WO2013090454A2 - Novel glp-1 receptor modulators - Google Patents

Novel glp-1 receptor modulators Download PDF

Info

Publication number
WO2013090454A2
WO2013090454A2 PCT/US2012/069289 US2012069289W WO2013090454A2 WO 2013090454 A2 WO2013090454 A2 WO 2013090454A2 US 2012069289 W US2012069289 W US 2012069289W WO 2013090454 A2 WO2013090454 A2 WO 2013090454A2
Authority
WO
WIPO (PCT)
Prior art keywords
compound
phenyl
tert
mmol
butyl
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/069289
Other languages
English (en)
French (fr)
Other versions
WO2013090454A3 (en
Inventor
Marcus F. Boehm
Esther Martinborough
Manisha Moorjani
Junko Tamiya
Liming Huang
Adam R. YEAGER
Enugurthi Brahmachary
Thomas Fowler
Andrew Novak
Premji Meghani
Michael Knaggs
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Receptos LLC
Original Assignee
Receptos LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Receptos LLC filed Critical Receptos LLC
Priority to ES12806828T priority Critical patent/ES2836973T3/es
Priority to HK15103363.6A priority patent/HK1202864B/en
Priority to CA2857197A priority patent/CA2857197C/en
Priority to CN201280060896.1A priority patent/CN104080767A/zh
Priority to EP12806828.5A priority patent/EP2791112B1/en
Priority to BR112014013925-3A priority patent/BR112014013925B1/pt
Priority to KR1020147017945A priority patent/KR20140107340A/ko
Priority to JP2014546193A priority patent/JP6061949B2/ja
Priority to AU2012352349A priority patent/AU2012352349B2/en
Priority to NZ626122A priority patent/NZ626122B2/en
Priority to MX2014006622A priority patent/MX365923B/es
Priority to RU2014128522A priority patent/RU2634896C2/ru
Priority to HK15102640.3A priority patent/HK1202119A1/xx
Publication of WO2013090454A2 publication Critical patent/WO2013090454A2/en
Publication of WO2013090454A3 publication Critical patent/WO2013090454A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K5/00Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
    • C07K5/04Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
    • C07K5/06Dipeptides
    • C07K5/06104Dipeptides with the first amino acid being acidic
    • C07K5/06113Asp- or Asn-amino acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/425Thiazoles
    • A61K31/4261,3-Thiazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/433Thidiazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/4427Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
    • A61K31/4439Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/04Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/05Dipeptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D211/00Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings
    • C07D211/04Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom
    • C07D211/06Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members
    • C07D211/08Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms
    • C07D211/18Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with substituted hydrocarbon radicals attached to ring carbon atoms
    • C07D211/20Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with substituted hydrocarbon radicals attached to ring carbon atoms with hydrocarbon radicals, substituted by singly bound oxygen or sulphur atoms
    • C07D211/22Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with only hydrogen or carbon atoms directly attached to the ring nitrogen atom having no double bonds between ring members or between ring members and non-ring members with hydrocarbon or substituted hydrocarbon radicals directly attached to ring carbon atoms with substituted hydrocarbon radicals attached to ring carbon atoms with hydrocarbon radicals, substituted by singly bound oxygen or sulphur atoms by oxygen atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D233/00Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings
    • C07D233/54Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members
    • C07D233/56Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, attached to ring carbon atoms
    • C07D233/60Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, attached to ring carbon atoms with hydrocarbon radicals, substituted by oxygen or sulfur atoms, attached to ring nitrogen atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D239/00Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
    • C07D239/02Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings
    • C07D239/24Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members
    • C07D239/26Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D243/00Heterocyclic compounds containing seven-membered rings having two nitrogen atoms as the only ring hetero atoms
    • C07D243/06Heterocyclic compounds containing seven-membered rings having two nitrogen atoms as the only ring hetero atoms having the nitrogen atoms in positions 1 and 4
    • C07D243/08Heterocyclic compounds containing seven-membered rings having two nitrogen atoms as the only ring hetero atoms having the nitrogen atoms in positions 1 and 4 not condensed with other rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D255/00Heterocyclic compounds containing rings having three nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D249/00 - C07D253/00
    • C07D255/02Heterocyclic compounds containing rings having three nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D249/00 - C07D253/00 not condensed with other rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D263/00Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings
    • C07D263/02Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings
    • C07D263/30Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
    • C07D263/32Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D271/00Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms
    • C07D271/02Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms not condensed with other rings
    • C07D271/061,2,4-Oxadiazoles; Hydrogenated 1,2,4-oxadiazoles
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D271/00Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms
    • C07D271/02Heterocyclic compounds containing five-membered rings having two nitrogen atoms and one oxygen atom as the only ring hetero atoms not condensed with other rings
    • C07D271/101,3,4-Oxadiazoles; Hydrogenated 1,3,4-oxadiazoles
    • C07D271/1071,3,4-Oxadiazoles; Hydrogenated 1,3,4-oxadiazoles with two aryl or substituted aryl radicals attached in positions 2 and 5
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D277/00Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings
    • C07D277/02Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings
    • C07D277/20Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
    • C07D277/22Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
    • C07D277/30Radicals substituted by carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D285/00Heterocyclic compounds containing rings having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by groups C07D275/00 - C07D283/00
    • C07D285/01Five-membered rings
    • C07D285/02Thiadiazoles; Hydrogenated thiadiazoles
    • C07D285/04Thiadiazoles; Hydrogenated thiadiazoles not condensed with other rings
    • C07D285/081,2,4-Thiadiazoles; Hydrogenated 1,2,4-thiadiazoles
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D285/00Heterocyclic compounds containing rings having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by groups C07D275/00 - C07D283/00
    • C07D285/01Five-membered rings
    • C07D285/02Thiadiazoles; Hydrogenated thiadiazoles
    • C07D285/04Thiadiazoles; Hydrogenated thiadiazoles not condensed with other rings
    • C07D285/121,3,4-Thiadiazoles; Hydrogenated 1,3,4-thiadiazoles
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D291/00Heterocyclic compounds containing rings having nitrogen, oxygen and sulfur atoms as the only ring hetero atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D401/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
    • C07D401/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
    • C07D401/04Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D403/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
    • C07D403/04Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D403/00Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00
    • C07D403/02Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings
    • C07D403/12Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, not provided for by group C07D401/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D409/00Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms
    • C07D409/02Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings
    • C07D409/12Heterocyclic compounds containing two or more hetero rings, at least one ring having sulfur atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/04Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings directly linked by a ring-member-to-ring-member bond
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/10Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a carbon chain containing aromatic rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/12Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/14Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D417/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
    • C07D417/12Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/4245Oxadiazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/445Non condensed piperidines, e.g. piperocaine
    • A61K31/4523Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems
    • A61K31/454Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. pimozide, domperidone
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/445Non condensed piperidines, e.g. piperocaine
    • A61K31/4523Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems
    • A61K31/4545Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a six-membered ring with nitrogen as a ring hetero atom, e.g. pipamperone, anabasine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • A61K31/4709Non-condensed quinolines and containing further heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/506Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim not condensed and containing further heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/551Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D233/00Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings
    • C07D233/54Heterocyclic compounds containing 1,3-diazole or hydrogenated 1,3-diazole rings, not condensed with other rings having two double bonds between ring members or between ring members and non-ring members
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D239/00Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
    • C07D239/02Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings
    • C07D239/24Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members
    • C07D239/28Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, directly attached to ring carbon atoms
    • C07D239/32One oxygen, sulfur or nitrogen atom
    • C07D239/34One oxygen atom
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D241/00Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings
    • C07D241/02Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings not condensed with other rings
    • C07D241/06Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings not condensed with other rings having one or two double bonds between ring members or between ring members and non-ring members
    • C07D241/08Heterocyclic compounds containing 1,4-diazine or hydrogenated 1,4-diazine rings not condensed with other rings having one or two double bonds between ring members or between ring members and non-ring members with oxygen atoms directly attached to ring carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D263/00Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings
    • C07D263/02Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings
    • C07D263/08Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having one double bond between ring members or between a ring member and a non-ring member
    • C07D263/16Heterocyclic compounds containing 1,3-oxazole or hydrogenated 1,3-oxazole rings not condensed with other rings having one double bond between ring members or between a ring member and a non-ring member with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D263/18Oxygen atoms
    • C07D263/20Oxygen atoms attached in position 2
    • C07D263/22Oxygen atoms attached in position 2 with only hydrogen atoms or radicals containing only hydrogen and carbon atoms, directly attached to other ring carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D277/00Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings
    • C07D277/02Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings
    • C07D277/20Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
    • C07D277/22Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to ring carbon atoms
    • C07D277/24Radicals substituted by oxygen atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D495/00Heterocyclic compounds containing in the condensed system at least one hetero ring having sulfur atoms as the only ring hetero atoms
    • C07D495/02Heterocyclic compounds containing in the condensed system at least one hetero ring having sulfur atoms as the only ring hetero atoms in which the condensed system contains two hetero rings
    • C07D495/04Ortho-condensed systems

