WO2013092875A1 - Vaccines against hpv - Google Patents
Vaccines against hpv Download PDFInfo
- Publication number
- WO2013092875A1 WO2013092875A1 PCT/EP2012/076404 EP2012076404W WO2013092875A1 WO 2013092875 A1 WO2013092875 A1 WO 2013092875A1 EP 2012076404 W EP2012076404 W EP 2012076404W WO 2013092875 A1 WO2013092875 A1 WO 2013092875A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- accord ing
- protein
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39575—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from other living beings excluding bacteria and viruses, e.g. protozoa, fungi, plants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/521—Chemokines
- C07K14/523—Beta-chemokines, e.g. RANTES, I-309/TCA-3, MIP-1alpha, MIP-1beta/ACT-2/LD78/SCIF, MCP-1/MCAF, MCP-2, MCP-3, LDCF-1, LDCF-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/081—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from DNA viruses
- C07K16/084—Papovaviridae, e.g. papillomavirus, polyomavirus, SV40, BK virus, JC virus
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6056—Antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/64—Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/80—Vaccine for a specifically defined cancer
- A61K2039/892—Reproductive system [uterus, ovaries, cervix, testes]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/735—Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20071—Demonstrated in vivo effect
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
Definitions
- the present invention relates to therapeutic compounds, such as vaccines against human papillomavirus (HPV) and in particu lar to DNA vaccines against H PV16 and/or H PV18.
- the invention further relates to protein construct encoding homod imeric peptides, which peptides may be released from a DNA vaccine or used separately. Further described are
- H PV16 and H PV 18 are responsible for about 70% of all cervical cancers worldwide.
- prophylactic HPV vaccines are on the market (Gardasil and Cervarix) .
- the aim of the prophylactic vaccines is to induce humoral immune responses by stimulating the production of neutralizing antibod ies specific for the HPV viral ca psid proteins, LI and L2.
- tumor-associated applied as vaccines are critical in order to induce tumor-specific immune responses and avoid killing of healthy cells in the patients which may lead to serious adverse events.
- the major challenges in cancer immunotherapy are to break the immunological tolerance and activate tumor-specific effector functions to recog nize and kill tumor cells.
- Althoug h some case reports show clinical response to therapeutic cancer vaccines in late stage tumor patients, the most common primary end point is to observe the impact on overall survival compared to conventional therapy (surgery, chemo and rad iation therapy) . However, most studies are either not conclusive or that they completely fail to show this.
- One reason for the negative results lies in the patient g roup carrying end-stage tumors that are challeng ing to treat in the first place.
- a possible strategy cou ld be to include patients with early-stage tumors in therapeutic vaccine trials.
- One strategy is to target pre-cancerous lesions.
- the challenges for this strategy are mainly the lack of reliable biomarkers that are specifically expressed by precancerous lesions for many tissues and poor med ical screening (either non-existing or that the existing method suffers from lack of sensitivity) . Exceptionally, this is not the case for H PV-induced malignancies.
- the majority of western countries have good screening programs for cervical dysplasia and cervical cancer by performing the Papanicolaou test (Pap smear test) . If there are unclear or abnormal results from Pap smear test, colposcopy will be performed (National Cervical Cancer Coalition) .
- HPV-testing may also be recommended for some patients to detect the presence of "hig h-risk" HPV-type in the precancerous lesion.
- HPV represents a potential biomarker for HPV-associated precancerous lesions, in particu lar cervical intraepithelial dysplasia (CIN).
- DNA vaccines have shown increasing promise for the treatment of human d iseases, in particu lar cancer. DNA vaccines induce strong antigen-specific immune responses and can be repeatedly administered to maintain the target-specific immune responses. Such vaccines are considered to be safe and simple and cheap to produce on a large scale compared to other cancer therapeutic formats. Numerous immunotherapeutic interventions fail to induce immunolog ical memory.
- DNA vaccination ensures sustained release of the vaccine product in vivo which enhances antigen-specific immunolog ical memory.
- Direct delivery of antigens to professional antigen-presenting cells (APCs) stimulates both CD4+ and CD8+ T cell immune responses in vivo.
- APCs professional antigen-presenting cells
- Such strong cellu lar immune responses have been demonstrated to specifically recognize and kill antigen-positive malignant cells efficiently both in vitro and in vivo.
- therapeutic vaccines are provided, wherein the strong immu nogenic epitopes of H PV gene products are presented with high efficiency to APCs to induce a specific and strong immune response.
- the products accord ing to the present invention is primarily envisioned as therapeutic nucleic acid vaccines, such as DNA vaccines, wherein a nucleic acid construct encod ing the vaccibody construct is used as the therapeutic compound lead ing to in vivo production of the protein product within the person receiving the vaccine.
- the protein product itself may be formulated and used directly in the vaccine.
- the present invention relates to a homod imeric protein of two identical amino acid chains, each amino acid chain comprising ( 1) a signal peptide, (2) a targeting unit, (3) a dimerization motif, and (4) an antigenic unit, said targeting unit comprising an amino acid sequence having at least 80 % sequence identity to the amino acid sequence 24-93 of SEQ ID NO : l, and an antigenic unit comprising an amino acid sequence of human papillomavirus (HPV), such as an antigenic unit comprising an amino acid sequence of H PV16 and/or H PV18, such as an antigenic unit derived from early proteins E6 and/or E7 of H PV16 and/or H PV18.
- HPV human papillomavirus
- the present invention relates to an amino acid chain comprising (1) a sig nal peptide, (2) a targeting unit, (3) a d imerization motif, and (4) an antigenic unit, said targeting unit comprising an amino acid sequence having at least 80 % sequence identity to the amino acid sequence 24-93 of SEQ ID NO : l, and an antigenic unit comprising an amino acid sequence of human papillomavirus (HPV), such as an antigenic u nit comprising an amino acid sequence of HPV16 and/or H PV18, such as an antigenic unit derived from early proteins E6 and/or E7 of HPV16 and/or H PV18, which amino acid chain is able to form a homodimeric protein accord ing to the invention.
- HPV human papillomavirus
- the present invention relates to a nucleic acid molecu le, such as a DNA, encod ing an amino acid chain comprising (1) a sig nal peptide, (2) a targeting unit, (3) a d imerization motif, and (4) an antigenic unit, said targeting unit comprising an amino acid sequence having at least 80 % sequence identity to the amino acid sequence 24-93 of SEQ ID NO : l, and an antigenic unit comprising an amino acid sequence of human papillomavirus (H PV), such as an antigenic unit comprising an amino acid sequence of H PV16 and/or H PV18, such as an antigenic unit derived from early proteins E6 and/or E7 of H PV16 and/or HPV18, which amino acid chain is able to form a homod imeric protein accord ing to the invention.
- H PV human papillomavirus
- the present invention relates to a homodimeric protein according to the invention, or an amino acid chain accord ing to the invention, or the nucleic acid molecule accord ing to the invention for use as a med icament.
- the present invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising a homod imeric protein accord ing to the invention, or an amino acid chain accord ing to the invention, or the nucleic acid molecu le accord ing to the invention.
- the present invention relates to a host cell comprising the nucleic acid molecu le accord ing to the invention.
- the present invention relates to a method for preparing a homod imeric protein accord ing to the invention, or an amino acid chain of the invention, the method comprising a) transfecting the nucleic acid molecu le accord ing to the invention into a cell popu lation; b) cu lturing the cell population; c) collecting and purifying the homod imeric protein, or am ino acid chain expressed from the cell population.
- the present invention relates to a method for preparing a vaccine, such as a DNA vaccine, comprising an immu nologically effective amount of a nucleic acid molecule accord ing to the invention, the method comprising a) preparing a nucleic acid molecu le accord ing to the invention; b) dissolving the nucleic acid molecule obtained under step a) in a pharmaceutically acceptable carrier, d iluent, or buffer.
- the present invention relates to a vaccine against HPV comprising an immunolog ically effective amount of a homod imeric protein accord ing to the invention, or an amino acid chain according to the invention, or nucleic acid molecu le, such as a DNA, accord ing to the invention, wherein said vaccine is able to trigger both a T-cell- and B-cell immune response.
