WO2012167251A1 - Long-acting glp-1/glucagon receptor agonists - Google Patents
Long-acting glp-1/glucagon receptor agonists Download PDFInfo
- Publication number
- WO2012167251A1 WO2012167251A1 PCT/US2012/040744 US2012040744W WO2012167251A1 WO 2012167251 A1 WO2012167251 A1 WO 2012167251A1 US 2012040744 W US2012040744 W US 2012040744W WO 2012167251 A1 WO2012167251 A1 WO 2012167251A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- oxm
- peg
- another embodiment
- fms
- fmoc
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/12—Antidiuretics, e.g. drugs for diabetes insipidus
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
Definitions
- Pegylated and reverse pegylated oxyntomodulin including pharmaceutical compositions comprising the same and methods of using the same are disclosed.
- Proteins and especially short peptides are susceptible to denaturation or enzymatic degradation in the blood, liver or kidney. Accordingly, proteins typically have short circulatory half-lives of several hours. Because of their low stability, peptide drugs are usually delivered in a sustained frequency so as to maintain an effective plasma concentration of the active peptide. Moreover, since peptide drugs are usually administered by infusion, frequent injection of peptide drugs cause considerable discomfort to a subject. Thus, there is a need for technologies that will prolong the half-lives of therapeutic proteins and peptides while maintaining a high pharmacological efficacy thereof. Such desired peptide drugs should also meet the requirements of enhanced serum stability, high activity and a low probability of inducing an undesired immune response when injected into a subject.
- Serum half-life is an empirical characteristic of a molecule, and must be determined experimentally for each new potential drug.
- physiological clearance mechanisms such as renal filtration can make the maintenance of therapeutic levels of a drug unfeasible because of cost or frequency of the required dosing regimen.
- OXM Oxyntomodulin
- OXM enhances glucose clearance via stimulation of insulin secretion after both oral and intraperitoneal administration. It also regulates the control of food intake.
- Intracerebroventricular (ICV) and intranuclear injection of OXM into the paraventricular and arcuate nuclei (ARC) of the hypothalamus inhibits re-feeding in fasting rats (Dakin et al. 2001; Dakin et al. 2004). This inhibition has also been demonstrated in freely fed rats at the start of the dark phase.
- peripheral administration of OXM dose-dependently inhibited both fast-induced and dark-phase food intake (Dakin et al. 2004).
- prodrugs are prepared by derivatizing the drug with functional groups that are sensitive to bases and removable under mild basic conditions such as physiological conditions.
- the derivatization includes a substitution of at least one amino, hydroxyl mercapto and/or carboxyl groups of the drug molecule with a linker such as 9-fluorenylmethoxycarbonyl (Fmoc) and 2-sulfo-9-fluorenylmethoxycarbonyl (FMS), to which a group of Polyethylene glycol (PEG) moiety is attached.
- a linker such as 9-fluorenylmethoxycarbonyl (Fmoc) and 2-sulfo-9-fluorenylmethoxycarbonyl (FMS)
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9-fluorenylmethoxycarbonyl
- the link between the PEG moiety and the drug is not direct but rather both residues are linked to different positions of the scaffold FMS or Fmoc structures that are highly sensitive to basic conditions.
- the present invention relates to OXM derivative in which the half
- the present invention provides a composition consisting of a dual GLP-1 /Glucagon receptor agonist linked or bound to polyethylene glycol polymer (PEG polymer) via 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- PEG polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9-fluorenylmethoxycarbonyl
- the present invention further provides a method for reducing food intake, reducing body weight, or both in a subject, comprising the step of administering to the subject a dual GLP-l/Glucagon receptor agonist conjugated to polyethylene glycol polymer (PEG polymer) via a flexible linker, wherein said flexible linker is 9- P-74757-PC fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- the linker is a cleavable linker.