Definitions

  • the invention relates to compounds that bind the glucagon-like peptide 1 (GLP-1) receptor, methods of their synthesis, and methods of their therapeutic and/or prophylactic use.
  • GLP-1 glucagon-like peptide 1
  • the present invention is directed to compounds adapted to act as modulators or potentiators of GLP-1 receptor, including peptides GLP-1 (7-36) and GLP-l(9-36), as well as peptide-based therapies such as exenatide and liraglutide.
  • GLP-1R Glucagon-like peptide 1 receptor
  • GLP-1R belongs to Family Bl of the seven-transmembrane G protein-coupled receptors, and its natural agonist ligand is the peptide hormone glucagon-like peptide- 1 (GLP-1).
  • GLP-1 is a peptide hormone arising by its alternative enzymatic cleavage from proglucagon, the prohormone precursor for GLP-1, which is highly expressed in enteroendocrine cells of the intestine, the alpha cells of the endocrine pancreas (islets of Langerhans), and the brain (Kieffer T. J. and Habener, J. F. Endocrin. Rev.
  • GLP-1 receptors couple to the a-subunit of G protein, with subsequent activation of adenylate cyclase and increase of cAMP levels, thereby potentiating glucose-stimulated insulin secretion. Therefore, GLP-1 is an attractive therapeutic target to lower blood glucose and preserve the ?-cells of the pancreas of diabetic patients.
  • Glucagon has been used for decades in medical practice within diabetes and several glucagon-like peptides are being developed for various therapeutic indications. GLP-1 analogs and derivatives are being developed for the treatment for patients suffering from diabetes.
  • the present invention is directed to compounds adapted to act as potentiators or modulators of GLP-1 receptor; methods of their preparation and methods of their use, such as in treatment of a malcondition mediated by GLP-1 receptor activation, or when modulation or potentiation of GLP-1 receptor is medically indicated.
  • Certain embodiments of the present invention comprise a compound having the structure of Formula I-R or I-S or a pharmaceutically acceptable isomer, enantiomer, racemate, salt, isotope, prodrug, hydrate or solvate thereof:
  • A is a 5-, 6- or 7-membered heterocyclyl having one, two or three heteroatoms where each such heteroatom is independently selected from O, N, and S, and where any ring atom of such heterocyclyl may be optionally substituted with one or more of R 4 ;
  • B is aryl, aralkyl, heterocyclyl, or heterocyclylalkyl
  • C is aryl, arylalkyl, heterocyclyl or heterocyclylalkyl
  • Yi and Y 2 are both null, or one of Yi or Y 2 is -NH- or -O- and the other Yi or Y 2 is null;
  • Z is -C(O)- or -S(0) 2 -;
  • each Ri is independently H or Ci_ 4 alkyl
  • R 2 is -OH, -0-R 8 , -N(Ri)-S0 2 -R 8 , -NR 4 iR 42 , -N(Ri)-(CR a R b ) m -COOH, -N(Ri)-(CRaR b ) m -CO-N(Ri)-heterocyclyl, -N(Ri)-(CR a R b ) m -CO-N(Ri)(R 7 ), or -N(Ri)- heterocyclyl;
  • each R 3 and R 4 is independently H, halo, alkyl, alkyl substituted with R 31j alkoxy, haloalkyl, perhaloalkyl, haloalkoxy, perhaloalkoxy, aryl, heterocyclyl, -OH, -OR 8 , -CN, -N0 2 , -NRiRg, , -C(0)R 8 , -C(0)NRiR 8 , -NRiC(0)R 8 , -SR 8 , -S(0)R 8 , -S(0) 2 R 8 , -OS(0) 2 R 8 , -S(0) 2 NRiR 8 , -NRiS(0) 2 R 8 , -(CR a R b ) m NRiR 8 ,
  • each R 3 i is independently H, halo, hydroxyl, -NR 4 iR 42 , or alkoxy;
  • each R 40 is independently H or alkyl; each R 4 i and R42 is independently R40 or -(CH 2 ) n -COO-R4o, -C(0)-R4o, aryl, heteroaryl, or two taken together with the N atom to which they are attached can form a 3- to 7-membered heterocyclyl;
  • Wi is null or -Li-(CR a Rb)m-Li-R 6 ;
  • each Li is independently, from the proximal to distal end of the structure of Formula I-R or I-S, null, -C(0)0-, -S(0 2 )-, -S-, -N(Ri)-C(0)-N(Ri)-, -N(Ri)-C(0)- 0-, -C(O)- or -S(0 2 )-NR ;
  • each R a and R b is independently H, alkyl, alkoxy, aryl, arylalkyl, heterocyclyl or heterocyclylalkyl, any of which alkyl, alkoxy, aryl, arylalkyl, heterocyclyl or heterocyclylalkyl may be optionally (singly or multiply) substituted with R 7 , or -(CH 2 ) m C(0)OR4o, -(CH 2 ) m OR4o, -(CH 2 ) m SR 40 , -(CH 2 ) m NR 4 iR4 2 ,
  • R 5 is R 7 , -(CH 2 ) m -L 2 -(CH 2 ) m -R 7 , or -(-L 3 -(CR a Rb) r -)s-L 3 -R 7 ;
  • Re is H, alkyl, cycloalkyl, aryl, heteroaryl, heterocyclyl, heterocycloalkyl, any of which may be optionally singly or multiply substituted with R 7 or -(CH 2 ) m -L 2 -(CH 2 ) m -R 7 ;
  • R 7 is H, halo, alkyl, haloalkyl, perhaloalkyl, alkoxy, -OH, -OR 8 , -CN, -NRiRg, -(CR a Rb) m O(CRaRb) m R8, -NRi(CR a R b ) m R 8 , -C(0)R 8 , -NRi(CR a R b ) m COOH, -NRiC(0)R 8 , -C(0)NRiR 8 , -SR 8 , -S(0)R 8 , -S(0) 2 R 8 , -S(0) 2 NRiR 8 , -NRiS(0) 2 R 8 ; or a ring moiety selected from cycloalkyl, aryl, arylalkyl, heterocyclyl or heterocyclylalkyl, where such ring moiety is optionally singly or multiply substituted with halo, -OH, -OR 8
  • each R 8 is independently H, alkyl, cycloalkyl or aryl;
  • L 2 is independently, from the proximal to distal end of the structure of Formula I-R or I-S, null, -0-, -OC(O)-, -NRi- , -C(0)NRi-, -N(Ri)-C(0)-, -S(0 2 )-, - C(O)- or -S(0 2 )-N(Ri)-;
  • each L is independently null, -0-, or -N(Ri)- each m is independently 0, 1, 2, 3, 4, 5 or 6; each n is independently 0 or 1 or 2;
  • p 0, 1, 2 or 3;
  • q 0, 1, 2 or 3;
  • each r is independently 2, 3, or 4;
  • each s is independently 1, 2, 3, or 4.
  • a pharmaceutical composition comprising a compound of the invention together with at least one pharmaceutically acceptable carrier, diluent or excipient is provided.
  • a method of use of a compound of the invention comprising preparation of a medicament is provided.
  • the invention provides a pharmaceutical combination comprising a compound of the invention and a second medicament.
  • the second medicament is an agonist or modulator for glucagon receptor, GIP receptor, GLP-2 receptor, or PTH receptor, or glucagon-like peptide 1 (GLP-1) receptor.
  • the second medicament is exenatide, liraglutide, taspoglutide, albiglutide, or lixisenatide or other insulin regulating peptide.
  • the second medicament is a DPPIV inhibitor.
  • the second medicament is medically indicated for the treatment of type II diabetes.
  • a method of activation, potentiation or agonism of a GLP-1 receptor comprising contacting the receptor with a compound, pharmaceutical composition or pharmaceutical combination of the invention.
  • a method for treatment of a malcondition in a subject for which activation, potentiation or agonism of a GLP-1 receptor is medically indicated comprises administering to such subject a compound, pharmaceutical composition or pharmaceutical combination of the invention.
  • selective activation, potentiation or agonism of a GLP-1 receptor is medically indicated.
  • the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
  • the invention provides methods for synthesis of certain compounds including compounds of the invention. In certain other
  • the invention provides certain intermediate compounds associated with such methods of synthesis.
  • Certain embodiments comprise a compound having the chiral structure of Formula I-R or I-S (with the chirality as indicated) or a pharmaceutically acceptable isomer, enantiomer, racemate, salt, isotope, prodrug, hydrate or solvate thereof:
  • Certain embodiments of the present invention comprise a compound having the structure of Formula I-R or I-S or a pharmaceutically acceptable isomer, enantiomer, racemate, salt, isotope, prodrug, hydrate or solvate thereof:
  • the compounds have the structure of Formula I- R or a pharmaceutically acceptable isomer, enantiomer, salt, isotope, prodrug, hydrate or solvate thereof.
  • the compounds have the structure of Formula I-S or a pharmaceutically acceptable isomer, enantiomer, salt, isotope, prodrug, hydrate or solvate thereof.
  • the compounds can be substantially identical to each other. [0016] in certain embodiments, the compounds can be substantially identical to each other.
  • the invention provides a compound of Formula I-R and/or Formula I-S where Yi and Y 2 are null, Z is -C(O)- and A is a 5- or 6- membered heteroaryl group.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " ⁇ ⁇ " represents either or both the R and S form of the compound):
  • the invention provides a compound where Yi and Y 2 are null, Z is -C(O)- and A is a 5-, 6- or 7-membered non-aromatic heterocyclyl group.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " ⁇ ⁇ " represents either or both the R and S form of the compound):
  • the inventions provides compounds of each of structures I-R/S(l)-(29) where R 4 of the phenyl group is H.
  • the inventions provides compounds of each of structures I-R/S(l)-(29) where the A group (i.e., the 5-, 6- or 7-membered heterocyclyl) is not substituted by R4, or substituted by R4 where R4 is alkyl, haloalkyl, alkoxy, -NR41R42 where R41 and R 42 are independently hydrogen or alkyl, or substituted by two R4 groups which taken together form oxo.
  • the A group i.e., the 5-, 6- or 7-membered heterocyclyl
  • R4 is alkyl, haloalkyl, alkoxy, -NR41R42 where R41 and R 42 are independently hydrogen or alkyl, or substituted by two R4 groups which taken together form oxo.
  • the invention provides a compound of Formula I-R and/or Formula I-S where Yi and Y 2 are null, Z is -C(O)- and A is C is aryl.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " /ww " represents either or both the R and S form of the compound):
  • the inventions provides compounds of each of structures I-R/S(30)-(32) where q is zero.
  • the inventions provides compounds of each of structures I-R/S(30)-(32) where q is one, two or three.
  • the inventions provides compounds of structure I-R/S(30) where q is one and R 5 is -(CH 2 ) m -L 2 -(CH 2 ) m -R7 or -(-L 3 -(CR a Rb)r-)s-L 3 -R7.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " " represents either or both the R and S form of the compound):
  • the inventions provides compounds of structure I-R/S(33) where R 7 is H or alklyl and L 2 is O.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " ⁇ " represents either or both the R and S form of the compound):
  • the inventions provides compounds of structure I-R/S(30) where R 5 is R 7 .
  • Representative compounds of this embodiment include compounds of the following structure (wherein " " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(35) where R 7 is halo, alkyl, haloalkyl, perhaloalkyl, alkoxy, -OH, -ORg, -CN, - RiRg, -(CR a Rb)mO(CR a Rb) m R8, -NRi(CR a Rb) m R8, -C(0)R 8 , -NRi(CR a Rb) m COOH, -NRiC(0)R 8 , -C(0)NRiR 8 , -SR 8 , -S(0)R 8 , -S(0) 2 R 8 , -S(0) 2 NRiR 8 or -NRiS(0) 2 R 8 .
  • the invention provides compounds of structure I-R/S(35) where R 7 is a ring moiety selected from cycloalkyl, aryl, arylalkyl, heterocyclyl or heterocyclylalkyl, where such ring moiety is optionally (singly or multiply) substituted with halo, -OH, -CN, alkyl, alkoxy, haloalkyl or perhaloalkyl.
  • the invention provides a compound of Formula I-R and/or Formula I-S where Yi and Y 2 are null, Z is -C(O)- and A is C is
  • heterocyclyl Representative compounds of this embodiment include compounds of the following structures (wherein “ ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of each of structures I-R/S(36)-(44) where R 7 is halo, alkyl, haloalkyl, perhaloalkyl, alkoxy, -OH, -OR 8 , -CN, -NRiRg, -(CRaRb)mO(CRaRb)mR8, -NRi(CRaRb) m R8, -C(0)R 8 ,
  • the invention provides compounds of each of structures I-R/S(36)-(44) where R 7 is a ring moiety selected from cycloalkyl, aryl, arylalkyl, heterocyclyl or heterocyclylalkyl, where such ring moiety is optionally (singly or multiply) substituted with halo, -OH, -CN, alkyl, alkoxy, haloalkyl or perhaloalkyl.
  • the invention provides a compound of Formula I-R and/or Formula I-S where Yi and Y 2 are null, Z is -C(O)- and B is aryl or arylalkyl.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " ' ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of each of structures I-R/S (45)-(48) where Wi is null.
  • Representative compounds of this embodiment include compounds of the following structure (wherein “ ' ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(49) where R 3 is halo, alkyl, alkoxy, haloalkyl, perhaloalkyl, haloalkoxy, perhaloalkoxy, -OH, -OR 8 , -CN, -NRiR 8 , , _C(0)R 8 , -C(0)NRiR 8 , -NRiC(0)R 8 , -SR 8 , -S(0)R 8 , -S(0) 2 R 8 , -OS(0) 2 R 8 , -S(0) 2 NRiR 8 , -NRiS(0) 2 R 8 , -(CR a R b ) m NRiR 8 or -(CRaRb) m O(CR a R b ) m R 8 .
  • the invention provides compounds of each of structures I-R/S (45)-(49) where R 3 is alkyl.
  • the invention provides a compound of Formula I-R and/or Formula I-S where Yi and Y 2 are null, Z is -C(O)- and B is heterocyclyl or heterocyclylalkyl.
  • Representative compounds of this embodiment include compounds of the following structures (wherein “ , ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of each of structures I-R/S(50)-(62) where Wi is null.
  • the invention provides compounds of each of structures I-R/S(50)-(62) where Wi is null and R 3 is halo, alkyl, alkoxy, haloalkyl, perhaloalkyl, haloalkoxy, perhaloalkoxy, -OH, -OR 8 , -CN, -NRiR 8 , , _C(0)R 8 ,
  • the invention provides compounds of each of structures I-R/S(50)-(62) where Wi is null, p is 1 and R 3 is alkyl.
  • the invention provides compounds of each of structuress I-R/S(l)-(62) where R 2 is -OH, -N(Ri)-(CR a R b ) m -COOH or -N(Ri)-S0 2 -R 8 ; where Ri is H; where R a and R b are independently H, alkyl, alkoxy,
  • the invention provides compounds of the following structures (wherein " " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure where A is a 5-membered heteroaryl.
  • the invention provides compounds of structure where A is a 6-membered heteroaryl.
  • the invention provides compounds of structure where A is a 6-membered heteroaryl having one or two nitrogen atoms.
  • the invention provides compounds of structure where A is pyrimindinyl.
  • the invention provides compounds of structure where A is pyridinyl.
  • the invention provides compounds of structure where B is aryl.
  • the invention provides compounds of structure where B is phenyl.
  • the invention provides compounds of structure where B is heteroaryl.
  • the invention provides compounds of structure where B is thiophenyl.
  • the invention provides compounds of structure where R 2 is -OH. [0053] In certain embodiments, the invention provides compounds of structure I-R/S(63) where R 2 is -NH(CR a R b ) m COOH.
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NHS0 2 R 8 .
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NHCH 2 COOH.
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NH(CHR b )COOH where R b is alkyl, -(CH 2 ) m OR4o,
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NH(CRaR b ) m COOH where Ra and R b are independenty H, alkyl, -(CH 2 ) m OR4o, -(CH 2 ) m SR 4 o, -(CH 2 ) m C(0)OR 4 o, -(CH 2 ) m NR 41 R 42 or
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NRi(CHR b )COOH where Ri and R b taken together form heterocyclyl.
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NRi(CRaR b ) m COOH where Ri and one of R b taken together form heterocyclyl .
  • the invention provides compounds of structure I-R/S(63) where any two R a and R b taken together with the carbon to which they are attached form a cycloalkyl.
  • the invention provides compounds of structure I-R/S(63) where R 2 is -NH(CR a R b ) m COOH where one of R a and R b is H and the other Ra and R b is aryl substituted with R 7 .
  • the invention provides compounds of structure I-R/S(63) where p is 1 or 2 and each R 3 is independently alkyl, alkoxy, -OH, perhaloalkyl or _C(0)Rs.
  • the invention provides compounds of structure I-R/S(63) where p is 1 and each R 3 is alkyl. [0064] In certain embodiments, the invention provides compounds of structure I-R/S(63) where q is 1 and R 5 is -(CH 2 ) m -L2-(CH 2 ) m -R7.
  • the invention provides compounds of structure I-R/S(63) where q is 1 and R 5 is alkoxy.
  • the invention provides a compound of Formula I-R and/or Formula I-S where Yi and Y 2 are null and Z is -S(0) 2 -.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " ''ww " represents either or both the R and S form of the compound):
  • the invention provides compounds of structure I-R/S(64) where A is pyrimidinyl, B is phenyl and C is phenyl.
  • Representative compounds of this embodiment include compounds of the following structure (wherein " >/ww " represents either or both the R and S form of the compound):
  • the invention provides a compound of Formula I-R and/or Formula I-S where Yi is null, Y 2 is -O- and Z is -C(O)-.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " /ww " represents either or both the R and S form of the compound):
  • the invention provides a compound of Formula I-R and/or Formula I-S where Yi is NH, Y 2 is null and Z is -C(O)-.
  • Representative compounds of this embodiment include compounds of the following structures (wherein " /ww " represents either or both the R and S form of the compound):
  • the invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising a compound of the invention together with at least one pharmaceutically acceptable carrier, diluent or excipient.
  • the invention provides a pharmaceutical composition comprising a compound of the invention and a second medicament.
  • the second medicament is a GLP-1 agonist or a DPPIV inhibitor.
  • the invention provides a method of use of compounds of the invention for preparation of a medicament.
  • the invention provides a pharmaceutical combination comprising a compound of the invention and a second medicament.
  • the second medicament is an agonist or modulator for glucagon receptor, GIP receptor, GLP-2 receptor, or PTH receptor, or glucagon-like peptide 1 (GLP-1) receptor.
  • the second medicament is exenatide, liraglutide, taspoglutide, albiglutide, or lixisenatide or other insulin regulating peptide.
  • the second medicament is a DPPIV inhibitor.
  • the second medicament is medically indicated for the treatment of type II diabetes.
  • a method for activation, potentiation or agonism of a glucagon-like peptide 1 comprising contacting the receptor with an effective amount of a compound, pharmaceutical composition or pharmaceutical combination of the invention.
  • a method for activation or agonism of a GLP-1 receptor by contacting the receptor with an effective amount of an invention compound and GLP-1 peptides GLP-1 (9-36) and GLP-1 (7-36), pharmaceutical composition or pharmaceutical combination, wherein the GLP-1 receptor is disposed within a living mammal; in certain embodiments wherein such mammal is a human.
  • a method for treatment of a malcondition in a subject for which activation, potentiation or agonism of a GLP-1 receptor is medically indicated, by administering an effective amount of an invention compound to the subject at a frequency and for a duration of time sufficient to provide a beneficial effect to the patient.
  • a method for treatment of a malcondition in a patient for which activation, potentiation, or agonism of a GLP-1 receptor is medically indicated by administering an effective amount of an invention compound to the patient at a frequency and for a duration of time sufficient to provide a beneficial effect to the patient, wherein the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
  • the subject is a patient or a human being.
  • the human being is afflicted with, or at risk of developing, a disease or condition selected from the group consisting of type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
  • a disease or condition selected from the group consisting of type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
  • said disease is type I diabetes or type II diabetes.
  • the invention provides methods for synthesis of certain compounds including compounds of the invention as more fully illustrated herein. In certain other embodiments, the invention provides certain intermediate compounds associated with such methods of synthesis as illustrated herein.
  • methods are provided for use of an invention compound for preparation of a medicament adapted for treatment of a disorder or a malcondition wherein activation or inhibition of a GLP-1 receptor is medically indicated.
  • the malcondition comprises type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, and metabolic disorder.
  • said disease is type I diabetes or type II diabetes.
  • the method additionally comprises
  • a second medicament selected from the group of peptidic GLP-1 agonists and DPPIV inhibitors, wherein such second medicament is either a component of the pharmaceutical composition or a second pharmaceutical composition.
  • the second medicament can be exenatide or sitagliptin.
  • mammals as in the subject of the treatment
  • Mammals include, for example, humans;