- the present invention relates to a method of treating or preventing a H PV induced d isease or cond ition, such as a cancer or an infectious d isease caused by HPV in a patient, the method comprising administering to the patient in need thereof, a homodimeric protein accord ing to the invention, or an amino acid chain accord ing to the invention, or the nucleic acid molecule, such as a DNA, accord ing to the invention.
- FIG. 1 The overall structure of vaccibody vaccines with E7/E6 fusion antigen. Shown are both DNA and protein formats.
- the vaccibody consist of three functional modules; the chemokine human ⁇ - ⁇ ( ⁇ _ ⁇ 78 ⁇ ) in the targeting module, hinge and CH3 sequences from human IgG3 in the d imerization modu le and fu ll-length E7 and/or E6 fusion in the vaccine module.
- FIG. 2 The suggested mode of action for a Vaccibody DNA vaccine against H PV -induced malignancies. Naked DNA plasmid encod ing vaccibody is injected intradermal followed by electroporation. The plasmid is taken up by local cells and vaccibody proteins are produced and secreted . The chemotactic targeting modu les attract CCRl and CCR5 expressing antigen presenting cells (APC) and ensure bind ing and u ptake into dend ritic cells (DC) . The DC will present antigenic peptides to CD4+ and CD8+ T cells and the CD8+ T cells will kill H PV infected and transformed cells in the cervix.
- APC antigen presenting cells
- DC dend ritic cells
- FIG. 3 ELISPOT results showing the number of E7 and E6 specific T cell responses as a function of d ifferent amounts of vaccine administered .
- C57BL/6 mice were injected i.d . with naked DNA plasmids encod ing VB1009 and VB1016 and their correspond ing controls followed by electroporation (Cellectis, France) on day 0 and day 7.
- Splenocytes were harvested at day 21 and stimu lated with M HC class I-restricted E7 or E6 peptide for 24h. The number of IFNy secreting splenocytes was calculated by ELISPOT.
- Figure 4 Therapeutic effect of VB1016 shown by measured tumor volume.
- C57BL/6 mice were injected s.c. with 5xl0 5 TC-1 cells at day 0. At day 3 and day 10, the mice were injected i.d . with 12.5pg naked DNA plasmids encod ing VB1016, control 2 or empty vector followed by electroporation (Cellectis, France) . The tumor sizes were measured by caliper two to three times a week and tumor volume calculated .
- Figure 5. Therapeutic effect of VB1016 shown by measured tumor volume.
- C57BL/6 mice were injected s.c. in the neck area with 5xl0 4 TC-1 cells at day 0. At day 3,7 and day 10, the mice were injected i.d .
- FIG. 6 Therapeutic effect of VB1020 and VB1021 shown by measu red tumor volume.
- C57BL/6 mice were injected s.c. in the thig h with 5xl0 4 TC-1 cells at day 0.
- the mice were injected i.d . with 10pg naked DNA plasmids encod ing VB1016, VB1020, VB1021 or empty vector followed by electroporation (Cellectis, France) .
- the tumor sizes were measured by caliper two to three times a week and tumor volume calculated .
- the constructs and DNA vaccine technology described herein by the inventors of the present invention represents a novel vaccine strategy to induce strong and specific immune responses for both infectious d iseases and cancer.
- the HPV E6/E7 such as HPV16 or H PV18 E6/E7 vaccine described herein may be administered as a DNA vaccine by intradermal injection, preferably followed by
- the early gene products E6 and E7 from "high-risk" H PV types such as HPV16 and 18 may be responsible for transformation of the basal-epithelium cells and induction of precancerous lesions.
- Both proteins consist of hig hly immunogenic epitopes and are shown herein to induce strong immune responses lead ing to specific erad ication of "hig h-risk" HPV positive tumor cells both in vitro and in vivo.
- vaccibody molecu le described herein is a homod imer consisting of three modules
- the vaccibody molecule targets antigen presenting cells (APCs) which results in an enhanced vaccine potency compared to identical, non-targeted antigens.
- APCs antigen presenting cells
- the vaccibody molecule consisting of hMIP-la as the targeting module, will not only target the antigens to specific cells, but in add ition g ive a response- amplifying effect (adjuvant effect) by recruiting specific immune cells to the injection site.
- This unique mechanism may be of g reat importance in a clinical setting where patients can receive the vaccine without any add itional adjuvants since the vaccine itself g ives the adjuvant effect.
- the inventors of the present invention describes herein vaccine constructs where the antigenic module consist of the E7 full length genetic sequence in fusion to the E6 full length sequence orig inating from the HPV16 or H PV18 subtype.
- the mutations, includ ing deletions, may be introduced at specific sites, known to inhibit the oncogenic properties of E6 and E7, such as any one described in any of Dalai S et al., J Virol, 1996; Munger K et al., EM BO, 1989; Nakagawa S et al., Virology, 1995; Crook T et al., Cell, 1991; Munger K et al., HPV Compendium Online, 1997
- the constructs accord ing to the present invention contain H PV16 E6, E7 or HPV16 E6/E7 chimeric constructs with one or more mutations in either of HPV16 E6, E7 or both at a position known to inhibit the oncogenic properties as described in Dalai S et al., J Virol, 1996; Mu nger K et al., EMBO, 1989;
- the constructs accord ing to the present invention contain HPV18 E6, E7 or H PV18 E6/E7 chimeric constructs with one or more mutations in either of HPV18 E6, E7 or both at a position known to inhibit the oncogenic properties as described in Dalai S et al., J Virol, 1996; Munger K et al., EM BO, 1989; Nakagawa S et al., Virology, 1995; Crook T et al., Cell, 1991 ; Munger K et al., H PV Compend ium Online, 1997
- vaccibody-moiety targeting and d imerization modules
- the vaccibody-moiety may erad icate the oncogenic properties of E6 and E7 wildtype proteins in the final fusion protein.
- the vaccibody-moiety targeting and d imerization modules
- the vaccibody-moiety may erad icate the oncogenic properties of E6 and E7 wildtype proteins in the final fusion protein.
- the vaccibody-moiety targeting and d imerization modules
- the vaccibody-moiety may erad icate the oncogenic properties of E6 and E7 wildtype proteins in the final fusion protein.
- the vaccibody-moiety targeting and d imerization modules
- the invention describes several variant of Vaccibody H PV therapeutic DNA vaccines all based on the overall format described in figure 1, the therapeutic vaccibody-H PV DNA vaccines encodes genes that are naturally expressed in humans; the targeting module genes encode the chemokine hMIP-la, which binds to its cog nate receptors, CCR1 and CCR5 expressed on the cell surface of APCs.
- the dimerization module genes may encode hinge regions and constant heavy chain 3, such as from human IgG3 which connects two vaccibody monomers generating a homod imer molecu le.
- Genes encod ing the vaccine module for the current strategy consist of HPV, such as H PV16 and/or HPV18 E7 and E6 antigens, such as the full length HPV16 E7 and E6 antigens, optionally comprising one or more mutation to inhibit the oncogenic properties.
- HPV such as H PV16 and/or HPV18 E7 and E6 antigens, such as the full length HPV16 E7 and E6 antigens, optionally comprising one or more mutation to inhibit the oncogenic properties.
- the hMIP-la targeting unit may be connected through a d imerization motif, such as a hinge reg ion, to an antigenic unit, wherein the later is in either the COOH-terminal or the N H2-terminal end .
- the present invention not only relates to a DNA sequence cod ing for this recombinant protein, but also to expression vectors comprising these DNA sequences, cell lines comprising said expression vectors, to treatment of mammals preferentially by immunization by means of Vaccibody DNA, Vaccibody RNA, or Vaccibody protein, and finally to pharmaceuticals and a kit comprising the said molecules.
- the d imerization motif in the proteins accord ing to the present invention may be constructed to include a hinge reg ion and an immunoglobulin domain (e.g . Cy3 domain), e.g .
- the hinge reg ion may be Ig derived and contributes to the d imerization through the formation of an interchain covalent bond (s), e.g . disu lfide bridge(s) .
- s interchain covalent bond
- disu lfide bridge(s) e.g . disu lfide bridge(s) .
- it functions as a flexible spacer between the domains allowing the two targeting units to bind simu ltaneously to two target molecu les on APC expressed with variable distances.