- the present invention further provides a method of inducing glucose tolerance, improving glycemic control, or both in a subject in need thereof, comprising the step of administering to the subject an effective amount of a composition consisting of a dual GLP-1 /Glucagon receptor agonist linked to polyethylene glycol polymer (PEG polymer) via 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9- fluorenylmethoxycarbonyl (FMS) and a pharmaceutical acceptable carrier.
- PEG polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9- fluorenylmethoxycarbonyl
- the present invention further provides a method for reducing insulin resistance in a subject, comprising the step of administering to the subject an effective amount of a composition comprising a dual GLP-1 /Glucagon receptor agonist conjugated to polyethylene glycol polymer (PEG polymer).
- a composition comprising a dual GLP-1 /Glucagon receptor agonist conjugated to polyethylene glycol polymer (PEG polymer).
- the present invention further provides a method for extending the biological half life of a GLP-1 /Glucagon receptor agonist consisting of the step of conjugating the agonist to polyethylene glycol polymer (PEG polymer) via a flexible linker comprising 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- PEG polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9-fluorenylmethoxycarbonyl
- the present invention further provides a method for extending the biological half life of a dual GLP-1 /Glucagon receptor agonist, consisting of the step of conjugating the agonist to polyethylene glycol polymer (PEG polymer) via a flexible linker comprising 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- PEG polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9-fluorenylmethoxycarbonyl
- the present invention further provides a method for improving the area under the curve (AUC) of a GLP-1 /Glucagon receptor agonist, consisting of the step of conjugating a polyethylene glycol polymer (PEG polymer) to the amino terminus of the agonist via 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9- fluorenylmethoxycarbonyl (FMS).
- AUC area under the curve
- PEG polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9- fluorenylmethoxycarbonyl
- the present invention further provides a method for reducing a dosing frequency of a dual GLP-1 /Glucagon receptor agonist, consisting of the step of conjugating a polyethylene glycol polymer (PEG polymer) to the amino terminus of said oxyntomodulin via 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9- fluorenylmethoxycarbonyl (FMS).
- PEG polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9- fluorenylmethoxycarbonyl
- the present invention provides a method for increasing insulin sensitivity in a subject, comprising the step of administering to the subject an effective P-74757-PC amount of a composition comprising a dual GLP-1 /Glucagon receptor agonist conjugated to polyethylene glycol polymer (PEG polymer).
- the present invention provides a method for increasing insulin sensitivity in a subject following acute treatment or chronic treatment, comprising the step of administering to the subject an effective amount of a composition comprising a dual GLP-1 /Glucagon receptor agonist conjugated to polyethylene glycol polymer (PEG polymer).
- Figure 1 is a graph showing the pharmacokinetic profile of OXM, PEGio-Fmoc- OXM and PEG 2 o-Fmoc-OXM in male rats.
- Rats received a single SC bolus injection of native OXM (62nmol/kg), PEGio-Fmoc-OXM (containing 278 ⁇ 3 ⁇ 4 OXM peptide) or PEG 20 -Fmoc-OXM (containing 62nmol/kg OXM peptide) in 0.5 ml PBS buffer. Serum samples were collected from the jugular vein at specified time points and OXM concentration was analyzed using OXM Elisa kit (Bachem, Switzerland).
- Figure 2 are graphs showing the pharmacokinetic profile of OXM and PEG 4 o-Fmoc- OXM in male rats.
- Rats received a single IV bolus (A) or SC (B) injection of native OXM (62mnol/kg) or PEG 4 o-Fmoc-OXM (containing 62nmol/kg body weight OXM peptide) in 0.5 ml PBS buffer. Serum samples were collected from the jugular vein at specified time points and OXM concentration was analyzed using OXM Elisa kit (Bachem, Switzerland). The overlay insert highlight the OXM profile which is apparent in the first two hours after administration.
- Figure 3 is a graph showing the in-vitro activity of native OXM, PEG 4 o-Fmoc-OXM and PEG 40 -EMCS-OXM.