  • non-human primates e.g., apes and monkeys; cattle; horses; sheep; and goats.
  • Non-mammals include, for example, fish and birds.
  • a "receptor”, as is well known in the art, is a biomolecular entity usually comprising a protein that specifically binds a structural class of ligands or a single native ligand in a living organism, the binding of which causes the receptor to transduce the binding signal into another kind of biological action, such as signaling a cell that a binding event has occurred, which causes the cell to alter its function in some manner.
  • An example of transduction is receptor binding of a ligand causing alteration of the activity of a "G-protein" in the cytoplasm of a living cell.
  • GLP-1 compound or "GLP-1 agonist” or “GLP-1 activator” or “GLP-1 inhibitor” or “GLP-1 antagonist” or “GLP-1 potentiator” or “GLP-1 modulator” as the terms are used herein refer to compounds that interact in some way with the GLP-1 receptor. They can be agonists, potentiators, or activators, or they can be antagonists or inhibitors. An "GLP-1 compound” of the invention can be selective for action of the GLP-1 receptor family.
  • substantially as the term is used herein means completely or almost completely; for example, a composition that is "substantially free” of a component either has none of the component or contains such a trace amount that any relevant functional property of the composition is unaffected by the presence of the trace amount, or a compound is "substantially pure” is there are only negligible traces of impurities present.
  • Substantially enantiomerically or diasteromerically pure means a level of enantiomeric or diasteromeric enrichment of one enantiomer with respect to the other enantiomer or diasteromer of at least 90%, 95%, 98%, 99%, 99.5% or 99.9%.
  • Treating or “treatment” within the meaning herein refers to an alleviation of symptoms associated with a disorder or disease, or inhibition of further progression or worsening of those symptoms, or prevention or prophylaxis of the disease or disorder.
  • the expression "effective amount”, when used to describe use of a compound of the invention in providing therapy to a patient suffering from a disorder or malcondition mediated by GLP-1 refers to the amount of a compound of the invention that is effective to bind to as an agonist or as an antagonist a GLP-1 receptor in the individual's tissues, wherein the GLP-1 is implicated in the disorder, wherein such binding occurs to an extent sufficient to produce a beneficial therapeutic effect on the patient.
  • an "effective amount” or a “therapeutically effective amount” of a compound of the invention refers to an amount of the compound that alleviates, in whole or in part, symptoms associated with the disorder or condition, or halts or slows further progression or worsening of those symptoms, or prevents or provides prophylaxis for the disorder or condition.
  • a “therapeutically effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result by acting as an agonist of GLP-1 activity.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of compounds of the invention are outweighed by the therapeutically beneficial effects.
  • a therapeutically effective amount of a GLP-1 receptor agonist of the invention is an amount sufficient to control the malcondition, to mitigate the progress of the malcondition, or to relieve the symptoms of the malcondition.
  • malconditions that can be so treated include, but not limited to, type II diabetes.
  • Compounds used in the present invention can include enriched or resolved optical isomers at any or all asymmetric atoms as are apparent from the depictions, at any degree of enrichment. Both racemic and diastereomeric mixtures, as well as the individual optical isomers can be synthesized so as to be substantially free of their enantiomeric or diastereomeric partners, and these are all within the scope of certain embodiments of the invention.
  • the isomers resulting from the presence of a chiral center comprise a pair of non-superimposable isomers that are called "enantiomers.”
  • enantiomers Single enantiomers of a pure compound are optically active, i.e., they are capable of rotating the plane of plane polarized light.
  • Single enantiomers are designated according to the
  • the molecule is oriented so that the lowest ranking group is pointed away from the viewer. Then, if the descending rank order of the other groups proceeds clockwise, the molecule is designated (R) and if the descending rank of the other groups proceeds counterclockwise, the molecule is designated (S).
  • R the descending rank order of the other groups
  • S the descending rank of the other groups proceeds counterclockwise
  • the Cahn-Ingold-Prelog ranking is A > B > C > D. The lowest ranking atom, D is oriented away from the viewer.
  • isolated optical isomer means a compound which has been
  • the isolated isomer is at least about 80%, more preferably at least 90%> pure, even more preferably at least 98%> pure, most preferably at least about 99% pure, by weight.
  • Enantiomers are sometimes called optical isomers because a pure enantiomer rotates plane-polarized light in a particular direction. If the light rotates clockwise, then that enantiomer is labeled "(+)” or “d” for dextrorotatory, its counterpart will rotate the light counterclockwise and is labeled “(-)” or “1” for levorotatory.
  • the terms “racemate” and “racemic mixture” are frequently used interchangeably. A racemate is an equal mixture of two enantiomers. A racemate is labeled "( ⁇ )” because it is not optically active (i.e., will not rotate plane-polarized light in either direction since its constituent enantiomers cancel each other out).
  • the preferred compounds of the present invention have a particular spatial arrangement of substituents on the aromatic rings, which is related to the structure activity relationship demonstrated by the compound class. Often such substitution arrangement is denoted by a numbering system; however, numbering systems are often not consistent between different ring systems. In six-membered aromatic systems, the spatial arrangements are specified by the common nomenclature "para” for 1 ,4-substitution, "meta” for 1,3-substitution and "ortho" for 1 ,2-substitution as shown below.
  • substituted refers to an organic group as defined herein in which one or more bonds to a hydrogen atom contained therein are replaced by one or more bonds to a non-hydrogen atom such as, but not limited to, a halogen (i.e., F, CI, Br, and I); an oxygen atom in groups such as hydroxyl groups, alkoxy groups, aryloxy groups, aralkyloxy groups, oxo(carbonyl) groups, carboxyl groups including carboxylic acids, carboxylates, and carboyxlate esters; a sulfur atom in groups such as thiol groups, alkyl and aryl sulfide groups, sulfoxide groups, sulfone groups, sulfonyl groups, and sulfonamide groups; a nitrogen atom in groups such as amines, hydroxylamines, nitriles, nitro groups, N-oxides, hydrazides, azides,
  • substituents that can be bonded to a substituted carbon (or other) atom include F, CI, Br, I, OR', OC(0)N(R) 2 ,
  • Substituted alkyl, alkenyl, alkynyl, cycloalkyl, and cycloalkenyl groups as well as other substituted groups also include groups in which one or more bonds to a hydrogen atom are replaced by one or more bonds, including double or triple bonds, to a carbon atom, or to a heteroatom such as, but not limited to, oxygen in carbonyl (oxo), carboxyl, ester, amide, imide, urethane, and urea groups; and nitrogen in imines, hydroxyimines, oximes, hydrazones, amidines, guanidines, and nitriles.
  • Substituted ring groups includes substituted aryl, heterocyclyl and heteroaryl groups. Substituted ring groups can be substituted by one or more substituents at any available ring position. In some embodiments, two substituents on a substituted ring group may taken together with the ring to which they are attached to form a ring, such that the two rings are fused together. For example, benzodioxolyl is a fused ring system formed by two substituents taken together on a phenyl group.
  • substituted ring groups also include rings and fused ring systems in which a bond to a hydrogen atom is replaced with a bond to a carbon atom. Therefore, substituted aryl, heterocyclyl and heteroaryl groups can also be substituted with alkyl, alkenyl, cycloalkyl, aryl, heteroaryl, and alkynyl groups as defined herein, which can themselves be further substituted.
  • the linking groups (e.g., Li and L 2 ) of Formula I-R or I-S are partial structures which may be represented by a formula, say, for example, -N(Ri)-C(0)-, which is read from left-to-right. Accordingly, the nitrogen atom of the -N(Ri)-C(0)- linker will be attached to the proximal end of the structure of Formula I-R or I-S, and the carbonyl carbon atom of the -N(Ri)-C(0)- linker will be attached to the distal end of the structure of Formula I-R or I-S.
  • heteroatoms refers to non-carbon and non- hydrogen atoms, capable of forming covalent bonds with carbon, and is not otherwise limited. Typical heteroatoms are N, O, and S.
  • sulfur (S) When sulfur (S) is referred to, it is understood that the sulfur can be in any of the oxidation states in which it is found, thus including sulfoxides (R-S(O)-R') and sulfones (R-S(0) 2 -R'), unless the oxidation state is specified; thus, the term “sulfone” encompasses only the sulfone form of sulfur; the term “sulfide” encompasses only the sulfide (R-S-R) form of sulfur.
  • heteroatoms selected from the group consisting of O, NH, NR' and S or "[variable] is O, S . . .” are used, they are understood to encompass all of the sulfide, sulfoxide and sulfone oxidation states of sulfur.
  • Alkyl groups include straight chain and branched alkyl groups and cycloalkyl groups having from 1 to about 20 carbon atoms, and typically from 1 to 12 carbons (C 1 -C 12 alkyl), or, in some embodiments, from 1 to 8 carbon atoms (Ci-Cg alkyl), or, in some embodiments, from 1 to 4 carbon atoms (C 1 -C4 alkyl).
  • straight chain alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, n- butyl, n-pentyl, n-hexyl, n-heptyl, and n-octyl groups.
  • branched alkyl groups include, but are not limited to, isopropyl, iso-butyl, sec-butyl, t-butyl, neopentyl, isopentyl, and 2,2-dimethylpropyl groups.
  • Alkyl groups as used herein may optionally include one or more further substituent groups.
  • Representative substituted alkyl groups can be substituted one or more times with any of the groups listed above, for example, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
  • Cycloalkyl groups are alkyl groups forming a ring structure, which can be substituted or unsubstituted, wherein the ring is either completely saturated, partially unsaturated, or fully unsaturated, wherein if there is unsaturation, the conjugation of the pi-electrons in the ring do not give rise to aromaticity.
  • Examples of cycloalkyl include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl groups.
  • the cycloalkyl group has 3 to 8 ring members, whereas in other embodiments the number of ring carbon atoms range from 3 to 5, 3 to 6, or 3 to 7.
  • Cycloalkyl groups further include polycyclic cycloalkyl groups such as, but not limited to, norbornyl, adamantyl, bornyl, camphenyl, isocamphenyl, and carenyl groups, and fused rings such as, but not limited to, decalinyl, and the like. Cycloalkyl groups also include rings that are substituted with straight or branched chain alkyl groups as defined above.
  • Representative substituted cycloalkyl groups can be mono-substituted or substituted one or more times with any of the groups listed above, for example, but not limited to, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
  • the terms "carbocyclic” and “carbocycle” denote a ring structure wherein the atoms of the ring are carbon. In some embodiments, the carbocycle has 3 to 8 ring members, whereas in other embodiments the number of ring carbon atoms is 4, 5, 6, or 7.
  • the carbocyclic ring can be substituted with as many as N substituents wherein N is the size of the carbocyclic ring with for example, amino, hydroxy, cyano, carboxy, nitro, thio, alkoxy, and halogen groups.
  • (Cycloalkyl)alkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of the alkyl group is replaced with a bond to a cycloalkyl group as defined above.
  • Alkenyl groups include straight and branched chain and cyclic alkyl groups as defined above, except that at least one double bond exists between two carbon atoms.
  • cycloalkenyl alone or in combination denotes a cyclic alkenyl group wherein at least one double bond is present in the ring structure.
  • Cycloalkenyl groups include cycloalkyl groups having at least one double bond between two adjacent carbon atoms.
  • cycloalkenyl groups include but are not limited to cyclohexenyl, cyclopentenyl, and cyclohexadienyl groups.
  • (Cycloalkenyl)alkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of the alkyl group is replaced with a bond to a cycloalkenyl group as defined above.
  • Alkynyl groups include straight and branched chain alkyl groups, except that at least one triple bond exists between two carbon atoms.
  • alkynyl groups have from 2 to about 20 carbon atoms, and typically from 2 to 12 carbons or, in some embodiments, from 2 to 8 carbon atoms. Examples include, but are not limited to - C ⁇ CH, -C ⁇ C(CH 3 ), -C ⁇ C(CH 2 CH 3 ), -CH 2 C ⁇ CH, -CH 2 C ⁇ C(CH 3 ), and
  • Aryl groups are cyclic aromatic hydrocarbons that do not contain heteroatoms.
  • aryl groups include, but are not limited to, phenyl, azulenyl, heptalenyl, biphenyl, indacenyl, fluorenyl, phenanthrenyl, triphenylenyl, pyrenyl, naphthacenyl, chrysenyl, biphenylenyl, anthracenyl, and naphthyl groups.
  • aryl groups contain 6-14 carbons in the ring portions of the groups.
  • aryl groups includes groups containing fused rings, such as fused aromatic- aliphatic ring systems (e.g., indanyl, tetrahydronaphthyl, and the like), and also includes substituted aryl groups that have other groups, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring atoms.
  • fused aromatic- aliphatic ring systems e.g., indanyl, tetrahydronaphthyl, and the like
  • substituted aryl groups that have other groups, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring atoms.
  • Representative substituted aryl groups can be mono-substituted or substituted more than once, such as, but not limited to, 2-, 3-, 4-, 5-, or 6-substituted phenyl or naphthyl groups, which can be substituted with groups including but not limited to those listed above.
  • Aralkyl groups are alkyl groups as defined above in which a hydrogen atom of an alkyl group is replaced with an aryl group as defined above.
  • Representative aralkyl groups include benzyl and phenylethyl groups and fused (cycloalkylaryl)alkyl groups such as 4-ethyl-indanyl.
  • the aryl moiety or the alkyl moiety or both are optionally substituted with other groups, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups.
  • Aralkenyl group are alkenyl groups as defined above in which a hydrogen or carbon bond of an alkyl group is replaced with a bond to an aryl group as defined above.
  • Heterocyclyl or heterocyclic groups include aromatic and non-aromatic ring moieties containing 3 or more ring members, of which one or more is a heteroatom such as, but not limited to, N, O, S, or P.
  • heterocyclyl groups include 3 to 20 ring members, whereas other such groups have 3 to 15 ring members, including for example single ring systems containing 5, 6 or 7 ring members. At least one ring contains a heteroatom, but every ring in a polycyclic system need not contain a heteroatom.
  • a dioxolanyl ring and a benzdioxolanyl ring system are both heterocyclyl groups within the meaning herein.
  • a heterocyclyl group designated as a C2-heterocyclyl can be a 5 -ring with two carbon atoms and three heteroatoms, a 6-ring with two carbon atoms and four heteroatoms, and so forth.
  • a C4-heterocyclyl can be a 5 -ring with one heteroatom, a 6-ring with two heteroatoms, and so forth.
  • the number of carbon atoms plus the number of heteroatoms sums up to equal the total number of ring atoms.
  • heterocyclyl includes fused ring species including those having fused aromatic and non-aromatic groups.
  • the phrase also includes poly cyclic ring systems containing a heteroatom such as, but not limited to, quinuclidyl and also includes heterocyclyl groups that have substituents, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups, bonded to one of the ring members.
  • a heterocyclyl group as defined herein can be a heteroaryl group or a partially or completely saturated cyclic group including at least one ring heteroatom.
  • Heterocyclyl groups include, but are not limited to, pyrazinyl, pyrimidinyl, pyridazinyl, thiadiazolyl, oxadiazolyl, imidazolinyl, hexahydropyrimidinyl, diazepanyl, triazinyl, imidazolyl, pyrrolidinyl, furanyl, tetrahydrofuranyl, tetrahydro-2H-pyranyl, dioxolanyl, piperidinyl, piperazinyl, morpholinyl, pyrrolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, thiazolyl, pyridinyl, thiophenyl, benzothiophenyl, benzofuranyl,
  • dihydrobenzofuranyl indolyl, dihydroindolyl, azaindolyl, indazolyl, benzimidazolyl, azabenzimidazolyl, benzoxazolyl, benzothiazolyl, benzothiadiazolyl, imidazopyridinyl, isoxazolopyridinyl, thianaphthalenyl, purinyl, xanthinyl, adeninyl, guaninyl, quinolinyl, isoquinolinyl, tetrahydroquinolinyl, quinoxalinyl, and quinazolinyl groups.
  • Heterocyclyl groups can be substituted.
  • Representative substituted heterocyclyl groups can be mono-substituted or substituted more than once, including but not limited to, rings containing at least one heteroatom which are mono, di, tri, tetra, penta, hexa, or higher-substituted with substituents such as those listed above, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, and alkoxy groups.
  • Heteroaryl groups are aromatic ring moieties containing 5 or more ring members, of which, one or more is a heteroatom such as, but not limited to, N, O, and S.
  • a heteroaryl group designated as a C 2 -heteroaryl can be a 5 -ring with two carbon atoms and three heteroatoms, a 6-ring with two carbon atoms and four heteroatoms and so forth.
  • a C4-heteroaryl can be a 5 -ring with one heteroatom, a 6-ring with two heteroatoms, and so forth. The number of carbon atoms plus the number of heteroatoms sums up to equal the total number of ring atoms.
  • Heteroaryl groups include, but are not limited to, groups such as pyrrolyl, pyrazolyl, pyridinyl, pyridazinyl, pyrimidyl, pyrazyl, pyrazinyl, pyrimidinyl, thiadiazolyl, imidazolyl, oxadiazolyl, thienyl, triazolyl, tetrazolyl, triazinyl, thiazolyl, thiophenyl, oxazolyl, isoxazolyl, benzothiophenyl, benzofuranyl, indolyl, azaindolyl, indazolyl,
  • benzimidazolyl azabenzimidazolyl, benzoxazolyl, benzothiazolyl, benzothiadiazolyl, imidazopyridinyl, isoxazolopyridinyl, thianaphthalenyl, purinyl, xanthinyl, adeninyl, guaninyl, quinolinyl, isoquinolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, quinoxalinyl, and quinazolinyl groups.
  • heteroaryl and heteroaryl groups include fused ring compounds such as wherein at least one ring, but not necessarily all rings, are aromatic, including tetrahydroquinolinyl, tetrahydroisoquinolinyl, indolyl and 2,3-dihydro indolyl.
  • the term also includes heteroaryl groups that have other groups bonded to one of the ring members, including but not limited to alkyl, halo, amino, hydroxy, cyano, carboxy, nitro, thio, or alkoxy groups.
  • Representative substituted heteroaryl groups can be substituted one or more times with groups such as those listed above.
  • aryl and heteroaryl groups include but are not limited to phenyl, biphenyl, indenyl, naphthyl (1-naphthyl, 2-naphthyl), N- hydroxytetrazolyl, N-hydroxytriazolyl, N-hydroxyimidazolyl, anthracenyl (1- anthracenyl, 2-anthracenyl, 3-anthracenyl), thiophenyl (2 -thienyl, 3-thienyl), furyl (2- furyl, 3-furyl), indolyl, oxadiazolyl (1,2,4-oxadiazolyl, 1,3,4-oxadiazolyl), thiadiazolyl (1,2,4-thiadiazolyl, 1,3,4-thiadiazolyl), isoxazolyl, quinazolinyl, fluorenyl, xanthenyl, isoindanyl, benzhydryl,
  • Heterocyclylalkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of an alkyl group is replaced with a bond to a heterocyclyl group as defined above.
  • Representative heterocyclyl alkyl groups include, but are not limited to, furan-2-yl methyl, furan-3-yl methyl, pyridine-2-yl methyl (a-picolyl), pyridine-3-yl methyl ( ⁇ -picolyl), pyridine-4-yl methyl ( ⁇ -picolyl), tetrahydrofuran-2-yl ethyl, and indol-2-yl propyl.
  • Heterocyclylalkyl groups can be substituted on the heterocyclyl moiety, the alkyl moiety, or both.
  • Heteroarylalkyl groups are alkyl groups as defined above in which a hydrogen or carbon bond of an alkyl group is replaced with a bond to a heteroaryl group as defined above. Heteroarylalkyl groups can be substituted on the heteroaryl moiety, the alkyl moiety, or both.