- the immunoglobulin domains contribute to homod imerization throug h non-covalent interactions, e.g . hyd rophobic interactions.
- the C H 3 domain is derived from IgG .
- These d imerization motifs may be exchanged with other multimerization moieties (e.g . from other Ig isotypes/subclasses) .
- the dimerization motif is derived from native human proteins, such as human IgG.
- the d imerization motif may have any orientation with respect to antigenic unit and targeting unit.
- the antigenic unit is in the COOH- terminal end of the d imerization motif with the targeting unit in the N-terminal end of the d imerization motif.
- the antigenic unit is in the N-terminal end of the d imerization motif with the targeting unit in the COOH-terminal end of the d imerization motif.
- the proteins according to the present invention include an antigenic unit derived from HPV, such as HPV16 E7 and E6 antigens, such as the full length HPV16 E7 and E6 antigens, as well as immunogenic fragments or variants thereof.
- the antigenic sequence shou ld be of sufficient length.
- the minimal length of such antigenic unit may be around 9 amino acids.
- the antigenic unit derived from H PV comprises an amino acid sequence of at least 9 amino acids corresponding to at least about 27 nucleotides in a nucleic acids sequence encod ing such antigenic unit.
- the antigenic u nit derived from H PV is considerably longer, such as the full length H PV16 E7 and E6 antigens.
- the present invention relates to a vaccine composition against cancer or infectious d iseases caused by H PV, the vaccine composition comprising an immunolog ically effective amount of the nucleic acid encod ing the molecu le of the invention or degenerate variants thereof.
- the vaccine may be able to trigger both a T-cell- and B-cell immune response.
- the present invention also relates to a kit comprising Vaccibody DNA, RNA, or protein for diagnostic, medical or scientific purposes.
- the invention further relates to a method of preparing the recombinant molecule of the invention comprising, transfecting the vector comprising the molecule of the invention into a cell population; culturing the cell population; collecting recombinant protein expressed from the cell population; and purifying the expressed protein.
- the above described nucleotide sequences may be inserted into a vector suited for gene therapy, e.g. under the control of a specific promoter, and introduced into the cells.
- the vector comprising said DNA sequence is a virus, e.g. an adenovirus, vaccinia virus or an adeno-associated virus.
- a retroviruses is used as vector. Examples of suitable retroviruses are e.g. MoMuLV or HaMuSV.
- the DNA/RNA sequences according to the invention can also be transported to the target cells in the form of colloidal dispersions. They comprise e.g. liposomes or lipoplexes.
- the present invention encompasses the use of a targeting unit as well as an antigenic unit having minimum degree of sequence identity or sequence homology with amino acid sequence(s) defined herein or with a polypeptide having the specific properties defined herein.
- the present invention encompasses, in particular, the use of peptide variants or peptide units to be used in the constructs according to the present invention having a degree of sequence identity with any one of SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:ll, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, or SEQ ID NO:
- variable means an entity having a certain degree of sequence identity with the subject amino acid sequences or the subject nucleotide sequences, where the subject amino acid sequence preferably is SEQ ID NO:l, SEQ ID NO:2, SEQ ID NO:3,
- the variant or fragment amino acid sequence and/or nucleotide sequence should provide and/or encode a polypeptide which retains the functional activity and/or enhances the activity of a polypeptide of SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:ll, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO : 19, SEQ ID NO : 21, SEQ ID NO : 22, SEQ ID NO : 23, SEQ ID NO : 24, SEQ ID NO : 25, SEQ ID NO : 26, SEQ ID NO : 27, SEQ ID NO : 28, SEQ ID NO : 29, SEQ ID NO : 30, SEQ ID NO : 32, or SEQ ID NO : 34.
- a variant sequence is taken to include an amino acid sequence which may be at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, identical to the subject sequence.
- the variants used accord ing to the present invention will comprise the same active sites etc. as the subject amino acid sequence.
- Althoug h homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity.
- Sequence identity comparisons can be conducted by eye, or more usually, with the aid of read ily available sequence comparison computer programs.
- These commercially available computer prog rams use complex comparison algorithms to alig n two or more sequences that best reflect the evolutionary events that might have led to the d ifference(s) between the two or more sequences. Therefore, these algorithms operate with a scoring system rewarding alig nment of identical or similar amino acids and penalising the insertion of gaps, gap extensions and alig nment of non-similar amino acids.
- the scoring system of the comparison algorithms include : i) assignment of a penalty score each time a gap is inserted (gap penalty score), ii) assignment of a penalty score each time an existing gap is extended with an extra position (extension penalty score), iii) assignment of high scores upon alignment of identical amino acids, and iv) assignment of variable scores upon alignment of non-identical amino acids.
- the scores g iven for alig nment of non-identical amino acids are assigned accord ing to a scoring matrix also called a substitution matrix.
- the scores provided in such substitution matrices are reflecting the fact that the likelihood of one amino acid being substituted with another during evolution varies and depends on the physical/chemical nature of the amino acid to be substituted . For example, the likelihood of a polar amino acid being substituted with another polar amino acid is hig her compared to being substituted with a hydrophobic amino acid . Therefore, the scoring matrix will assign the hig hest score for identical amino acids, lower score for non-identical but similar amino acids and even lower score for non- identical non-similar amino acids.
- the most frequently used scoring matrices are the PAM matrices (Dayhoff et al. ( 1978), Jones et al. (1992)), the BLOSUM matrices (Henikoff and Henikoff (1992)) and the Gonnet matrix (Gonnet et al. (1992)) .
- Suitable computer prog rams for carrying out such an alig nment include, but are not limited to, Vector NTI (Invitrogen Corp.) and the ClustalV, ClustalW and ClustalW2 programs (H igg ins DG & Sharp PM (1988), H igg ins et al. (1992), Thompson et al. (1994), Larkin et al. (2007) .
- the software Once the software has produced an alig nment, it is possible to calculate % similarity and % sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.
- ClustalW software for performing sequence alig nments.
- alignment with ClustalW is performed with the following parameters for pairwise alignment:
- ClustalW2 is for example made available on the internet by the European Bioinformatics Institute at the EM BL-EBI webpage www.ebi.ac.uk under tools - sequence analysis - ClustalW2. Currently, the exact add ress of the ClustalW2 tool is
- Gap extension penalty 0.05
- the present invention also encompasses the use of variants, fragments, and derivatives of any amino acid sequence of a protein, polypeptide, motif or domain as defined herein, particularly those of SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:ll, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, or SEQ ID NO:34.
- sequences particularly those of variants, fragments, and derivatives of SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:ll, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID
- SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, or SEQ ID NO:34 may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent substance.
- Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues as long as the secondary binding activity of the substance is retained.
- negatively charged amino acids include aspartic acid and glutamic acid; positively charged amino acids include lysine and arginine; and amino acids with uncharged polar head groups having similar hydrophilicity values include leucine, isoleucine, valine, glycine, alanine, asparagine, glutamine, serine, threonine, phenylalanine, and tyrosine.
- the present invention also encompasses conservative substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue, with an alternative residue) that may occur i.e. like-for-like substitution such as basic for basic, acidic for acidic, polar for polar etc.
- Non-conservative substitution may also occur i.e. from one class of residue to another or alternatively involving the inclusion of unnatural amino acids such as ornithine (hereinafter referred to as Z), diaminobutyric acid ornithine (hereinafter referred to as B), norleucine ornithine (hereinafter referred to as O),
- Conservative substitutions that may be made are, for example within the groups of basic amino acids (Arginine, Lysine and Histidine), acidic amino acids (glutamic acid and aspartic acid), aliphatic amino acids (Alanine, Valine, Leucine, Isoleucine), polar amino acids
- Variant amino acid sequences may include suitable spacer groups that may be inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or ⁇ -alanine residues.
- a further form of variation involves the presence of one or more amino acid residues in peptoid form, will be well understood by those skilled in the art. For the avoidance of doubt,
- the peptoid form is used to refer to variant amino acid residues wherein the oc-carbon substituent group is on the residue's nitrogen atom rather than the oc-carbon.
- Processes for preparing peptides in the peptoid form are known in the art, for example Simon RJ et al.