- CHO-K1 cells over-expressing GLP-1 receptor (Millipore HTS163C2) were seeded in 96 wells half-area white at a density of 200,000 cells/ml and incubated for 24 hours at 37°C. The cells were incubated with escalating concentrations of OXM (ALMAC), PEG40-EMCS-OXM and PEG40-Fmoc-OXM with or without Rat serum 1% (Bio reclamation). Cells cAMP concentrations were quantified by HTRF assay (Cisbio 62AM4PEB) and EC50 parameter was analyzed by PRISM software.
- Figure 4 are graphs showing the induction of glucose tolerance in mice with native OXM and PEG 40 -Fmoc-OXM and PEG 40 -EMCS-OXM as measured by IP glucose tolerance test (IPGTT).
- IPGTT IP glucose tolerance test
- Glucose 1.5gr/kg was administrated ⁇ either 15min after test article administration (vehicle, OXM and PEG 40 - Osu) or 120 min after PEG 4 o-Fmoc-OXM administration. Blood glucose levels were measured by tail vein sampling prior to glucose administration and 10, 20, 30, 60 and 120 min after glucose administration using a handheld glucometer. Graph (A) provides the blood glucose profile and graph (B) shows the glucose AUC.
- SEMs are calculated from the residuals of the statistical model. Mice were dosed for 7 days started on Day 1. Data analyzed by ANCOVA with body weight on Day 1 as covariate followed by Williams' test (OXM in PBS) or multiple t test (sibutramine and PEG40-FMS- OXM) vs appropriate vehicle. Significant differences vs. appropriate vehicle: *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001. Percentage values indicate difference from appropriate vehicle group on Day 8 (i.e. after 7 days dosing).
- Figure 7 shows the effects of reversible PEGylated OXM Administration on body weight in Diet Induced Obesity (DIO) Mice.
- DIO Diet Induced Obesity
- PEG40-FMS-OXM (6,000nmol/kg), E. PEG30-FMS-OXM (6,000nmol/kg), F. Vehicle (PBS), and G. OXM (6,000nmol/kg; PBS).
- PBS PEG40-FMS-OXM
- E. PEG30-FMS-OXM 6,000nmol/kg
- F. Vehicle PBS
- G. OXM 6,000nmol/kg; PBS
- FIG. 8 shows the acute effects of reversible PEGylated OXM administration on glucose tolerance in Diet Induced Obesity (DIO) Mice.
- DIO Diet Induced Obesity
- Figure 9 shows the effects of reversible PEGylated OXM administration on terminal glucose, glycerol, cholesterol and insulin in Diet Induced Obesity (DIO) Mice.
- Terminal plasma samples were collected (24 hours after the final dose of test or control compound on Day 29) by cardiac puncture and assayed for insulin, glucose and cholesterol using the mouse ultrasensitive insulin ELISA (80-INSMSU-ElO), Thermoelectron Infinity glucose reagent (TR15421) and Thermoelectron Infinity cholesterol reagent (TR13421).
- FIG 10 shows the effects of reversible PEGylated OXM administration on terminal body composition analysis of fat, water, protein and ash (bone) in Diet Induced Obesity (DIO) Mice.
- Body fat (A), water (B), protein (C), and ash levels (D) of DIO mouse carcasses were determined using standard chemical analysis techniques.
- the treatment groups were as follows: A. PEG40-SH (662 mg/kg), B. PEG40-EMC S-OXM (6,000nmol/kg), C. PEG30-EMCS-OXM (6,000nmol/kg), D. PEG40-FMS-OXM (6,000nmol/kg), E. PEG30-FMS-OXM (6,000nmol/kg), F. Vehicle (PBS), and G. OXM (6,000nmol/kg; PBS).
- Figure 11 shows that administration of PEG-OXM variants PEG40-EMCS-OXM, PEG30-EMCS-OXM, PEG40-FMS-OXM, PEG30-FMS-OXM produced marked and significant reductions in fasting glucose and fasting plasma insulin when compared to controls.