  • ring system as the term is used herein is meant a moiety comprising one, two, three or more rings, which can be substituted with non-ring groups or with other ring systems, or both, which can be fully saturated, partially unsaturated, fully unsaturated, or aromatic, and when the ring system includes more than a single ring, the rings can be fused, bridging, or spirocyclic.
  • spirocyclic is meant the class of structures wherein two rings are fused at a single tetrahedral carbon atom, as is well known in the art.
  • a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring” as the term is used herein refers to a ring system including an unsaturated ring possessing 4n+2 pi electrons, or a partially reduced (hydrogenated) form thereof.
  • the aromatic or partially aromatic ring can include additional fused, bridged, or spiro rings that are not themselves aromatic or partially aromatic.
  • naphthalene and tetrahydronaphthalene are both a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring" within the meaning herein.
  • a benzo-[2.2.2]- bicyclooctane is also a "monocyclic, bicyclic or polycyclic, aromatic or partially aromatic ring" within the meaning herein, containing a phenyl ring fused to a bridged bicyclic system.
  • a fully saturated ring has no double bonds therein, and is carbocyclic or heterocyclic depending on the presence of heteroatoms within the meaning herein.
  • alkoxy refers to an oxygen atom connected to an alkyl group, including a cycloalkyl group, as are defined above.
  • linear alkoxy groups include but are not limited to methoxy, ethoxy, n-propoxy, n-butoxy, n-pentyloxy, n- hexyloxy, n-heptyloxy, n-octyloxy n-nonyloxy, and the like.
  • branched alkoxy include but are not limited to isopropoxy, sec-butoxy, tert-butoxy, isopentyloxy, isohexyloxy, and the like.
  • cyclic alkoxy include but are not limited to cyclopropyloxy, cyclobutyloxy, cyclopentyloxy, cyclohexyloxy, and the like.
  • aryloxy and arylalkoxy refer to, respectively, an aryl group bonded to an oxygen atom and an aralkyl group bonded to the oxygen atom at the alkyl moiety. Examples include but are not limited to phenoxy, naphthyloxy, and benzyloxy.
  • acyl group refers to a group containing a carbonyl moiety wherein the group is bonded via the carbonyl carbon atom.
  • the carbonyl carbon atom is also bonded to another carbon atom, which can be part of an alkyl, aryl, aralkyl cycloalkyl, cycloalkylalkyl, heterocyclyl, heterocyclylalkyl, heteroaryl, heteroarylalkyl group or the like.
  • the group is a "formyl” group, an acyl group as the term is defined herein.
  • An acyl group can include 0 to about 12-20 additional carbon atoms bonded to the carbonyl group.
  • An acyl group can include double or triple bonds within the meaning herein.
  • An acryloyl group is an example of an acyl group.
  • An acyl group can also include heteroatoms within the meaning here.
  • a nicotinoyl group (pyridyl-3 -carbonyl) group is an example of an acyl group within the meaning herein.
  • Other examples include acetyl, benzoyl, phenylacetyl, pyridylacetyl, cinnamoyl, and acryloyl groups and the like.
  • the group containing the carbon atom that is bonded to the carbonyl carbon atom contains a halogen, the group is termed a "haloacyl" group.
  • An example is a trifluoroacetyl group.
  • amine includes primary, secondary, and tertiary amines having, e.g., the formula N(group) 3 wherein each group can independently be H or non- H, such as alkyl, aryl, and the like.
  • Amines include but are not limited to R-NH 2 , for example, alkylamines, arylamines, alkylarylamines; R 2 NH wherein each R is independently selected, such as dialkylamines, diarylamines, aralkylamines, heterocyclylamines and the like; and R 3 N wherein each R is independently selected, such as trialkylamines, dialkylarylamines, alkyldiarylamines, triarylamines, and the like.
  • the term "amine” also includes ammonium ions as used herein.
  • amino group is a substituent of the form -NH 2 , -NHR, -NR 2 , - NR 3 + , wherein each R is independently selected, and protonated forms of each.
  • any compound substituted with an amino group can be viewed as an amine.
  • ammonium ion includes the unsubstituted ammonium ion N3 ⁇ 4 + , but unless otherwise specified, it also includes any protonated or quaternarized forms of amines. Thus, trimethylammonium hydrochloride and tetramethylammonium chloride are both ammonium ions, and amines, within the meaning herein.
  • amide includes C- and N-amide groups, i.e., -C(0)NR 2 , and -NRC(0)R groups, respectively.
  • Amide groups therefore include but are not limited to carbamoyl groups (-C(0)NH 2 ) and formamide groups (-NHC(O)H).
  • a "carboxamido” group is a group of the formula C(0)NR 2 , wherein R can be H, alkyl, aryl, etc.
  • carbonyl refers to a -C(O)- group.
  • Halo include fluorine, chlorine, bromine and iodine.
  • perhaloalkyl refers to an alkyl group where all of the hydrogen atoms are replaced by halogen atoms. Perhaloalkyl groups include, but are not limited to, -CF 3 and -C(CF 3 ) 3 .
  • haloalkyl refers to an alkyl group where some but not necessarily all of the hydrogen atoms are replaced by halogen atoms. Haloalkyl groups include but are not limited to -CHF 2 and -CH 2 F.
  • perhaloalkoxy refers to an alkoxy group where all of the hydrogen atoms are replaced by halogen atoms.
  • Perhaloalkoxy groups include, but are not limited to, -OCF 3 and -OC(CF 3 ) 3 .
  • haloalkoxy refers to an alkoxy group where some but not necessarily all of the hydrogen atoms are replaced by halogen atoms.
  • Haloalkoxy groups include but are not limited to -OCHF 2 and -OCH 2 F.
  • a "salt" as is well known in the art includes an organic compound such as a carboxylic acid, a sulfonic acid, or an amine, in ionic form, in combination with a counterion.
  • acids in their anionic form can form salts with cations such as metal cations, for example sodium, potassium, and the like; with ammonium salts such as NH 4 + or the cations of various amines, including tetraalkyl ammonium salts such as tetramethylammonium, or other cations such as trimethylsulfonium, and the like.
  • a “pharmaceutically acceptable” or “pharmacologically acceptable” salt is a salt formed from an ion that has been approved for human consumption and is generally non-toxic, such as a chloride salt or a sodium salt.
  • a “zwitterion” is an internal salt such as can be formed in a molecule that has at least two ionizable groups, one forming an anion and the other a cation, which serve to balance each other. For example, amino acids such as glycine can exist in a zwitterionic form.
  • a “zwitterion” is a salt within the meaning herein.
  • the compounds of the present invention may take the form of salts.
  • the term “salts" embraces addition salts of free acids or free bases which are compounds of the invention. Salts can be “pharmaceutically-acceptable salts.” The term
  • “pharmaceutically-acceptable salt” refers to salts which possess toxicity profiles within a range that affords utility in pharmaceutical applications.
  • unacceptable salts may nonetheless possess properties such as high crystallinity, which have utility in the practice of the present invention, such as for example utility in process of synthesis, purification or formulation of compounds of the invention.
  • Suitable pharmaceutically-acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid.
  • inorganic acids include hydrochloric, hydrobromic, hydriodic, nitric, carbonic, sulfuric, and phosphoric acids.
  • Appropriate organic acids may be selected from aliphatic, cycloaliphatic, aromatic, araliphatic, heterocyclic, carboxylic and sulfonic classes of organic acids, examples of which include formic, acetic, propionic, succinic, glycolic, gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic, benzoic, anthranilic, 4-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic, ethanesulfonic, benzenesulfonic, pantothenic,
  • Suitable pharmaceutically acceptable base addition salts of compounds of the invention include, for example, metallic salts including alkali metal, alkaline earth metal and transition metal salts such as, for example, calcium, magnesium, potassium, sodium and zinc salts.
  • Pharmaceutically acceptable base addition salts also include organic salts made from basic amines such as, for example,
  • pharmaceutically unacceptable base addition salts include lithium salts and cyanate salts.
  • pharmaceutically unacceptable salts are not generally useful as medicaments, such salts may be useful, for example as intermediates in the synthesis of Formula I compounds, for example in their purification by recrystallization. All of these salts may be prepared by conventional means from the corresponding compound according to Formula I by reacting, for example, the appropriate acid or base with the compound according to Formula I.
  • pharmaceutically acceptable salts refers to nontoxic inorganic or organic acid and/or base addition salts, see, for example, Lit et al, Salt Selection for Basic Drugs (1986), IntJ. Pharm., 33, 201-217, incorporated by reference herein.
  • a "hydrate” is a compound that exists in a composition with water molecules.
  • the composition can include water in stoichiometric quantities, such as a monohydrate or a dihydrate, or can include water in random amounts.
  • a "hydrate” refers to a solid form, i.e., a compound in water solution, while it may be hydrated, is not a hydrate as the term is used herein.
  • a “solvate” is a similar composition except that a solvent other that water replaces the water.
  • a solvent other that water replaces the water.
  • methanol or ethanol can form an “alcoholate”, which can again be stoichiometric or non-stoichiometric.
  • a “solvate” refers to a solid form, i.e., a compound in solution in a solvent, while it may be solvated, is not a solvate as the term is used herein.
  • a "prodrug” as is well known in the art is a substance that can be administered to a patient where the substance is converted in vivo by the action of biochemicals within the patient's body, such as enzymes, to the active pharmaceutical ingredient.
  • prodrugs include esters of carboxylic acid groups, which can be hydro lyzed by endogenous esterases as are found in the bloodstream of humans and other mammals.
  • Isotopes are well know in the art and refer to atoms with the same number of protons but different number of neutrons. For example, carbon 12, the most common form of carbon, has six protons and six neutrons, whereas carbon 14 has six protons and eight neutrons.
  • the GLP-1 compounds, their pharmaceutically acceptable salts or hydrolyzable esters of the present invention may be combined with a pharmaceutically acceptable carrier to provide pharmaceutical compositions useful for treating the biological conditions or disorders noted herein in mammalian species, and more preferably, in humans.
  • a pharmaceutically acceptable carrier employed in these pharmaceutical compositions may vary depending upon the type of administration desired (e.g., intravenous, oral, topical, suppository, or parenteral).
  • compositions in oral liquid dosage forms e.g., suspensions, elixirs and solutions
  • typical pharmaceutical media such as water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents and the like
  • carriers such as starches, sugars, diluents, granulating agents, lubricants, binders, disintegrating agents and the like can be employed.
  • compositions of the compounds of the invention alone or in combination with another GLP-1 agonist or another type of therapeutic agent, or both.
  • GLP-1 receptor agonists include exenatide, liraglutide, taspoglutide, albiglutide, lixisenatide, and mixtures thereof.
  • the GLP-1 agonist is exenatide (Byetta®) or Byetta LAR®. Exenatide is described, for example, in U.S. Pat. Nos. 5,424,286; 6,902,744; 7,297,761, and others, the contents of each of which is herein incorporated by reference in its entirety.
  • the GLP-1 agonist is liraglutide (VICTOZA®) (also called NN-2211 and [Arg34, Lys26]-(N-epsilon-(gamma-Glu(N-alpha-hexadecanoyl))- GLP-1 (7-37)), includes the sequence
  • HAEGTFTSDVSSYLEGQAAKEFIAWKVRGRG (SEQ ID NO: l) and is available from Novo Nordisk (Denmark) or Scios (Fremont, Calif. USA). See, e.g., Elbrond et al, 2002, Diabetes Care. August; 25(8):1398404; Agerso et al, 2002, Diabetologia. February; 45(2): 195-202).
  • the GLP-1 agonist is taspoglutide (CAS Registry No. 275371-94-3) and is available from Hoffman La-Roche. See, for example, U.S. Pat. No. 7,368,427, the contents of which are herein incorporated by reference in its entirety.
  • the GLP-1 agonist is albiglutide (SYNCRIA® from Glaxo SmithKline) .
  • the GLP-1 agonist is lixisenatide (Lyxumia® from Sanofi-Aventis/Zealand Pharma)
  • compositions containing a compound of the invention can be prepared by conventional techniques, e.g., as described in Remington: The Science and Practice of Pharmacy, 19th Ed., 1995, incorporated by reference herein.
  • the compositions can appear in conventional forms, for example capsules, tablets, aerosols, solutions, suspensions or topical applications.
  • compositions include a compound of the invention and a pharmaceutically acceptable excipient which can be a carrier or a diluent.
  • the active compound will usually be mixed with a carrier, or diluted by a carrier, or enclosed within a carrier which can be in the form of an ampoule, capsule, sachet, paper, or other container.
  • the active compound can be solid, semi-solid, or liquid material that acts as a vehicle, excipient, or medium for the active compound.
  • the active compound can be adsorbed on a granular solid carrier, for example contained in a sachet.
  • suitable carriers are water, salt solutions, alcohols, polyethylene glycols,
  • polyhydroxyethoxylated castor oil peanut oil, olive oil, gelatin, lactose, terra alba, sucrose, dextrin, magnesium carbonate, sugar, cyclodextrin, amylose, magnesium stearate, talc, gelatin, agar, pectin, acacia, stearic acid or lower alkyl ethers of cellulose, silicic acid, fatty acids, fatty acid amines, fatty acid monoglycerides and diglycerides, pentaerythritol fatty acid esters, polyoxyethylene, hydroxymethylcellulose and polyvinylpyrrolidone.
  • the carrier or diluent can include any sustained release material known in the art, such as glyceryl monostearate or glyceryl distearate, alone or mixed with a wax.
  • the formulations can be mixed with auxiliary agents which do not deleteriously react with the active compounds.
  • auxiliary agents which do not deleteriously react with the active compounds.
  • Such additives can include wetting agents, emulsifying and suspending agents, salt for influencing osmotic pressure, buffers and/or coloring substances preserving agents, sweetening agents or flavoring agents.
  • the compositions can also be sterilized if desired.
  • the route of administration can be any route which effectively transports the active compound of the invention to the appropriate or desired site of action, such as oral, nasal, pulmonary, buccal, subdermal, intradermal, transdermal or parenteral, e.g., rectal, depot, subcutaneous, intravenous, intraurethral, intramuscular, intranasal, ophthalmic solution or an ointment, the oral route being preferred.
  • the carrier will typically comprise sterile water, although other ingredients that aid solubility or serve as preservatives can also be included.
  • injectable suspensions can also be prepared, in which case appropriate liquid carriers, suspending agents and the like can be employed.
  • the compounds of the present invention can be formulated using bland, moisturizing bases such as ointments or creams.
  • the preparation can be tabletted, placed in a hard gelatin capsule in powder or pellet form or it can be in the form of a troche or lozenge. If a liquid carrier is used, the preparation can be in the form of a syrup, emulsion, soft gelatin capsule or sterile injectable liquid such as an aqueous or non-aqueous liquid suspension or solution.
  • Injectable dosage forms generally include aqueous suspensions or oil suspensions which can be prepared using a suitable dispersant or wetting agent and a suspending agent Injectable forms can be in solution phase or in the form of a suspension, which is prepared with a solvent or diluent.
  • Acceptable solvents or vehicles include sterilized water, Ringer's solution, or an isotonic aqueous saline solution.
  • sterile oils can be employed as solvents or suspending agents.
  • the oil or fatty acid is non-volatile, including natural or synthetic oils, fatty acids, mono-, di- or tri-glycerides.
  • the formulation can also be a powder suitable for reconstitution with an appropriate solution as described above. Examples of these include, but are not limited to, freeze dried, rotary dried or spray dried powders, amorphous powders, granules, precipitates, or particulates.
  • the formulations can optionally contain stabilizers, pH modifiers, surfactants,
  • the compounds can be formulated for parenteral administration by injection such as by bolus injection or continuous infusion.
  • a unit dosage form for injection can be in ampoules or in multi-dose containers.
  • the formulations of the invention can be designed to provide quick, sustained, or delayed release of the active ingredient after administration to the patient by employing procedures well known in the art.
  • the formulations can also be formulated for controlled release or for slow release.
  • compositions contemplated by the present invention can include, for example, micelles or liposomes, or some other encapsulated form, or can be
  • the formulations can be compressed into pellets or cylinders and implanted intramuscularly or subcutaneously as depot injections.
  • Such implants can employ known inert materials such as silicones and biodegradable polymers, e.g., polylactide-polyglycolide.
  • biodegradable polymers include poly(orthoesters) and poly(anhydrides).
  • the preparation can contain a compound of the invention, dissolved or suspended in a liquid carrier, preferably an aqueous carrier, for aerosol application.
  • a liquid carrier preferably an aqueous carrier
  • the carrier can contain additives such as solubilizing agents, e.g., propylene glycol, surfactants, absorption enhancers such as lecithin
  • injectable solutions or suspensions preferably aqueous solutions with the active compound dissolved in polyhydroxylated castor oil.
  • Dosage forms can be administered daily, or more than once a day, such as twice or thrice daily. Alternatively dosage forms can be administered less frequently than daily, such as every other day, or weekly, if found to be advisable by a prescribing physician.
  • An embodiment of the invention also encompasses prodrugs of a compound of the invention which on administration undergo chemical conversion by metabolic or other physiological processes before becoming active pharmacological substances. Conversion by metabolic or other physiological processes includes without limitation enzymatic (e.g, specific enzymatically catalyzed) and non-enzymatic (e.g., general or specific acid or base induced) chemical transformation of the prodrug into the active pharmacological substance.
  • prodrugs will be functional derivatives of a compound of the invention which are readily convertible in vivo into a compound of the invention. Conventional procedures for the selection and preparation of suitable prodrug derivatives are described, for example, in Design of Prodrugs, ed. H. Bundgaard, Elsevier, 1985.
  • methods of making a composition of a compound described herein including formulating a compound of the invention with a pharmaceutically acceptable carrier or diluent.
  • the pharmaceutically acceptable carrier or diluent is suitable for oral administration.
  • the methods can further include the step of formulating the composition into a tablet or capsule.
  • the pharmaceutically acceptable carrier or diluent is suitable for parenteral administration.
  • the methods further include the step of lyophilizing the composition to form a lyophilized preparation.
  • the compounds of the invention can be used therapeutically in combination with i) one or more other GLP-1 modulators and/or ii) one or more other types of therapeutic agents which can be administered orally in the same dosage form, in a separate oral dosage form (e.g., sequentially or non-sequentially) or by injection together or separately (e.g., sequentially or non-sequentially).
  • combination therapeutic agents include Sitagliptin (MK-0431 , Januvia) an oral antihyperglycemic (antidiabetic drug) of the dipeptidyl peptidase-4 (DPP-4) inhibitor class and Exenatide (Byetta) an incretin mimetic.