- the variant targeting unit used in the homodimeric protein according to the present invention is variant having the sequence of amino acids at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% amino acid sequence identity therewith.
- the protein or sequence used in the present invention is in a purified form.
- purified means that a given component is present at a high level.
- the component is desirably the predominant active component present in a composition.
- a "variant” or “variants” refers to proteins, polypeptides, units, motifs, domains or nucleic acids.
- variant may be used interchangeably with the term “mutant.”
- Variants include insertions, substitutions, transversions, truncations, and/or inversions at one or more locations in the amino acid or nucleotide sequence, respectively.
- variant polypeptide means a polypeptide/protein that has an amino acid sequence that has been modified from the amino acid sequence of SEQ ID NO: 1.
- the variant polypeptides include a polypeptide having a certain percent, e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, of sequence identity with the amino acid sequence of SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:ll, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID
- Variant nucleic acids can include sequences that are complementary to sequences that are capable of hybridizing to the nucleotide sequences presented herein.
- the term variant encompasses sequences that are complementary to sequences that are capable of hybridizing under highly stringent conditions, e.g., 65°C and 0.1X SSC, to the nucleotide sequences presented herein.
- the melting point (Tm) of a variant nucleic acid may be about 1, 2, or 3°C lower than the Tm of the wild-type nucleic acid.
- the variant nucleic acids include a polynucleotide having a certain percent, e.g., 80%, 85%, 90%, 95%, or 99%, of sequence identity with the nucleic acid encoding SEQ ID NO:l, SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:ll, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID
- a specific category of mutations are the mutations in E6 and E7:
- the E6 protein may be detoxified by rendering the p53 binding impossible.
- Five positions in the full length HPV16 E6 protein are sites for mutations for inactivation of E6 functionality, F47, L50, C63, C106 and 1128. Any amino acid substitution in these positions may lead to inactivation of E6 and induces tumor suppression. Substitutions in any one of these positions with any one different amino acid may potentially be utilized. Sites for potential mutations are shown in SEQ ID NO:22.
- Signal peptide A sig nal peptide at the N-terminal end of the nascent polypeptide d irects the molecu le into the ER before transport to into the Golgi complex.
- the signal peptide is cleaved off by sig nal peptidase once it has served its purpose of targeting and importing the protein to the ER.
- These signal peptides are generally between 15 and 30 amino acids, but can have more than 50 residues (Martoglio, B. et al., Trends in Cell Biology, 1998, Knappskog, S. et al., J
- the native signal peptide may be replaced by signal peptides from any mammalian, prokaryotic or marine origin.
- Commonly used sig nal peptides are e.g . humanlL- 2 and human albumin due to their natural ability to secrete large amounts of protein. The choice of sig nal peptide can have a considerable impact on the amount of synthesized and secreted protein.
- the sig nal peptide used in the protein construct accord ing to the present invention is derived from a chemokine protein, such as the signal sequence of LD78beta.
- the signal peptide is not derived from pLNOH2 (Bl-8 variable immunog lobulin leader) d isclosed in the international application with International
- the signal peptide is not derived from an immunog lobulin gene.
- homodimeric protein refers to a protein comprising two ind ividual identical strands of amino acids, or subunits held together as a sing le, d imeric protein by hydrogen bond ing, ionic (charged) interactions, actual covalent disulfide bonding, or some combination of these interactions.
- dimerization motif refers to the sequence of amino acids between the antigenic unit and the targeting unit comprising the hinge reg ion and the optional second domain that may contribute to the d imerization. This second domain may be an
- the d imerization motif serves to connect the antigenic unit and the targeting unit, but also contain the hinge region that facilitates the dimerization of the two monomeric proteins into a homod imeric protein accord ing to the invention.
- the term "targeting unit” as used herein refers to a unit that delivers the protein with its antigen to mouse or human APC for MHC class Il-restricted presentation to CD4+ T cells or for provid ing cross presentation to CD8+ T cells by M HC class I restriction.
- the targeting unit used in the constructs accord ing to the present invention is derived from or identical to mature LD78-beta.
- antigenic unit refers to any molecule, such as a peptide which is able to be specifically recognized by an antibody or other component of the immune system, such as a surface receptor on T-cells. Included within this definition are also immunogens that are able to induce an immune response.
- epitope or “antigenic epitope” is used to refer to a distinct molecular surface, such as a molecular surface provided by a short peptide sequence within an antigenic unit. In some embod iments the antigenic unit comprises two ore more antigenic epitopes.
- the antigenic unit used in the constructs accord ing to the present invention is derived from or identical to the early gene products E6 and E7 from H PV, such as from HPV16 or HPV18.
- the term "hinge region" refers to a peptide sequence of the homod imeric protein that facilitates the d imerization, such as throug h the formation of an interchain covalent bond(s), e.g . d isulfide bridge(s) .
- the hinge reg ion may be Ig derived, such as hinge exons hl + h4 of an Ig, such as IgG3.
- the present invention relates to a homod imeric protein of two identical amino acid chains, each amino acid chain comprising (1) a sig nal peptide, (2) a targeting unit, (3) a dimerization motif, and (4) an antigenic unit, said targeting unit comprising an amino acid sequence having at least 80 % sequence identity to the amino acid sequence 24- 93 of SEQ ID NO : l, and an antigenic unit comprising an am ino acid sequence of human papillomavirus (HPV), such as an antigenic unit comprising an amino acid sequence of H PV16 and/or H PV18, such as an antigenic unit derived from early proteins E6 and/or E7 of H PV16 and/or H PV18.
- HPV human papillomavirus
- the targeting unit, d imerization motif and antigenic unit in the amino acid chain are in the N-terminal to C- terminal order of targeting unit, d imerization motif and antigenic unit.
- the antigenic unit used in the constructs accord ing to the present invention is derived from H PV16, such as from early proteins E6 and/or E7. In some embodiments, the antigenic unit used in the constructs according to the present invention is derived from E6 of HPV16.
- the antigenic unit used in the constructs according to the present invention is derived from E7 of HPV16. In some embodiments, the antigenic unit used in the constructs according to the present invention is derived from HPV18, such as from early proteins E6 and/or E7.
- the antigenic unit used in the constructs according to the present invention is derived from E6 of HPV18.
- the antigenic unit used in the constructs according to the present invention is derived from E7 of HPV18.
- the signal peptide consists of an amino acid sequence having at least 80 % sequence identity to the amino acid sequence 1- 23 of SEQ ID NO:l.
- the signal peptide consists of an amino acid sequence having at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99%, such as 100% sequence identity to the amino acid sequence 1-23 of SEQ ID NO:l.
- the targeting unit consists of an amino acid sequence having at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 24-93 of SEQ ID NO:l.
- the dimerization motif comprises a hinge region and optionally another domain that facilitate dimerization, such as an immunoglobulin domain, optionally connected through a linker.
- the hinge region is Ig derived, such as derived from IgG3.
- the hinge region has the ability to form one, two, or several covalent bonds.
- the covalent bond is a d isulphide bridge.
- the immunog lobulin domain of the d imerization motif is a carboxyterminal C domain, or a sequence that is substantially identical to the C doma in or a variant thereof.
- the carboxyterminal C domain is derived from IgG.
- the immunog lobulin domain of the d imerization motif has the ability to homod imerize.
- the immunog lobulin domain has the ability to homod imerize via noncovalent interactions.
- the noncovalent interactions are hydrophobic interactions.
- the d imerization domain does not comprise the CH2 domain.
- the d imerization motif consists of hinge exons hi and h4 connected throug h a linker to a C H 3 domain of human IgG3.
- the d imerization motif consist of an amino acid sequence having at least 80 % sequence identity to the amino acid sequence 94-237 of SEQ ID NO : 3.
- the linker is a G 3 S 2 G 3 SG linker.
- the antigenic u nit and the d imerization motif is connected through a linker, such as a GLGGL linker or a GLSGL linker.
- the targeting unit consists of amino acids 24-93 of SEQ ID NO : l, or a variant thereof.
- the homod imeric protein have increased affinity for any one chemokine receptor selected from CCR1, CCR3 and CCR5 as compared to the affinity of the same homod imeric protein with the targeting unit consisting of amino acids 24-93 of SEQ ID NO : l, or a variant thereof.