- Figure 12 shows that administration of PEG-OXM variants PEG30-FMS-OXM, PEG40-FMS-OXM and PEG60-FMS-OXM produced marked and significant reductions in fasting glucose and fasting plasma insulin when compared to controls.
- Figure 13 shows that administration of PEG-OXM variants PEG5 -FMS-OXM, PEG30-FMS -OXM, PEG40-FMS-OXM and PEG60-FMS-OXM produced marked and significant reductions in body weight when compared to controls.
- the present invention provides a long-acting dual GLP-1/ Glucagon receptor agonist and methods of producing and using the same.
- the present invention provides a long-acting oxyntomodulin and methods of producing and using same.
- a long-acting dual GLP-1 /Glucagon receptor agonist is a composition comprising or consisting of oxyntomodulin, polyethylene glycol P-74757-PC polymer (PEG polymer) and 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9- fluorenylmethoxycarbonyl (FMS).
- a long-acting oxyntomodulin is a composition comprising or consisting of oxyntomodulin, polyethylene glycol polymer (PEG polymer) and 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- the present invention provides a modified oxyntomodulin peptide comprising an oxyntomodulin peptide, a polyethylene glycol (PEG) polymer, and a 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- the present invention provides a modified oxyntomodulin peptide consisting of an oxyntomodulin peptide, a polyethylene glycol (PEG) polymer, and a 9- fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- a long-acting oxyntomodulin is a composition comprising or consisting of oxyntomodulin and polyethylene glycol polymer (PEG polymer).
- the terms dual "GLP-l/Glucagon receptor agonist” and “agonist” are used interchangeably herein.
- the terms also include any GLP- 1/Glucagon receptor agonist known in the art.
- the preferred agonist is oxyntomodulin or OXM or a functional variant thereof.
- the term "functional" refers to the ability of the agonist or OXM provided herein to have biological activity, which include but is not limited to, reducing weight, increasing insulin sensitivity, etc., as further provided herein.
- a long-acting dual GLP-1 /Glucagon receptor agonist is a pegylated oxyntomodulin.
- a long-acting dual GLP-1 /Glucagon receptor agonist is a reversed pegylated oxyntomodulin.
- a long- acting oxyntomodulin is a pegylated oxyntomodulin.
- a long-acting oxyntomodulin is a reversed pegylated oxyntomodulin.
- the phrases "long-acting oxyntomodulin”, “reversed pegylated oxyntomodulin”, “reversible PEGylated OXM”, and "a composition comprising or consisting of oxyntomodulin, polyethylene glycol polymer (PEG polymer) and 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9- fluorenylmethoxycarbonyl (FMS)" are used interchangeably.
- a long- acting oxyntomodulin is OXM linked to PEG via Fmoc or FMS.
- a long-acting dual GLP-1 /Glucagon receptor agonist provided herein comprises a PEG polymer.
- the agonist comprises a PEG polymer conjugated to the amino terminus of an oxyntomodulin peptide via Fmoc or FMS.
- a long-acting oxyntomodulin of the invention comprises a PEG polymer.
- a long-acting oxyntomodulin of the invention comprises a P-74757-PC
- a long-acting oxyntomodulin is a composition comprising or consisting of oxyntomodulin, polyethylene glycol polymer (PEG polymer) and 9- fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS) in a molar ratio of 1:0.2-10:0.2-10.
- PEG polymer polyethylene glycol polymer
- Fmoc 9- fluorenylmethoxycarbonyl
- FMS 2-sulfo-9-fluorenylmethoxycarbonyl
- a long-acting oxyntomodulin is a composition comprising or consisting of oxyntomodulin, polyethylene glycol polymer (PEG polymer) and 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS) in a molar ratio of 1:0.5-2:0.5-2.