  • Combinations of the invention include mixtures of compounds from (a) and (b) in a single formulation and compounds from (a) and (b) as separate formulations. Some combinations of the invention can be packaged as separate formulations in a kit. In some embodiments, two or more compounds from (b) are formulated together while a compound of the invention is formulated separately.
  • the present invention encompasses compounds that bind with high affinity and specificity to the GLP-1 receptor in an agonist manner or as an activator or a potentiator.
  • a compound of the invention acts as a positive allosteric modulator of GLP-1 receptor.
  • the present invention provides a method for activating, potentiating, or agonizing (i.e., to have an agonic effect, to act as an agonist) a GLP-1 receptor, with a compound of the invention.
  • the method involves contacting the receptor with a suitable concentration of an inventive compound to bring about activation of the receptor.
  • the contacting can take place in vitro, for example in carrying out an assay to determine the GLP-1 receptor activation activity of an inventive compound undergoing experimentation related to a submission for regulatory approval.
  • the method for activating an GLP-1 receptor can also be carried out in vivo, that is, within the living body of a mammal, such as a human patient or a test animal.
  • the inventive compound can be supplied to the living organism via one of the routes as described above, e.g. , orally, or can be provided locally within the body tissues. In the presence of the inventive compound, activation of the receptor takes place, and the effect thereof can be studied.
  • An embodiment of the present invention provides a method of treatment of a malcondition in a patient for which activation of an GLP-1 receptor is medically indicated, wherein the patient is administered the inventive compound in a dosage, at a frequency, and for a duration to produce a beneficial effect on the patient.
  • the inventive compound can be administered by any suitable means, examples of which are described above.
  • the present invention is directed to compounds adapted to act as modulators or potentiators of Class B GPCRs. These compounds may have activity on their own or in the presence of receptor ligands.
  • Receptors include incretin peptides including GLP-1 (7-36) and GLP-1 (9-36).
  • Methods of treatments provided by the invention include administration of a compound of the invention, alone or in combination with another
  • pharmacologically active agent to a subject or patient having a malcondition for which activation, potentiation or agonism of a glucagon-like peptide 1 receptor is medically indicated such as type I diabetes, type II diabetes, gestational diabetes, obesity, excessive appetite, insufficient satiety, or metabolic disorder.
  • Reagents (i) Zn(CN) 2 , Pd(PPh 3 ) 4 , NMP; (ii) NH 2 OH HCl, TEA, EtOH.
  • PG is a protecting group (i) EDC, HOBt, DMF then heat; (ii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • PG is a protecting group (i) NH 2 OH, TEA, water or EtOH; (ii) EDC, HOBt, DMF then heat; (iii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • PG is a protecting group
  • DIEA 1,1,1 -trifluoro-N-phenyl-N-((trifluoromethyl)sulfonyl)methanesulfonamide, DCM
  • KOAc bis-pinacolatoborane, PdCl 2 (dppf) or Pd(dppf)Cl 2 , Na 2 C0 3 , THF, MeCN, water;
  • Pd(dppf)Cl 2 Na 2 C0 3 , THF, MeCN, water;
  • Reagents PG is a protecting group; (i) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, MeCN, water; (ii) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, MeCN, water; (iii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • XA and X B is independently CP or N.
  • PG is a protecting group (i) DIEA or TEA, acetonitrile; (ii) Acetamide, boron trifluoride etherate, DCM; (iii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • PG is a protecting group (i) Boron trifluoride etherate, acetamide, DCM; (ii) Zn, I 2 , Pd 2 (dba) 3 , dicyclohexyl(2',6'-dimethoxy-[l, -biphenyl]-2- yl)phosphine, DMF; (iii) Deprotection e.g., methyl ester deprotection: NaOH, MeOH, water.
  • PG is a protecting group (i) Pd(dppf)Cl 2 , Na 2 C0 3 , THF,
  • PG is a protecting group (i) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, MeCN, water; (ii) Deprotection e.g., tert- vXy ⁇ ester deprotection: DCM, TFA
  • PGi and PG 2 are protecting groups (i) 2,4-bis(4- phenoxyphenyl)-l,3,2,4-dithiadiphosphetane 2,4-disulfide, DME, THF; (ii)
  • PG is a protecting group (i) 3-bromo-5-chloro-l,2,4- thiadiazole, NaHC0 3 , Pd(dppf)Cl 2 , water and THF, ACN or dioxane; (ii) NaHC0 3 , Pd(dppf)Cl 2 , water and THF, ACN or dioxane; (iii) Deprotection of PG, e.g., tert-butyl ester deprotection: DCM, TFA.
  • PG is a protecting group (i) NaO'Bu or Cs 2 C0 3 , Pd(dppf)Cl 2 or Pd 2 (dba) 3 , 2-dicyclohexylphosphino-2'-(N,N-dimethylamino)biphenyl, water and THF, ACN or dioxane; (ii) Deprotection of PG, e.g., tert-bvXy ⁇ ester deprotection: DCM, TFA.
  • PG is a protecting group (i) NaO'Bu or Cs 2 C0 3 , Pd 2 (dppf)Cl 2 or Pd 2 (dba) 3 , 2-dicyclohexylphosphino-2'-(N,N-dimethylamino)biphenyl, water and THF, ACN or dioxane; (ii) Deprotection of PG, e.g., tert- vXy ⁇ ester deprotection: DCM, TFA.
  • PG is a protecting group (i) NaO'Bu or Cs 2 C0 3 , Pd(dppf)Cl 2 or Pd 2 (dba) 3 , 2-dicyclohexylphosphino-2'-(N,N-dimethylamino)biphenyl, water and THF, ACN or dioxane; (ii) Deprotection of PG, e.g., tert-bvXy ⁇ ester deprotection:
  • PG is a protecting group (i) (a) where R 2 is NH-(CR a Rb) m - COOH: NH 2 -(CR a R b ) m -COOPG, HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA;(b) where R 2 is NH-S0 2 -R 8 : R 8 S0 2 NH 2 , DCC, DMAP, DCM (c) where R 2 is NR 4 iR4 2 : HNR 4 iR 42, HATU, DMF then deprotection e.g., tert-butyl ester deprotection: DCM, TFA: (d) where R 2 is N(Ri)-(CRaR b )m-CO-N(Ri)- heterocyclyl: HN(Ri)-(CR a R b )m-
  • Reagents PGi and PG 2 are protecting groups (i) DIEA, 1,1,1-trifluoro- N-phenyl-N-((trifluoromethyl)sulfonyl)methanesulfonamide, DCM; (ii) KOAc, bis- pinacolatoborane, PdCl 2 (dppf); (iii) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, MeCN, water;
  • PG is a protecting group (i) Pd(dppf)Cl 2 , Na 2 C0 3 , THF, MeCN, water; (ii) Deprotection of PG, e.g., tert-butyl ester deprotection: DCM, TFA.
  • PG is a protecting group (i) Zn(CN) 2 , Pd(Ph 3 ) 4 , NMP;
  • PG is a protecting group (i) NH 4 C1, NaN 3 , DMF; (ii) CsC0 3 , or K 2 C0 3 , DMF, acetone or acetonitrile; (iii) Deprotection of PG, e.g., tert- vXy ⁇ ester deprotection: DCM, TFA.
  • PG is a protecting group (i) sodium tert-butoxide, Pd 2 (dba) 3 , dioxane; (ii) Deprotection of PG, e.g., tert- vXy ⁇ ester deprotection: DCM, TFA.
  • PG is a protecting group (i) NaO'Bu or Cs 2 C0 3 , Pd 2 (dppf)Cl 2 or Pd 2 (dba) 3 , 2-dicyclohexylphosphino-2'-(N,N-dimethylamino)biphenyl, water and THF, ACN or dioxane; (ii) Pd/C, H 2 , EtOH, (iii) Deprotection of PG, e.g., tert-butyl ester deprotection: DCM, TFA.
  • Mass spectra were obtained using one of 5 systems.
  • System 1 Agilent 1100/6110 HPLC system equipped with a Thompson ODS-A, 100A, 5 ⁇ (50 X 4.6 mm) column using water with 0.1% formic acid as the mobile phase A, and acetonitrile with 0.1% formic acid as the mobile phase B.
  • Method 1 20-100% mobile phase B over 2.5 min then held at 100% for 2.5 min with a flow rate of 1 mL/min.
  • Method 2 5% mobile phase B for 1 min, 5-95% over 9 min, then held at 95% for 10 min, with a flow rate of 1 mL/min.
  • Method 3 20-100% mobile phase B over 2.5 min then held at 100% for 4.5 min with a flow rate of 1 mL/min.
  • System 2 Agilent 1200 LCMS equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
  • Method 4 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
  • Method 5 5-95% mobile phase B over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with an flow rate of 4.5 mL/min.
  • System 3 Waters Fractionlynx LCMS system equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ , (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
  • Method 6 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
  • Method 7 5-95% mobile phase B over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with an flow rate of 4.5 mL/min.
  • System 4 Agilent 1260 LCMS equipped with an Agilent Zorbax Extend RRHT 1.8 ⁇ (4.6 x 30 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
  • Method 8 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with a flow rate of 4.5 mL/min.
  • Method 9 5- 95% mobile phase B over 14 min with a flow rate of 2.5 mL/min, then held at 95% for 0.5 min with an flow rate of 4.5 mL/min.
  • System 5 Agilent 1260 LCMS equipped with a Waters Xselect CSH CI 8 3.5 ⁇ (4.6x50 mm) column using water with 0.1% formic acid as mobile phase A and acetonitrile with 0.1% formic acid as mobile phase B.
  • Method 10 The gradient was 5-95% mobile phase B over 13.0 min with a flow rate of 2.5 mL/min, then held at 95% for 1.0 min with an flow rate of 4.5 mL/min.
  • Method 11 The gradient was 5-95% mobile phase B over 3.0 min with a flow rate of 2.5 mL/min, then held at 95% for 0.6 min with an flow rate of 4.5 mL/min.
  • EA ethyl acetate
  • NMP l-methy-2-pyrrolidinone
  • TEA triethylamine
  • HOBt N- hydroxybenzotriazole
  • EDC N,N-dimethylformamide
  • DMF dimethyl acetamide
  • DMA Di-tert-butyl dicarbonate
  • Boc 2 0 N,N-Diisopropylethylamine
  • acetic acid AcOH
  • hydrochloric acid HC1
  • O-(7-azabenzotriazol-l-yl)-N,N,N',N'- tetramethyluronium hexafluorophosphate HATU
  • DMAP 4-dimethylaminopyridine
  • t-BuOH sodium tert-butanol
  • sodium HC1 O-(7-azabenzotriazol-l-yl)-N,N,N',N'- tetramethyluronium
  • Enantiomeric excess was determined by integration of peaks that were separated on a Diacel Chiralpak IA, 4.6 x 250 mm column, 5 ⁇ particle size.
  • the solvents used were "Solvent A”: 4: 1 (hexanes with 0.2% TFA): DCM, and "Solvent B”: EtOH.
  • the flow rate was held at 1.0 mL / min with the following gradient: Increase Solvent B from 2-10% over 30 min, hold Solvent B at 10% for 15 min.
  • reaction mixture was diluted with DCM, washed with NaHC0 3 , then dried with Na 2 S0 4 and concentrated. The resulting residue was dissolved in EtOH and heated in a microwave for 35 min at 110°C. The solvent was removed and the final product was purified by preparative HPLC.
  • the coupling reagent could be HATU (1.05 - 2.5 eq), EDC (1.5 eq) with HOBt (1.5 eq), DCC (1.1 eq) with HOBt (1.1 eq) or DCC (1.5 eq) with DMAP (2.0 eq).
  • the reaction mixture was stirred until the reaction was complete.
  • the reaction was diluted with EA and washed with saturated aqueous NaHC0 3 .
  • the organic layer was dried over MgS0 4 and
  • the reaction was diluted with EA and washed with saturated aqueous NaHC0 3 .
  • the organic layer was dried over Na 2 S0 4 and concentrated.
  • the product can be purified by chromatography, preparative HPLC, or carried on to the next step without further purification.
  • Compounds 3 - 11 and 13 - 61 were prepared from ( Z)-methyl 2-(4- (tert-butyl)benzamido)-3-(4-(N'-hydroxycarbamimidoyl)phenyl)propanoate INT-2 using General Procedures 5 and 4 sequentially.
  • Compounds 62 - 66 were prepared from (S,Z)-mst y ⁇ 2-(4-(tert- butyl)benzamido)-3 -(4-(N'-hydroxycarbamimidoyl)phenyl)propanoate INT-2 using General Procedures 5, 6, and 4 sequentially.
  • tert-butyl 2-aminoacetate (3.49 mg, 0.027 mmol) was added and the reaction mixture stirred at RT for 2 h.
  • LCMS analysis showed complete conversion to the intermediate.
  • the reaction mixture was partitioned between NaHCOs aqueous (5 ml) and DCM (1 mL), the organic layer was collected and concentrated by vacuum and then was re- dissolved in 1 mL of DCM and 0.1 mL of TFA. The mixture was heated to 30°C for 3 h.
  • Compounds 69 and 70 were prepared from (S,Z)-methyl 2-(4-(tert- butyl)benzamido)-3 -(4-(N'-hydroxycarbamimidoyl)phenyl)propanoate Compound 2 using General Procedures 7, and 8 sequentially.
  • Compound 75 was prepared from (5)-methyl 3-amino-4-(4- hydroxyphenyl)butanoate hydrochloride using General Procedures 7, 9, 1, 2, 5, and 4 sequentially.
  • Compound 76 was prepared using (S)-methyl 2-(4-(tert- butyl)benzamido)-3-(4-(5-(4-(heptyloxy)phenyl)-l,3,4-oxadiazol-2- yl)phenyl)propanoate and General Procedure 4.
  • Compound 77 was prepared from (5)-methyl 2-(4-(tert- butyl)benzamido)-3-(4-(4-(4-(heptyloxy)phenyl)oxazol-2-yl)phenyl)propanoate using General Procedure 4.
  • Compound 78 was prepared from (5)-methyl 2-((tert- butoxycarbonyl)amino)-3-(4-(2-(4-(heptyloxy)phenyl)oxazol-4-yl)phenyl)propanoate and 4-(tert-butyl)benzoic acid using General Procedures 8, 7 then 4.
  • Compound 80 was prepared from (5)-methyl 2-((tert- butoxycarbonyl)amino)-3-(4-(2-(4-(heptyloxy)phenyl)thiazol-4-yl)phenyl)propanoate and 4-(tert-butyl)benzoic acid using General Procedures 8, 7 then 4.
  • Compound 81 was prepared from Methyl 2-((tert- butoxycarbonyl)amino)-3-(4-(5-(4-(heptyloxy) phenyl) thiazol-2-yl) phenyl) propanoate and 4-(tert-butyl)benzoyl chloride using General Procedures 8, 3 then 4.
  • Compound 82 was prepared in a similar fashion to Compound 81 using 4-(2-(4-(heptyloxy) phenyl) thiazol-5-yl)benzaldehyde in place of 4-(5-(4- (heptyloxy)phenyl)thiazol-2-yl) benzaldehyde.
  • Compound 83 was prepared from (5)-methyl 2- (4-(tert-butyl) benzamido) -3-(4-(5-(4-(heptyloxy) phenyl)- 1, 3, 4-thiadiazol-2-yl)phenyl)propanoate using General Procedure 4.
  • Compound 84 was prepared using 3-bromo-5-chloro- 1 ,2,4-thiadiazole, (4-(heptyloxy)phenyl)boronic acid and INT-13 using General Procedures 10, 10, and 8 sequentially.
  • Pd(dppf)Cl 2 (0.136 g, 0.186 mmol) was added and the reaction was heated to 110°C in the microwave for 45 min. The reaction was diluted with EA (50mL) and filtered over celite. The organic phase was washed with water (100 mL) and concentrated.
  • Compound 182 can be prepared in a manner analogous to 165 starting from (R)-tert-butyl 2-(((benzyloxy)carbonyl)amino)-3-(4-hydroxyphenyl)propanoate.
  • Compound 191 can be prepared in a manner analogous to 85 starting from (R)-tert-butyl 2-(((benzyloxy)carbonyl)amino)-3-(4-hydroxyphenyl)propanoate.
  • Compound 193 was be prepared in a manner analogous to 192 starting from (R)-tert-buty ⁇ 2-(((benzyloxy)carbonyl)amino)-3-(4-hydroxyphenyl)propanoate.
  • Compound 256 was prepared from INT-14 and 5-(4,4,5,5-tetramethyl- l,3,2-dioxaborolan-2-yl)isoindolin-l-one using General Procedures 10, 12 and 8.
  • Compound 261 was prepared from INT-12 and l-(4- (heptyloxy)phenyl)piperazin-2-one using General Procedures 11 and 8.
  • Compound 262 was prepared in a similar fashion from INT-12 and l-(4- (heptyloxy)phenyl)imidazolidin-2-one using General Procedures 11 and 8.
  • Compound 263 was prepared using (5)-methyl 2-amino-3-(4- nitrophenyl)propanoate hydrochloride, 4-(tert-butyl)benzoic acid and l-(4- (heptyloxy)phenyl)piperidin-4-one using General Procedures 7, 14, 15 then 4.
  • Compound 266 can be prepared using INT-12 and l-([l,l'-biphenyl]-4- yl)piperazine using General Procedures 11 then 8.
  • Compound 268 was prepared using INT-12, tert-butyl 1,4-diazepane-l- carboxylate and l-bromo-4-(heptyloxy)benzene using General Procedures 11, 8, 11 then 8.
  • Compound 269 was prepared using 5-bromo-2-iodopyridine, INT-13 and (4-(heptyloxy)phenyl)boronic acid using General Procedures 10, 10, and 8 sequentially.
  • Compound 270 was prepared using 5-bromo-2-iodopyridine, (4- (heptyloxy)phenyl)boronic acid and INT-13 using General Procedures 10, 10, and 8 sequentially.
  • Compound 271 was prepared using 5-bromo-2-iodopyrimidine, (4- (heptyloxy)phenyl)boronic acid and INT-13 using General Procedures 10, 10, and 8 sequentially.
  • Compound 272 was prepared using 2-bromo-5-iodopyrazine, (4- (heptyloxy)phenyl)boronic acid and INT-13 using General Procedures 10, 10, and 8 sequentially.
  • Compound 273 was prepared using 3-chloro-6-iodopyridazine, (4- (heptyloxy)phenyl)boronic acid and INT-13 using General Procedures 10, 10, and 8 sequentially.
  • Compound 274 was prepared in a similar fashion to 79 using 3-(4- bromophenyl)-6-(4-(heptyloxy)phenyl)-l,2,4-triazine INT-20 in place of 2-(4- bromophenyl)-4-(4-(heptyloxy)phenyl)thiazole.
  • Compound 275 was prepared in a similar fashion to 274 using 6-(4- bromophenyl)-3-(4-(heptyloxy)phenyl)-l,2,4-triazine INT-21 in place of 3-(4- bromophenyl)-6-(4-(heptyloxy)phenyl)- 1 ,2,4-triazine.
  • Compound 283 was prepared from Compound 279 and tert-butyl glycinate using General Procedures 7 and 8 sequentially.
  • Compound 284 was prepared from Compound 281 and tert-butyl glycinate using General Procedures 7 and 8 sequentially.
  • Compound 285 was prepared from Compound 277 and tert-butyl glycinate using General Procedures 7 and 8 sequentially.
  • reaction mixture was heated in a microwave reactor at 1 10°C for 60 min.
  • the sample was cooled, diluted with EA (50 mL), and washed with sat aq.NaHC0 3 (30 mL).
  • the organic layers were dried over MgSC ⁇ , filtered, concentrated, and purified by chromatography (EA / hexane) to afford 205 mg (49%) of (5)-methyl 4-(4-(5- bromopyrimidin-2-yl)phenyl)-3-(4-(fert-butyl)benzamido)butanoate as a colourless solid.
  • Compound 293 was prepared using tert-butyl (S)-2-(4-(tert- butyl)benzamido)-3-(4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)propanoate INT-13 and 5-bromo-2-chloro-N,N-dimethylpyrimidin-4-amine using General Procedures 10, 10 and 8 sequentially.
  • Compound 294 was prepared using tert-butyl (S)-2-(4-(tert- butyl)benzamido)-3-(4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)propanoate INT-13 and 5-bromo-2-iodo-4-methylpyridine using General Procedures 10, 10 and 8 sequentially 5-bromo-2-iodo-4-(trifluoromethyl)pyridine
  • Compound 295 was prepared by employing tert-bvXy ⁇ (S)-2-(4-(tert- butyl)benzamido)-3-(4-(4,4,5,5-tetramethyl-l,3,2-dioxaborolan-2-yl)phenyl)propanoate INT-13 and 5-bromo-2-iodo-4-(trifluoromethyl)pyridine using General Procedures 10, 10 and 8 sequentially.
  • the crude material was diluted in EA (50 mL), washed with saturated aqueous sodium bicarbonate (20 mL) and brine (20 mL). The organic layer was dried over MgS0 4 , filtered, and the solvent removed under reduced pressure. The crude product was purified by
  • the crude material was diluted in EA (50 mL), washed with saturated aqueous sodium bicarbonate (20 mL) and brine (20 mL). The organic layer was dried over MgS0 4 , filtered, and the solvent removed under reduced pressure. The crude product was purified by chromatography (EA / hexanes) to afford the intermediate tert-butyl ester (122 mg).
  • Compounds 300 - 304 were prepared from (S)-2-(4-(tert- butyl)benzamido)-3-(4-(5-(4-(heptyloxy)phenyl)pyrimidin-2-yl)phenyl)propanoic acid Compound 85 using General Procedures 3 ox 7 followed by 4 or 8.
  • Compound 318 was prepared from (5)-2-(4-(tert-butyl)benzamido)-3-(4- (5-(4-(hexyloxy)phenyl)pyrimidin-2-yl)phenyl)propanoic acid Compound 225 using General Procedures 7 followed by 8.
  • the reaction mixture was diluted with EA (25 mL) and washed with saturated aqueous NaHC0 3 (2 x 25 mL) and 1 M HC1 (2 x 25 mL).
  • the organic phase was dried over MgS0 4 , filtered, and concentrated.
  • the solid was purified by chromatography (EA / hexanes) to afford the methyl ester intermediate as a colorless solid.
  • TEA (32.1 ⁇ , 0.23 mmol) was added to a suspension ⁇ (S)-(2-(4-(tert- butyl)benzamido)-3-(4-(5-(4-(heptyloxy)phenyl)pyrimidin-2-yl)phenyl)propanoyl) glycine Compound 297 (75.0 mg, 0.11 mmol), methanesulfonamide (12.1 mg, 0.13 mmol), HATU (52.6 mg, 0.14 mmol) and DMAP (1.41 mg, 0.01 mmol) in DCM (2 mL). The resultant yellow suspension was stirred at RT for 3 h.
  • GLP-1 P AM shift cAMP assay dose response of peptide ligand in presence of fixed concentration of compound.
  • a GLP-1 R expressing CRE-bla CHO-Kl cell line was purchased from Invitrogen. Cells were seeded into 384-well white flat bottom plates at 5000 cells/well/20 growth media (DMEM-High glucose, 10% dialyzed FBS, 0.1 mM NEAA, 25 mM Hepes, lOOU/mL penicillin/ 10( ⁇ g/mL streptomycin, 5 ⁇ / ⁇ ,
  • GLP-1R CRE-bla CHO-K1 cells cultured in growth medium (DMEM- High glucose, 10% dialyzed FBS, 0.1 mM NEAA, 25 mM Hepes, lOOU/mL
  • GLP-l(7-36) (SEQ ID NO:2):
  • GLP-l(9-36) (SEQ ID NO:3): EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH 2 .
  • GLP-1 (7-36) was purchased from GenScript.
  • GLP-1 (9-36) was purchased from Biopeptide Co., Inc.
  • Activity data for selected GLP-1 modulators are displayed in Table 2.
  • the EC 20 GLP-1 (9-36) PAM Activity range is denoted as follows: + denotes activity ⁇ 0.8 ⁇ , ++ denotes activity between 0.8 and 2.5 ⁇ , +++ denotes activity between 2.5 and 5 ⁇ , and ++++ denotes activity 5 to 10 ⁇ .
  • COMPOUND EC 20 GLP- 1(9-36) COMPOUND EC 20 GLP- 1(9-36) NUMBER PAM ECso NUMBER PAM ECso