- the antigenic u nit comprises an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-293 of SEQ ID NO : 3.
- the antigenic u nit consists of an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-293 of SEQ ID NO : 3.
- the antigenic u nit comprises one or more amino acid substitutions at a position selected from the list consisting of F47, L50, C63, C106 and 1128 of SEQ ID NO : 22, or a deletion involving one or more amino acid selected from the list consisting of Y43-L50 of SEQ ID NO : 22.
- the antigenic u nit comprises not more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18 or 20 amino acid su bstitutions and/or deletions relative to SEQ ID NO : 22.
- the antigenic u nit comprises the amino acid sequence 243-293 of SEQ ID NO : 3, SEQ ID NO : 5, SEQ ID NO : 7, or SEQ ID NO :9, or a variant or antigenic fragment thereof.
- the antigenic u nit consists of the amino acid sequence 243-293 of SEQ ID NO : 3, SEQ ID NO : 5, SEQ ID NO : 7, or SEQ ID NO :9, or a variant or antigenic fragment thereof.
- the antigenic u nit comprises an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-340 of SEQ ID NO : 11.
- the antigenic u nit consists of an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-340 of SEQ ID NO : 11.
- the antigenic u nit comprises one or more amino acid substitutions at a position selected from the list consisting of C24, E26, C58, C61, C91, and C94 of SEQ ID NO : 23, or a deletion involving one or more amino acid selected from the list consisting of L22-E26 and/or C58-C61 and/or C91-S95 of SEQ ID NO : 23.
- the antigenic u nit comprises not more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18 or 20 amino acid su bstitutions and/or deletions relative to SEQ ID NO : 23.
- the antigenic u nit comprises the amino acid sequence 243-340 of SEQ ID NO : l l, SEQ ID NO : 13, SEQ ID NO : 15, or SEQ ID NO : 17, or a variant or antigenic fragment thereof.
- the antigenic u nit consists of the amino acid sequence 243-340 of SEQ ID NO : l l, SEQ ID NO : 13, SEQ ID NO : 15, or SEQ ID NO : 17, or a variant or antigenic fragment thereof.
- the antigenic u nit comprises an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-501 of SEQ ID NO: 19, SEQ ID NO:21, SEQ ID NO:32, or SEQ ID NO:34.
- the antigenic unit consists of an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to the amino acid sequence 243-501 of SEQ ID NO: 19, SEQ ID NO:21, SEQ ID NO:32, or SEQ ID NO:34.
- the antigenic unit comprising an amino acid sequence of human papillomavirus 16 (HPV16) derived from both early proteins E6 and E7.
- HPV16 human papillomavirus 16
- the antigenic unit comprising an amino acid sequence of human papillomavirus 18 (HPV18) derived from both early proteins E6 and E7.
- HPV18 human papillomavirus 18
- the antigenic unit comprises one or more amino acid substitutions at a position selected from the list consisting of F47, L50G, C63, C106, I128T of SEQ ID NO:22 and C24, E26, C58, C61, C91, C94 of SEQ ID NO:23. In some embodiments according to the present invention, the antigenic unit comprises not more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18 or 20 amino acid substitutions and/or deletions relative to SEQ ID NO:22 and SEQ ID NO:23.
- the antigenic unit consists of the amino acid sequence 243-501 of SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:32, or SEQ ID NO:34, or a variant or antigenic fragment thereof.
- the amino acid chain consists of an amino acid sequence selected from the list consisting of SEQ ID NO:3, SEQ ID NO:5, SEQ ID NO:7, SEQ ID NO:9, SEQ ID NO:ll, SEQ ID NO:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ ID NO:21, SEQ ID NO:32, and SEQ ID NO:34, or a variant or antigenic fragment thereof.
- the antigenic unit comprises an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to any one amino acid sequence selected from SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, and SEQ ID NO:25.
- the antigenic unit consist of an amino acid sequence having at least 80%, such as at least 81%, such as at least 82%, such as at least 83%, such as at least 84%, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99% sequence identity to any one amino acid sequence selected from SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, and SEQ ID NO:25.
- the homodimeric protein according to the present invention is in its mature form without any signal peptide sequence.
- nucleic acid molecule according to the present invention is human codon optimized.
- a human codon optimized nucleic acid molecule according to the present invention comprises one or more nucleic acid substitution as compared to the wild type sequence, which substitution provides for a codon with higher frequency of usage in human coding regions.
- Frequency of codon usage in homo sapiens can be found at http://biowiki.edu-wiki.org/en/codon_table
- nucleic acid molecule according to the present invention is comprising any one of nucleotide sequences selected from the list consisting of SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ID NO:14, SEQ ID NO:16, SEQ ID NO:18, SEQ ID NO:20, SEQ ID NO:31 and SEQ ID NO:33, or a variant thereof.
- nucleic acid molecule according to the present invention is comprised by a vector. In some embodiments the nucleic acid molecule according to the present invention is formulated for administration to a patient to induce production of the homodimeric protein in said patient.
- the vaccine according to the present invention further comprises a pharmaceutically acceptable carrier and/or adjuvant.
- the method of treating or preventing a HPV induced disease or condition, such as a cancer or an infectious disease caused by HPV in a patient according to the present invention comprises administering to the patient in need thereof of a nucleic acid molecule, such as a DNA, according to the present invention with a subsequent step of electroporation.
- the administration is performed intra dermal or intra muscular.
- Gene sequences were designed according to the following structure: 1: native leader sequence for human LD78 b, 2: full length LD78b sequence.3: Human hinge-region 1 from IgG3.4: Human hinge region 4 from IgG3.5: Glycine- Serine linker.6: Human CH3 domain from IgG3.7: Glycine-Leucine linker.8: wildtype and mutant Human papilloma virus oncogenes E6, E7 and fusion proteins of both E6 and E7 divided by a Glycine- Serine linker. The constructs are designated according to their E6 and or E7 composition as follows:
- VB1001 Vaccibody-E6 wild type
- VB1005 Vaccibody-E7 wild type
- mutants are designated according to the amino acid position in the corresponding native E6 or E7 sequence.
- VB1004 Vaccibody-E6 F47R, C63R, C106R;
- VB1006 Vaccibody-E7 C24G, E26G;
- VB1007 Vaccibody-E7 C24G, E26G, C58G, C61G;
- VB1008 Vaccibody-E7 C24G, E26G, C91G, C94G;
- VB1009 Vaccibody- E7 C24G, E26G/ E6 F47R, C63R, C106R;
- VB1016 Vaccibody- E7 C24G, E26G/ E6 C63R, C106R;
- VB1020 Vaccibody- E7 C24G, E26G/ E6 F47R, C63R, C106R human codon optimized
- VB1021 Vaccibody- E7 C24G, E26G/ E6 F47R, L50G, C106R, I128T human codon optimized
- Control 1 E7 C24G, E26G/ E6 F47R, C63R, C106R;
- Control 2 E7 C24G, E26G/ E6 C63R, C106R
- VB 1009,VB1016, VB1020 and VB1021 were selected as vaccine cand idates with their correspond ing controls 1 and 2 respectively.
- As a negative control empty pUMVC4a vector was utilized .
- VB1016, VB1020 and VB1021 with the correspond ing controls 1 and 2 were selected as the vaccine cand idate for therapeutic vaccine studies.
- mice 5xl0 4 or 5xl0 5 TC-1 cells (Johns Hopkins University, Baltimore, USA, Lin KY et al., Cancer Res, 1996) were injected in the neck or thigh reg ion of C57BI/6 mice. After days 3 and 10 or day 3,7 and 10, the mice were vaccinated with 2pg, 10pg, 12.5 pg or 20pg of plasmid DNA followed by electroporation, Dermavax, Cellectis France. Tumor size were measured two to three times a week up until day 49 after TC-1 cell injection ( Figure 4, 5 and 6)
- a therapeutic DNA vaccine to be used may be prepared by GM P manufactu ring of the plasmid vaccine accord ing to regulatory authorities' gu idelines, includ ing GMP cell banking, GM P manufactu ring of d rug substance and d rug product, ICH stability stud ies and Fill & Finish of the DNA vaccine.
- the DNA vaccine may be formulated by d issolving in a saline solution, such as ⁇ Tris, ImM EDTA at a concentration of 2-5 mg/ml.
- the vaccine may be administered either intra-derma l or intra-muscular with or without following electroporation.
- C-C motif chemokine 3-like 1 precursor including signal peptide (aa 1-23 in bold) and mature peptide (LD78-beta), aa 24-93 (SEQ ID NO : l) :
- vaccibody HPV constructs The specific DNA and correspond ing amino acid sequences of vaccibody HPV constructs :
- the d ifferent domains of the constructs are separated by an " I "with the domains in the following order: Sig nal peptide
- PRKLPQLCTELQTTIHDI ILECVYCKQQLLRREVYDFAFRDLCIVYRDGN PYAVRDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQK PLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL*
- PRKLPQLCTELQTTIHDI ILECVYCKQQLLRREVYDFAFRDLCIVYRDGN PYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINRQK PLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL*
- Protein sequence of VB1004 (Homod imeric construct accord ing to the invention, SEQ ID NO :9) : Amino acid sequence, 393 amino acids.
- Protein sequence of VB1006 (Homod imeric construct accord ing to the invention, SEQ ID NO : 13) : Am ino acid sequence, 340 amino acids .
- Protein sequence of VB1007 (Homod imeric construct accord ing to the invention, SEQ ID NO : 15) : Am ino acid sequence, 340 amino acids .
- Protein sequence of VB1008 (Homod imeric construct accord ing to the invention, SEQ ID NO : 17) : Amino acid sequence, 340 amino acids.
- the d ifferent domains of the constructs are separated by an " I " with the domains in the following order: Sig nal peptide
- Protein sequence of VB1016 (Homod imeric construct accord ing to the invention, SEQ ID NO : 21) : Am ino acid sequence, 501 amino acids
- Hinge regions IgG3 UH hinge
- 12 amino acids ELKTPLGDTTHT
- Hinge region (IgG3, MH hinge, 15 amino acids): EPKSCDTPPPCPRCP
- Gly-Ser Linker GGGSSGGGSG
- SEQ ID NO:31 DNA sequence of VB1020: ATGCAGGTCTCCACTGCTGCCCTTGCCGTCCTCCTCTGCACCATGGCTCTCTGCAACCAGGTCCTCTCT
- GCACCACTT GCTGCTGACACGCCGACCGCCTGCTGCTTCAGCTACACCTCCCGACAGATTCCACAGAATTTCATAGCTGACTACTTTG
- GAGCTCAAAACCCCACTTGGTGACACAACTCACAC A I GAGCCCAAATCTTGTGACACACCTCCCCCGTGCCCAAGGTGCCCA
- SEQ ID NO : 32 Protein sequence of VB1020 (Homod imeric construct according to the invention Amino acid sequence, 501 amino acids : MQVSTAALAVLLCTMALCNQVLS
- SEQ ID NO : 33 DNA sequence of VB1021 :
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Virology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Oncology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Toxicology (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Communicable Diseases (AREA)
- Tropical Medicine & Parasitology (AREA)
- Biomedical Technology (AREA)
- Botany (AREA)
- General Engineering & Computer Science (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA2858963A CA2858963C (en) | 2011-12-21 | 2012-12-20 | Vaccines against hpv |
| HK15103135.3A HK1202442B (en) | 2011-12-21 | 2012-12-20 | Vaccines against hpv |
| EP12809271.5A EP2793937B1 (en) | 2011-12-21 | 2012-12-20 | Vaccines against hpv |
| NZ626124A NZ626124B2 (en) | 2011-12-21 | 2012-12-20 | Vaccines against hpv |
| CN201280064089.7A CN104039833B (zh) | 2011-12-21 | 2012-12-20 | 针对hpv的疫苗 |
| JP2014548019A JP6258864B2 (ja) | 2011-12-21 | 2012-12-20 | Hpvに対するワクチン |
| ES12809271T ES2730718T3 (es) | 2011-12-21 | 2012-12-20 | Vacunas contra el VPH |
| RU2014129788A RU2644201C2 (ru) | 2011-12-21 | 2012-12-20 | Вакцины против hpv |
| DK12809271.5T DK2793937T3 (da) | 2011-12-21 | 2012-12-20 | Vacciner mod HPV |
| BR112014015016-8A BR112014015016B1 (pt) | 2011-12-21 | 2012-12-20 | Proteína homodimérica de duas cadeias de aminoácidos idênticas,cadeia de aminoácido, molécula de ácido nucléico, composição farmacêutica,célula hospedeira, método de preparação de uma proteína homodimérica, método de preparação de uma vacina e vacina |
| US14/365,536 US9901635B2 (en) | 2011-12-21 | 2012-12-20 | Vaccines against HPV |
| AU2012356969A AU2012356969B2 (en) | 2011-12-21 | 2012-12-20 | Vaccines against HPV |
| KR1020147020468A KR102057265B1 (ko) | 2011-12-21 | 2012-12-20 | Hpv에 대한 백신들 |
| EP19166523.1A EP3533462A1 (en) | 2011-12-21 | 2012-12-20 | Vaccines against hpv |
| IL233217A IL233217B (en) | 2011-12-21 | 2014-06-18 | Anti-human papillomavirus compounds |
| ZA2014/04516A ZA201404516B (en) | 2011-12-21 | 2014-06-19 | Vaccines against hpv |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161578542P | 2011-12-21 | 2011-12-21 | |
| US61/578,542 | 2011-12-21 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2013092875A1 true WO2013092875A1 (en) | 2013-06-27 |
Family
ID=47471832
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2012/076404 Ceased WO2013092875A1 (en) | 2011-12-21 | 2012-12-20 | Vaccines against hpv |
Country Status (17)
| Country | Link |
|---|---|
| US (1) | US9901635B2 (enExample) |
| EP (2) | EP3533462A1 (enExample) |
| JP (1) | JP6258864B2 (enExample) |
| KR (1) | KR102057265B1 (enExample) |
| CN (1) | CN104039833B (enExample) |
| AU (1) | AU2012356969B2 (enExample) |
| BR (1) | BR112014015016B1 (enExample) |
| CA (1) | CA2858963C (enExample) |
| DK (1) | DK2793937T3 (enExample) |
| ES (1) | ES2730718T3 (enExample) |
| HU (1) | HUE043361T2 (enExample) |
| IL (1) | IL233217B (enExample) |
| PT (1) | PT2793937T (enExample) |
| RU (1) | RU2644201C2 (enExample) |
| TR (1) | TR201908199T4 (enExample) |
| WO (1) | WO2013092875A1 (enExample) |
| ZA (1) | ZA201404516B (enExample) |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014140176A1 (en) * | 2013-03-15 | 2014-09-18 | Vaccibody As | Targeting vaccines for veterinary use |
| WO2016024255A1 (en) | 2014-08-15 | 2016-02-18 | Genexine, Inc. | Methods of treating cervical cancer |
| WO2019048928A1 (en) * | 2017-09-07 | 2019-03-14 | University Of Oslo | VACCINE MOLECULES |
| WO2019048936A1 (en) * | 2017-09-07 | 2019-03-14 | University Of Oslo | VACCINE MOLECULES |
| WO2021205027A1 (en) | 2020-04-09 | 2021-10-14 | Vaccibody As | Individualized therapeutic anticancer vaccine |
| WO2021219897A1 (en) | 2020-05-01 | 2021-11-04 | Vaccibody As | Betacoronavirus prophylaxis and therapy |
| JP7037884B2 (ja) | 2014-01-13 | 2022-03-17 | ベイラー リサーチ インスティテュート | Hpv及びhpv関連疾患に対する新規のワクチン |
| WO2022200590A1 (en) | 2021-03-26 | 2022-09-29 | Nykode Therapeutics ASA | Therapeutic combination for treating cancer |
| WO2022233851A1 (en) | 2021-05-03 | 2022-11-10 | Nykode Therapeutics ASA | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of infectious diseases |
| WO2022238395A1 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Tolerance-inducing constructs and compositions and their use for the treatment of immune disorders |