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Diabetes (AREA)
  • Immunology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Endocrinology (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Child & Adolescent Psychology (AREA)
  • Emergency Medicine (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Heterocyclic Carbon Compounds Containing A Hetero Ring Having Nitrogen And Oxygen As The Only Ring Hetero Atoms (AREA)
  • Peptides Or Proteins (AREA)
  • Plural Heterocyclic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Thiazole And Isothizaole Compounds (AREA)
  • Nitrogen- Or Sulfur-Containing Heterocyclic Ring Compounds With Rings Of Six Or More Members (AREA)
  • Hydrogenated Pyridines (AREA)
  • Pyridine Compounds (AREA)
PCT/US2012/069289 2011-12-12 2012-12-12 Novel glp-1 receptor modulators Ceased WO2013090454A2 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
ES12806828T ES2836973T3 (es) 2011-12-12 2012-12-12 Derivados de ácido carboxílico que comprenden cuatro ciclos que actúan como moduladores de receptor GLP-1 para la terapia de enfermedades tales como la diabetes
HK15103363.6A HK1202864B (en) 2011-12-12 2012-12-12 Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes
CA2857197A CA2857197C (en) 2011-12-12 2012-12-12 Novel glp-1 receptor modulators
CN201280060896.1A CN104080767A (zh) 2011-12-12 2012-12-12 新的glp-1受体调节剂
EP12806828.5A EP2791112B1 (en) 2011-12-12 2012-12-12 Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes
BR112014013925-3A BR112014013925B1 (pt) 2011-12-12 2012-12-12 Compostos moduladores do receptor de glp-1 e composição e combinação farmacêutica compreendendo os ditos compostos
KR1020147017945A KR20140107340A (ko) 2011-12-12 2012-12-12 당뇨병과 같은 치료를 위한 glp-1 수용체 조절제로서 작용하는 4 개의 사이클을 포함하는 카르복실산 유도체
JP2014546193A JP6061949B2 (ja) 2011-12-12 2012-12-12 糖尿病などの疾患の治療のためのglp−1受容体モジュレーターとして作用する4つの環を含むカルボン酸誘導体
AU2012352349A AU2012352349B2 (en) 2011-12-12 2012-12-12 Carboxylic acid derivatives comprising four cycles acting as GLP-1 receptor modulators for therapy of diseases such as diabetes
NZ626122A NZ626122B2 (en) 2011-12-12 2012-12-12 Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes
MX2014006622A MX365923B (es) 2011-12-12 2012-12-12 Derivados de acido carboxilico que comprenden cuatro ciclos, que actuan como moduladores del receptor del peptido 1 similar al glucagon (glp-1) para terapia de enfermedades como la diabetes.
RU2014128522A RU2634896C2 (ru) 2011-12-12 2012-12-12 Новые модуляторы рецептора glp-1
HK15102640.3A HK1202119A1 (en) 2011-12-12 2012-12-12 Novel glp-1 receptor modulators