| WO2022238402A1 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Tolerance-inducing constructs and composition and their use for the treatment of immune disorders |
| WO2022238432A2 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Co-expression of constructs and immunoinhibitory compounds |
| WO2022238381A2 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Immunotherapy constructs for treatment of disease |
| WO2022238420A2 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Co-expression of constructs and immunostimulatory compounds |
| WO2022238363A1 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of infectious diseases |
| WO2023079001A1 (en) | 2021-11-03 | 2023-05-11 | Nykode Therapeutics ASA | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2 |
| US11883479B2 (en) | 2020-04-24 | 2024-01-30 | Genexine, Inc. | Method for treating cervical cancer |
| WO2024092025A1 (en) | 2022-10-25 | 2024-05-02 | Nykode Therapeutics ASA | Constructs and their use |
| WO2024100196A1 (en) | 2022-11-09 | 2024-05-16 | Nykode Therapeutics ASA | Co-expression of constructs and polypeptides |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MY195389A (en) * | 2015-08-20 | 2023-01-18 | Janssen Vaccines & Prevention Bv | Therapeutic HPV18 Vaccines |
| CA3008437A1 (en) | 2016-01-08 | 2017-07-13 | Vaccibody As | Therapeutic anticancer neoepitope vaccine |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6306397B1 (en) | 1994-12-20 | 2001-10-23 | Csl Limited | Variants of human papilloma virus antigens |
| WO2004076489A1 (en) | 2003-02-25 | 2004-09-10 | Medinnova As | Modified antibody |
| WO2005089792A1 (en) * | 2004-03-18 | 2005-09-29 | Institut Pasteur | Recombinant protein carrying human papillomavirus epitopes inserted in an adenylate cyclase protein or fragment thereof. therapeutic uses thereof |
| US20080102084A1 (en) | 2005-01-26 | 2008-05-01 | Tzyy-Choou Wu | Anti-cancer DNA Vaccine Employing Plasmids Encoding Mutant Oncoprotein Antigen and Calreticulin |
| WO2011161244A1 (en) * | 2010-06-25 | 2011-12-29 | Vaccibody As | Homodimeric protein constructs |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB9105383D0 (en) * | 1991-03-14 | 1991-05-01 | Immunology Ltd | An immunotherapeutic for cervical cancer |
| CN1720060B (zh) * | 2002-10-03 | 2011-12-14 | 惠氏控股公司 | 人乳头瘤病毒多肽和免疫原性组合物 |
-
2012
- 2012-12-20 RU RU2014129788A patent/RU2644201C2/ru active
- 2012-12-20 US US14/365,536 patent/US9901635B2/en active Active
- 2012-12-20 ES ES12809271T patent/ES2730718T3/es active Active
- 2012-12-20 AU AU2012356969A patent/AU2012356969B2/en active Active
- 2012-12-20 TR TR2019/08199T patent/TR201908199T4/tr unknown
- 2012-12-20 JP JP2014548019A patent/JP6258864B2/ja active Active
- 2012-12-20 PT PT12809271T patent/PT2793937T/pt unknown
- 2012-12-20 CA CA2858963A patent/CA2858963C/en active Active
- 2012-12-20 EP EP19166523.1A patent/EP3533462A1/en not_active Withdrawn
- 2012-12-20 WO PCT/EP2012/076404 patent/WO2013092875A1/en not_active Ceased
- 2012-12-20 HU HUE12809271A patent/HUE043361T2/hu unknown
- 2012-12-20 CN CN201280064089.7A patent/CN104039833B/zh active Active
- 2012-12-20 BR BR112014015016-8A patent/BR112014015016B1/pt active IP Right Grant
- 2012-12-20 KR KR1020147020468A patent/KR102057265B1/ko active Active
- 2012-12-20 DK DK12809271.5T patent/DK2793937T3/da active
- 2012-12-20 EP EP12809271.5A patent/EP2793937B1/en active Active
-
2014
- 2014-06-18 IL IL233217A patent/IL233217B/en active IP Right Grant
- 2014-06-19 ZA ZA2014/04516A patent/ZA201404516B/en unknown
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6306397B1 (en) | 1994-12-20 | 2001-10-23 | Csl Limited | Variants of human papilloma virus antigens |
| WO2004076489A1 (en) | 2003-02-25 | 2004-09-10 | Medinnova As | Modified antibody |
| WO2005089792A1 (en) * | 2004-03-18 | 2005-09-29 | Institut Pasteur | Recombinant protein carrying human papillomavirus epitopes inserted in an adenylate cyclase protein or fragment thereof. therapeutic uses thereof |
| US20080102084A1 (en) | 2005-01-26 | 2008-05-01 | Tzyy-Choou Wu | Anti-cancer DNA Vaccine Employing Plasmids Encoding Mutant Oncoprotein Antigen and Calreticulin |
| WO2011161244A1 (en) * | 2010-06-25 | 2011-12-29 | Vaccibody As | Homodimeric protein constructs |
Non-Patent Citations (28)
| Title |
|---|
| Ã YNEBRÃTEN I ET AL: "P19-39. Vaccibodies: a novel vaccine strategy for HIV that target viral antigens to APC", RETROVIROLOGY, BIOMED CENTRAL LTD., LONDON, GB, vol. 6, no. Suppl 3, 22 October 2009 (2009-10-22), pages P359, XP021064082, ISSN: 1742-4690, DOI: 10.1186/1742-4690-6-S3-P359 * |
| AGNETE BRUNSVIK FREDRIKSEN ET AL: "Chemokine-idiotype fusion DNAvaccines are potentiated by bivalency and xenogeneic sequences", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US, vol. 110, 1 January 2007 (2007-01-01), pages 1797 - 1805, XP007915509, ISSN: 0006-4971, [retrieved on 20070531], DOI: 10.1182/BLOOD-2006-06-032938 * |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| CROOK T ET AL., CELL, 1991 |
| DALAL S ET AL., J VIROL, 1996 |
| DALAL S ET AL., VIROL, 1996 |
| FREDRIKSEN ET AL: "DNA Vaccines Increase Immunogenicity of Idiotypic Tumor Antigen by Targeting Novel Fusion Proteins to Antigen-Presenting Cells", MOLECULAR THERAPY, ACADEMIC PRESS, SAN DIEGO, CA, US, vol. 13, no. 4, 1 April 2006 (2006-04-01), pages 776 - 785, XP005358612, ISSN: 1525-0016, DOI: 10.1016/J.YMTHE.2005.10.019 * |
| FROYLAND MARIANNE ET AL: "Targeted idiotype-fusion DNA vaccines for human multiple myeloma: preclinical testing", EUROPEAN JOURNAL OF HAEMATOLOGY, vol. 86, no. 5, May 2011 (2011-05-01), pages 385 - 395, XP055056142 * |
| GULLIVER ET AL., J VIROL, 1997 |
| KNAPPSKOG, S. ET AL., BIOTECHNOL, 2007 |
| LIN KY ET AL., CANCER RES, 1996 |
| MA B ET AL., CURRENT CANCER THERAPY REVIEWS, 2010 |
| MARTOGLIO, B. ET AL., TRENDS IN CELL BIOLOGY, 1998 |
| MESPLEDE T ET AL., VIROL, 2012 |
| MOODY C ET AL., NAT REV CANCER, 2010 |
| MÜNGER K ET AL., EMBO, 1989 |
| MUNGER K ET AL., EMBO, pages 1989 |
| MUNGER K ET AL., HPV COMPENDIUM ONLINE, 1997 |
| MÜNGER K ET AL., HPV COMPENDIUM ONLINE, 1997 |
| NAKAGAWA S ET AL., VIROLOGY, 1995 |
| NGUYEN, M ET AL., VIROL, 2002 |
| NOMINÉ Y, MOLECULAR CELL, 2006 |
| PHELPS ET AL., J. VIROL, vol. 66, April 1992 (1992-04-01), pages 42418 - 242 |
| POLAKOVA L ET AL., VACCINE, 2010 |
| POLAKOVA LET, VACCINE, 2010 |
| RUFFINI P A ET AL: "Human chemokine MIP1alpha increases efficiency of targeted DNA fusion vaccines", VACCINE, ELSEVIER LTD, GB, vol. 29, no. 2, 16 December 2010 (2010-12-16), pages 191 - 199, XP027539078, ISSN: 0264-410X, [retrieved on 20101104] * |
| TUNHEIM GRO ET AL: "Human receptors of innate immunity (CD14, TLR2) are promising targets for novel recombinant immunoglobulin-based vaccine candidates", VACCINE, vol. 25, no. 24, June 2007 (2007-06-01), pages 4723 - 4734, XP022095376, ISSN: 0264-410X * |
| XIE Q, VIROLOGICA SINICA, 2011 |
Cited By (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014140176A1 (en) * | 2013-03-15 | 2014-09-18 | Vaccibody As | Targeting vaccines for veterinary use |
| JP7037884B2 (ja) | 2014-01-13 | 2022-03-17 | ベイラー リサーチ インスティテュート | Hpv及びhpv関連疾患に対する新規のワクチン |
| US12214034B2 (en) | 2014-01-13 | 2025-02-04 | Baylor Research Institute | Vaccines against HPV and HPV-related diseases |
| JP2024112966A (ja) * | 2014-01-13 | 2024-08-21 | ベイラー リサーチ インスティテュート | Hpv及びhpv関連疾患に対する新規のワクチン |
| JP7536737B2 (ja) | 2014-01-13 | 2024-08-20 | ベイラー リサーチ インスティテュート | Hpv及びhpv関連疾患に対する新規のワクチン |
| US11717567B2 (en) | 2014-01-13 | 2023-08-08 | Baylor Research Institute | Vaccines against HPV and HPV-related diseases |
| JP2022081468A (ja) * | 2014-01-13 | 2022-05-31 | ベイラー リサーチ インスティテュート | Hpv及びhpv関連疾患に対する新規のワクチン |
| JP7355399B2 (ja) | 2014-08-15 | 2023-10-03 | ジェネクシン・インコーポレイテッド | 子宮頸癌を処置する方法 |
| US11135262B2 (en) | 2014-08-15 | 2021-10-05 | Genexine, Inc. | Methods of treating cervical cancer |
| AU2015302930C1 (en) * | 2014-08-15 | 2023-06-01 | Genexine, Inc. | Methods of treating cervical cancer |
| EP3193905A4 (en) * | 2014-08-15 | 2018-05-09 | Genexine, Inc. | Methods of treating cervical cancer |
| JP2021119174A (ja) * | 2014-08-15 | 2021-08-12 | ジェネクシン・インコーポレイテッドGenexine, Inc. | 子宮頸癌を処置する方法 |
| AU2015302930B2 (en) * | 2014-08-15 | 2020-11-26 | Genexine, Inc. | Methods of treating cervical cancer |
| JP2017525760A (ja) * | 2014-08-15 | 2017-09-07 | ジェネクシン・インコーポレイテッドGenexine, Inc. | 子宮頸癌を処置する方法 |
| WO2016024255A1 (en) | 2014-08-15 | 2016-02-18 | Genexine, Inc. | Methods of treating cervical cancer |
| US12447205B2 (en) | 2017-09-07 | 2025-10-21 | University Of Oslo | Vaccine molecules |
| US12268736B2 (en) | 2017-09-07 | 2025-04-08 | University Of Oslo | Vaccine molecules |
| US12005112B2 (en) | 2017-09-07 | 2024-06-11 | University Of Oslo | Vaccine molecules |
| WO2019048936A1 (en) * | 2017-09-07 | 2019-03-14 | University Of Oslo | VACCINE MOLECULES |
| WO2019048928A1 (en) * | 2017-09-07 | 2019-03-14 | University Of Oslo | VACCINE MOLECULES |
| WO2021205027A1 (en) | 2020-04-09 | 2021-10-14 | Vaccibody As | Individualized therapeutic anticancer vaccine |
| US11883479B2 (en) | 2020-04-24 | 2024-01-30 | Genexine, Inc. | Method for treating cervical cancer |
| WO2021219897A1 (en) | 2020-05-01 | 2021-11-04 | Vaccibody As | Betacoronavirus prophylaxis and therapy |
| WO2022200590A1 (en) | 2021-03-26 | 2022-09-29 | Nykode Therapeutics ASA | Therapeutic combination for treating cancer |
| WO2022233851A1 (en) | 2021-05-03 | 2022-11-10 | Nykode Therapeutics ASA | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of infectious diseases |
| WO2022238363A1 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of infectious diseases |
| WO2022238420A2 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Co-expression of constructs and immunostimulatory compounds |
| WO2022238381A2 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Immunotherapy constructs for treatment of disease |
| WO2022238432A2 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Co-expression of constructs and immunoinhibitory compounds |
| WO2022238402A1 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Tolerance-inducing constructs and composition and their use for the treatment of immune disorders |
| WO2022238395A1 (en) | 2021-05-10 | 2022-11-17 | Nykode Therapeutics ASA | Tolerance-inducing constructs and compositions and their use for the treatment of immune disorders |
| WO2023079001A1 (en) | 2021-11-03 | 2023-05-11 | Nykode Therapeutics ASA | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2 |
| WO2024092025A1 (en) | 2022-10-25 | 2024-05-02 | Nykode Therapeutics ASA | Constructs and their use |
| WO2024100196A1 (en) | 2022-11-09 | 2024-05-16 | Nykode Therapeutics ASA | Co-expression of constructs and polypeptides |
Also Published As
| Publication number | Publication date |
|---|---|
| HK1202442A1 (en) | 2015-10-02 |
| HUE043361T2 (hu) | 2019-08-28 |
| IL233217B (en) | 2019-05-30 |
| BR112014015016A8 (pt) | 2023-05-09 |
| AU2012356969B2 (en) | 2017-05-04 |
| JP2015508284A (ja) | 2015-03-19 |
| RU2644201C2 (ru) | 2018-02-08 |
| IL233217A0 (en) | 2014-08-31 |
| PT2793937T (pt) | 2019-06-05 |
| DK2793937T3 (da) | 2019-07-01 |
| CA2858963C (en) | 2023-05-23 |
| US20150056197A1 (en) | 2015-02-26 |
| EP2793937A1 (en) | 2014-10-29 |
| US20150306217A9 (en) | 2015-10-29 |
| CA2858963A1 (en) | 2013-06-27 |
| BR112014015016A2 (pt) | 2020-10-27 |
| CN104039833B (zh) | 2018-01-30 |
| EP2793937B1 (en) | 2019-04-10 |
| AU2012356969A1 (en) | 2014-07-03 |
| EP3533462A1 (en) | 2019-09-04 |
| ZA201404516B (en) | 2017-04-26 |
| RU2014129788A (ru) | 2016-02-10 |
| TR201908199T4 (tr) | 2019-06-21 |
| US9901635B2 (en) | 2018-02-27 |
| BR112014015016B1 (pt) | 2023-10-03 |
| ES2730718T3 (es) | 2019-11-12 |
| CN104039833A (zh) | 2014-09-10 |
| KR102057265B1 (ko) | 2019-12-18 |
| JP6258864B2 (ja) | 2018-01-10 |
| NZ626124A (en) | 2016-07-29 |
| KR20140107569A (ko) | 2014-09-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2012356969B2 (en) | Vaccines against HPV | |
| US11479605B2 (en) | Homodimeric protein constructs | |
| EP2928493B1 (en) | Fusion proteins for use as immunogenic enhancers for inducing antigen-specific t cell responses | |
| Massa et al. | Antitumor activity of DNA vaccines based on the human papillomavirus-16 E7 protein genetically fused to a plant virus coat protein | |
| WO2013041966A1 (en) | Vaccibodies targeted to cross-presenting dendritic cells | |
| HK1202442B (en) | Vaccines against hpv | |
| NZ626124B2 (en) | Vaccines against hpv |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12809271 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2858963 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14365536 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 233217 Country of ref document: IL Ref document number: 2012809271 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2014548019 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2012356969 Country of ref document: AU Date of ref document: 20121220 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20147020468 Country of ref document: KR Kind code of ref document: A Ref document number: 2014129788 Country of ref document: RU Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112014015016 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112014015016 Country of ref document: BR Kind code of ref document: A2 Effective date: 20140619 |