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201161569754P 2011-12-12 2011-12-12
US61/569,754 2011-12-12
US201161570789P 2011-12-14 2011-12-14
US61/570,789 2011-12-14
US201261734300P 2012-12-06 2012-12-06
US61/734,300 2012-12-06

Publications (2)

Publication Number Publication Date
WO2013090454A2 true WO2013090454A2 (en) 2013-06-20
WO2013090454A3 WO2013090454A3 (en) 2013-10-10

Family

ID=47436261

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2012/069289 Ceased WO2013090454A2 (en) 2011-12-12 2012-12-12 Novel glp-1 receptor modulators

Country Status (13)

Country Link
US (2) US8778923B2 (https=)
EP (1) EP2791112B1 (https=)
JP (1) JP6061949B2 (https=)
KR (1) KR20140107340A (https=)
CN (1) CN104080767A (https=)
AU (1) AU2012352349B2 (https=)
BR (1) BR112014013925B1 (https=)
CA (1) CA2857197C (https=)
ES (1) ES2836973T3 (https=)
HK (1) HK1202119A1 (https=)
MX (1) MX365923B (https=)
RU (1) RU2634896C2 (https=)
WO (1) WO2013090454A2 (https=)

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8816121B2 (en) 2010-06-09 2014-08-26 Receptos, Inc. GLP-1 receptor stabilizers and modulators
WO2014201172A1 (en) * 2013-06-11 2014-12-18 Receptos, Inc. Novel glp-1 receptor modulators
US9187522B2 (en) 2011-12-12 2015-11-17 Receptos, Inc. GLP-1 receptor modulators
WO2016015014A1 (en) * 2014-07-25 2016-01-28 Receptos, Inc. Novel glp-1 receptor modulators
US9278910B2 (en) 2011-05-31 2016-03-08 Receptos, Inc. GLP-1 receptor stabilizers and modulators
WO2016094729A1 (en) * 2014-12-10 2016-06-16 Celgene International Ii Sarl Glp-1 receptor modulators
WO2018200833A1 (en) * 2017-04-28 2018-11-01 Celgene International Ii Sarl Novel glp-1 receptor modulators
WO2020103815A1 (en) * 2018-11-22 2020-05-28 Qilu Regor Therapeutics Inc. Glp-1r agonists and uses thereof
WO2020210582A1 (en) * 2019-04-11 2020-10-15 University Of The Sciences Allosteric agonists and positive allosteric modulators of glucagon-like peptide 1 receptor
WO2020207474A1 (en) 2019-04-12 2020-10-15 Qilu Regor Therapeutics Inc. Glp-1r agonists and uses thereof
US10858359B2 (en) 2016-06-07 2020-12-08 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic ring derivatives useful as SHP2 inhibitors
US10954221B2 (en) 2019-04-12 2021-03-23 Qilu Regor Therapeutics Inc. GLP-1R agonists and uses thereof
US10988466B2 (en) 2017-03-23 2021-04-27 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic derivatives useful as SHP2 inhibitors
WO2021096284A1 (ko) * 2019-11-15 2021-05-20 일동제약(주) Glp-1 수용체 작용제 및 이의 용도
WO2021187886A1 (ko) * 2020-03-18 2021-09-23 주식회사 엘지화학 Glp-1 수용체 효능제, 이를 포함하는 약학적 조성물 및 이의 제조방법
WO2022111624A1 (zh) 2020-11-27 2022-06-02 深圳信立泰药业股份有限公司 一种苯并咪唑类衍生物及其制备方法和医药用途
US12233062B2 (en) 2018-09-26 2025-02-25 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic derivatives useful as SHP2 inhibitors
US12473271B2 (en) 2020-11-20 2025-11-18 Gilead Sciences, Inc. GLP-1R modulating compounds
US12497382B2 (en) 2019-10-25 2025-12-16 Gilead Sciences, Inc. GLP-1R modulating compounds
US12570642B2 (en) 2021-04-21 2026-03-10 Gilead Sciences, Inc. GLP-IR modulating compounds

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP7418958B2 (ja) 2016-03-17 2024-01-22 チオジェネシス セラピューティクス, インコーポレイテッド システアミンの制御放出のための組成物及びシステアミン感受性障害の全身治療
JP7091255B2 (ja) 2016-05-06 2022-06-27 アイオニス・ファーマシューティカルズ・インコーポレイテッド Glp-1受容体リガンド部分コンジュゲート化オリゴヌクレオチドおよびその使用
JP7208982B2 (ja) 2017-09-20 2023-01-19 チオジェネシス セラピューティクス, インコーポレイテッド システアミン感受性障害の治療方法
WO2020113094A1 (en) 2018-11-30 2020-06-04 Nuvation Bio Inc. Pyrrole and pyrazole compounds and methods of use thereof
CN112521501A (zh) * 2019-09-18 2021-03-19 鸿运华宁(杭州)生物医药有限公司 Gipr抗体及其与glp-1的融合蛋白质,以及其药物组合物和应用
CN117645601A (zh) * 2020-06-10 2024-03-05 重庆康丁医药技术有限公司 一种具有心血管益处的glp-1小分子
CN117222644A (zh) * 2021-04-12 2023-12-12 诺华股份有限公司 2-((4-((S)-2-(4-氯-2-氟苯基)-2-甲基苯并[d][1,3]二氧戊环-4-基)哌啶-1-基)甲基)-1-(((S)-氧杂环丁烷-2-基)甲基)-1H-咪唑衍生物作为GLP1受体激活剂治疗肥胖症
TW202521533A (zh) 2023-09-14 2025-06-01 香港商歌禮製藥(中國)有限公司 Glp-1r 激動劑及其治療方法
US12291530B1 (en) 2023-11-24 2025-05-06 Ascletis Pharma (China) Co., Limited GLP-1R agonist and therapeutic method thereof

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
US6902744B1 (en) 1999-01-14 2005-06-07 Amylin Pharmaceuticals, Inc. Exendin agonist formulations and methods of administration thereof
US7297761B2 (en) 1996-08-08 2007-11-20 Amylin Pharmaceuticals, Inc. Pharmaceutical compositions containing exendins
US7368427B1 (en) 1998-12-07 2008-05-06 Societe De Conseils De Recherches Et D'applications Scientifiques, Sas GLP-1 analogues

Family Cites Families (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IT1062206B (it) 1974-02-01 1983-09-20 Rotta Research Lab S P A A S Derivati della tirosina attivi sulla muscolatura liscia
DE2423536A1 (de) 1974-05-15 1975-11-27 Bayer Ag 3-amino-phenylessigsaeure-derivate, verfahren zu ihrer herstellung sowie ihre verwendung als herbizide
US6174905B1 (en) 1996-09-30 2001-01-16 Mitsui Chemicals, Inc. Cell differentiation inducer
US6583139B1 (en) * 1997-07-31 2003-06-24 Eugene D. Thorsett Compounds which inhibit leukocyte adhesion mediated by VLA-4
HUP0003921A3 (en) * 1997-07-31 2001-03-28 Wyeth Corp Sulfonylated dipeptide compounds which inhibit leukocyte adhesion mediated by vla-4, pharmaceutical compositions comprising thereof and their use
BR9811730B1 (pt) * 1997-08-22 2014-04-08 Hoffmann La Roche Derivados de n-aroilfenilalanina, uso dos mesmos, medicamentos contendo os mesmos.
US6191171B1 (en) 1997-11-20 2001-02-20 Merck & Co., Inc. Para-aminomethylaryl carboxamide derivatives
AU3487500A (en) * 1999-02-08 2000-08-25 Lion Bioscience Ag Thiazole derivatives and combinatorial libraries thereof
RU2281283C2 (ru) 2000-03-07 2006-08-10 Санофи-Авентис Дойчланд Гмбх Замещенные 3-фенил-5-алкокси-1,3,4-оксадиазол-2-оны и их применение для ингибирования гормоночувствительной липазы
JP4895067B2 (ja) * 2000-09-29 2012-03-14 味の素株式会社 新規フェニルアラニン誘導体
AU2002350217A1 (en) 2001-12-04 2003-06-17 Bristol-Myers Squibb Company Glycinamides as factor xa inhibitors
AU2003211560A1 (en) * 2002-02-20 2003-09-09 Ajinomoto Co., Inc. Novel phenylalanine derivative
WO2003089410A1 (en) * 2002-04-19 2003-10-30 Kyowa Hakko Kogyo Co., Ltd. Phenylalanine derivative
KR101194176B1 (ko) * 2003-12-22 2012-10-24 아지노모토 가부시키가이샤 신규한 페닐알라닌 유도체
KR20070004676A (ko) * 2004-02-10 2007-01-09 얀센 파마슈티카 엔.브이. 알파4 인테그린의 길항제로서의 피리다지논
US7825139B2 (en) 2005-05-25 2010-11-02 Forest Laboratories Holdings Limited (BM) Compounds and methods for selective inhibition of dipeptidyl peptidase-IV
WO2008112939A2 (en) 2007-03-13 2008-09-18 Board Of Regents, The University Of Texas System Composition and method for making oligo-benzamide compounds
EP2155720B1 (en) 2007-06-08 2013-07-17 Advinus Therapeutics Private Limited Pyrrole-2-carboxamide derivatives as glucokinase activators, their process and pharmaceutical application
WO2011094890A1 (en) * 2010-02-02 2011-08-11 Argusina Inc. Phenylalanine derivatives and their use as non-peptide glp-1 receptor modulators
US8501982B2 (en) 2010-06-09 2013-08-06 Receptos, Inc. GLP-1 receptor stabilizers and modulators
JP6007417B2 (ja) 2011-05-31 2016-10-12 レセプトス エルエルシー 新規glp−1受容体安定剤および調節剤
CA2837334C (en) 2011-06-01 2022-05-10 Andrew Llc Broadband distributed antenna system with non-duplexer isolator sub-system
AU2012352349B2 (en) 2011-12-12 2017-08-17 Receptos Llc Carboxylic acid derivatives comprising four cycles acting as GLP-1 receptor modulators for therapy of diseases such as diabetes
CN109867630A (zh) 2013-06-11 2019-06-11 赛尔基因第二国际有限公司 新型glp-1受体调节剂

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5424286A (en) 1993-05-24 1995-06-13 Eng; John Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same
US7297761B2 (en) 1996-08-08 2007-11-20 Amylin Pharmaceuticals, Inc. Pharmaceutical compositions containing exendins
US7368427B1 (en) 1998-12-07 2008-05-06 Societe De Conseils De Recherches Et D'applications Scientifiques, Sas GLP-1 analogues
US6902744B1 (en) 1999-01-14 2005-06-07 Amylin Pharmaceuticals, Inc. Exendin agonist formulations and methods of administration thereof

Non-Patent Citations (13)

* Cited by examiner, † Cited by third party
Title
"Design ofProdrugs", 1985, ELSEVIER
AGERSO ET AL., DIABETOLOGIA, vol. 45, no. 2, February 2002 (2002-02-01), pages 195 - 202
DRUCKER, D. J., ENDOCRINOLOGY, vol. 142, 2001, pages 521 - 7
DRUCKER, D. J., ENDOCRINOLOGY, vol. 144, 2003, pages 5145 - 8
DUEZ, ENDOCRINOLOGY, vol. 150, no. 1, January 2009 (2009-01-01), pages 56 - 62
ELBROND ET AL., DIABETES CARE., vol. 25, no. 8, August 2002 (2002-08-01), pages 1398404
HOLST, J. J., DIABETES METAB. RES. REV., vol. 18, 2002, pages 430 - 41
HOLZ, G. G.; CHEPURNY O. G., CURR. MED. CHEM., vol. 10, 2003, pages 2471 - 83
KIEFFER T. J.; HABENER, J. F., ENDOCRIN. REV., vol. 20, 1999, pages 876 - 913
LIST, J. F.; HABENER, J. F., AM. J. PHYSIOL. ENDOCRINOL. METAB., vol. 286, 2004, pages E875 - 81
LIT: "Salt Selection for Basic Drugs", INTJ. PHARM., vol. 33, 1986, pages 201 - 217
PEDERSON, DIABETES, vol. 47, August 1998 (1998-08-01), pages 1253 - 1258
RCMINGTON: "The Science and Practice of Pharmacy", 1995

Cited By (47)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8816121B2 (en) 2010-06-09 2014-08-26 Receptos, Inc. GLP-1 receptor stabilizers and modulators
US9278910B2 (en) 2011-05-31 2016-03-08 Receptos, Inc. GLP-1 receptor stabilizers and modulators
US9700543B2 (en) 2011-05-31 2017-07-11 Celgene International Ii Sàrl GLP-1 receptor stabilizers and modulators
US9187522B2 (en) 2011-12-12 2015-11-17 Receptos, Inc. GLP-1 receptor modulators
AU2014278183B2 (en) * 2013-06-11 2018-10-04 Receptos Llc Novel GLP-1 receptor modulators
WO2014201172A1 (en) * 2013-06-11 2014-12-18 Receptos, Inc. Novel glp-1 receptor modulators
US9260427B2 (en) 2013-06-11 2016-02-16 Receptos, Inc. GLP-1 receptor modulators
CN105593225A (zh) * 2013-06-11 2016-05-18 瑞塞普托斯有限责任公司 新型glp-1受体调节剂
US10259823B2 (en) 2013-06-11 2019-04-16 Celgene International Ii Sàrl GLP-1 receptor modulators
CN105593225B (zh) * 2013-06-11 2019-04-16 赛尔基因第二国际有限公司 新型glp-1受体调节剂
US9598430B2 (en) 2013-06-11 2017-03-21 Celgene International Ii Sàrl GLP-1 receptor modulators
EA030857B1 (ru) * 2013-06-11 2018-10-31 Селджин Интернэшнл Ii Сарл Новые модуляторы рецептора glp-1
EA032525B1 (ru) * 2014-07-25 2019-06-28 Селджин Интернэшнл Ii Сарл Модуляторы рецептора glp-1
WO2016015014A1 (en) * 2014-07-25 2016-01-28 Receptos, Inc. Novel glp-1 receptor modulators
CN112457301A (zh) * 2014-07-25 2021-03-09 赛尔基因第二国际有限公司 新的glp-1受体调节剂
US9839664B2 (en) 2014-07-25 2017-12-12 Celgene International Ii Sàrl GLP-1 receptor modulators
CN107074820B (zh) * 2014-07-25 2021-05-18 赛尔基因第二国际有限公司 Glp-1受体调节剂
CN107074820A (zh) * 2014-07-25 2017-08-18 赛尔基因第二国际有限公司 新的glp‑1受体调节剂
KR20170040233A (ko) * 2014-07-25 2017-04-12 셀진 인터내셔널 Ii 에스에이알엘 신규 glp-1 수용체 조절제
KR102564946B1 (ko) * 2014-07-25 2023-08-08 리셉토스 엘엘씨 신규 glp-1 수용체 조절제
US9474755B2 (en) 2014-07-25 2016-10-25 Celgene International Ii Sarl GLP-1 receptor modulators
AU2015292356B2 (en) * 2014-07-25 2020-02-06 Receptos Llc Novel GLP-1 receptor modulators
JP2017526734A (ja) * 2014-07-25 2017-09-14 セルジーン インターナショナル ツー エスエーアールエル 新規のglp−1受容体モジュレーター
WO2016094729A1 (en) * 2014-12-10 2016-06-16 Celgene International Ii Sarl Glp-1 receptor modulators
AU2015360364B2 (en) * 2014-12-10 2020-04-30 Receptos Llc GLP-1 receptor modulators
US10034886B2 (en) 2014-12-10 2018-07-31 Celgene International Ii Sàrl GLP-1 receptor modulators
US9795613B2 (en) 2014-12-10 2017-10-24 Celgene International Ii Sàrl GLP-1 receptor modulators
US10858359B2 (en) 2016-06-07 2020-12-08 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic ring derivatives useful as SHP2 inhibitors
US10988466B2 (en) 2017-03-23 2021-04-27 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic derivatives useful as SHP2 inhibitors
WO2018200833A1 (en) * 2017-04-28 2018-11-01 Celgene International Ii Sarl Novel glp-1 receptor modulators
US11530205B2 (en) 2017-04-28 2022-12-20 Receptos Llc GLP-1 receptor modulators
US12233062B2 (en) 2018-09-26 2025-02-25 Jacobio Pharmaceuticals Co., Ltd. Heterocyclic derivatives useful as SHP2 inhibitors
KR102904955B1 (ko) 2018-11-22 2025-12-30 치루 레고르 테라퓨틱스 인코포레이티드 Glp-1r 작용제 및 그의 용도
US12365670B2 (en) 2018-11-22 2025-07-22 Qilu Regor Therapeutics Inc. GLP-IR agonists and uses thereof
WO2020103815A1 (en) * 2018-11-22 2020-05-28 Qilu Regor Therapeutics Inc. Glp-1r agonists and uses thereof
KR20210106447A (ko) * 2018-11-22 2021-08-30 치루 레고르 테라퓨틱스 인코포레이티드 Glp-1r 효능제 및 그의 용도
US10844049B2 (en) 2018-11-22 2020-11-24 Qilu Regor Therapeutics Inc. GLP-1R agonists and uses thereof
WO2020210582A1 (en) * 2019-04-11 2020-10-15 University Of The Sciences Allosteric agonists and positive allosteric modulators of glucagon-like peptide 1 receptor
US11591321B2 (en) 2019-04-12 2023-02-28 Qilu Regor Therapeutics Inc. GLP-1R agonists and uses thereof
WO2020207474A1 (en) 2019-04-12 2020-10-15 Qilu Regor Therapeutics Inc. Glp-1r agonists and uses thereof
US10954221B2 (en) 2019-04-12 2021-03-23 Qilu Regor Therapeutics Inc. GLP-1R agonists and uses thereof
US12497382B2 (en) 2019-10-25 2025-12-16 Gilead Sciences, Inc. GLP-1R modulating compounds
WO2021096284A1 (ko) * 2019-11-15 2021-05-20 일동제약(주) Glp-1 수용체 작용제 및 이의 용도
WO2021187886A1 (ko) * 2020-03-18 2021-09-23 주식회사 엘지화학 Glp-1 수용체 효능제, 이를 포함하는 약학적 조성물 및 이의 제조방법
US12473271B2 (en) 2020-11-20 2025-11-18 Gilead Sciences, Inc. GLP-1R modulating compounds
WO2022111624A1 (zh) 2020-11-27 2022-06-02 深圳信立泰药业股份有限公司 一种苯并咪唑类衍生物及其制备方法和医药用途
US12570642B2 (en) 2021-04-21 2026-03-10 Gilead Sciences, Inc. GLP-IR modulating compounds

Also Published As

Publication number Publication date
CA2857197C (en) 2019-11-26
US9187522B2 (en) 2015-11-17
KR20140107340A (ko) 2014-09-04
HK1202119A1 (en) 2015-09-18
AU2012352349A1 (en) 2014-07-03
BR112014013925A2 (en) 2018-05-15
RU2634896C2 (ru) 2017-11-08
MX365923B (es) 2019-06-20
US8778923B2 (en) 2014-07-15
US20130178420A1 (en) 2013-07-11
NZ626122A (en) 2016-10-28
JP6061949B2 (ja) 2017-01-18
BR112014013925B1 (pt) 2022-02-22
EP2791112A2 (en) 2014-10-22
HK1202864A1 (en) 2015-10-09
CN104080767A (zh) 2014-10-01
EP2791112B1 (en) 2020-09-23
RU2014128522A (ru) 2016-02-10
US20150038416A1 (en) 2015-02-05
JP2015505842A (ja) 2015-02-26
MX2014006622A (es) 2014-09-22
ES2836973T3 (es) 2021-06-28
WO2013090454A3 (en) 2013-10-10
CA2857197A1 (en) 2013-06-20
AU2012352349B2 (en) 2017-08-17

Similar Documents

Publication Publication Date Title
AU2012352349B2 (en) Carboxylic acid derivatives comprising four cycles acting as GLP-1 receptor modulators for therapy of diseases such as diabetes
US10259823B2 (en) GLP-1 receptor modulators
US10034886B2 (en) GLP-1 receptor modulators
HK1202864B (en) Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes
NZ626122B2 (en) Carboxylic acid derivatives comprising four cycles acting as glp-1 receptor modulators for therapy of diseases such as diabetes
NZ715006B2 (en) Novel glp-1 receptor modulators

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12806828

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2857197

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2014/006622

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2014546193

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20147017945

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2012352349

Country of ref document: AU

Date of ref document: 20121212

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2012806828

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2014128522

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112014013925

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112014013925

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20140609