- PEG polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9-fluorenylmethoxycarbonyl
- a long-acting oxyntomodulin is a composition comprising or consisting of oxyntomodulin, polyethylene glycol polymer (PEG polymer) and 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9- fluorenylmethoxycarbonyl (FMS) in a molar ratio of 1 : 1 : 1.
- a long- acting oxyntomodulin includes a PEG polymer conjugated to the amino tenninus of oxyntomodulin via Fmoc or FMS.
- a long-acting dual GLP-1 /Glucagon receptor agonist is linked to PEG via a reversible linker such as, but not limited to, Fmoc and FMS.
- a long-acting oxyntomodulin is linked to PEG via a reversible linker such as, but not limited to, Fmoc and FMS.
- Fmoc and FMS are sensitive to bases and are removable under physiological conditions.
- a reversible linker is a linker that is sensitive to bases and is removable under physiological conditions.
- a reversible linker is a linker that is sensitive to bases and is removable under physiological conditions in the blood, plasma, or lymph.
- a reversible linker is a linker that is sensitive to bases and is removable under physiological conditions in a body fluid.
- a reversible linker is a linker that is removable in a body fluid having a basic pH.
- a linker that is sensitive to bases is cleaved upon exposure to a basic environment thus releasing OXM from the linker and PEG.
- a reverse pegylated oxyntomodulin is a composition wherein OXM is linked to PEG via a reversible linker.
- a reverse pegylated oxyntomodulin releases free OXM upon exposure to a basic environment.
- a reverse pegylated oxyntomodulin releases free OXM upon exposure to blood or plasma.
- a long-acting oxyntomodulin comprises PEG and oxyntomodulin that are not linked directly to each other, as in standard pegylation procedures, but rather both residues are linked to different positions of Fmoc or FMS which P-74757-PC are highly sensitive to bases and are removable under regular physiological conditions.
- regular physiological conditions include a physiologic environment such as the blood or plasma.
- a long-acting oxyntomodulin is non-reversibly conjugated to PEG using EMCS (see example 3).
- reverse pegylation renders OXM a long-acting OXM.
- long-acting oxyntomodulin is an oxyntomodulin with an extended biological half-life.
- reverse pegylation provides protection against degradation of a dual GLP-1 /Glucagon receptor agonist. In another embodiment, reverse pegylation provides protection against degradation of OXM. In another embodiment, reverse pegylation affects the C max of OXM to reduce harmful side effects. In another embodiment, reverse pegylation extends the T m ax of OXM. In another embodiment, reverse pegylation extends the circulatory half-live of OXM. In another embodiment, reverse pegylated OXM has improved bioavailability compared to non-modified OXM. In another embodiment, reverse pegylated OXM has improved biological activity compared to non-modified OXM. In some embodiments, reverse pegylation enhances the potency of OXM.
- a reverse pegylated OXM is at least equivalent to the non- modified OXM, in terms of biochemical measures. In other embodiments, a reverse pegylated OXM is at least equivalent to the non-modified OXM, in terms of pharmacological measures. In other embodiments, a reverse pegylated OXM is at least equivalent to the non- modified OXM, in terms of binding capacity (Kd). In other embodiments, a reverse pegylated OXM is at least equivalent to the non-modified OXM, in terms of absorption through the digestive system. In other embodiments, a reverse pegylated OXM is more stable during absorption through the digestive system than non-modified OXM.
- a reverse pegylated dual GLP-1 /Glucagon receptor agonist exhibits improved blood area under the curve (AUC) levels compared to free agonist.
- a reverse pegylated OXM exhibits improved blood area under the curve (AUC) levels compared to free OXM.
- a reverse pegylated OXM exhibits improved biological activity and blood area under the curve (AUC) levels compared to free OXM.
- a reverse pegylated dual GLP-1 /Glucagon receptor P-74757-PC agonist exhibits improved blood retention time (ti/ 2 ) compared to free OXM.
- a reverse pegylated OXM exhibits improved blood retention time (tj /2 ) compared to free OXM. In another embodiment, a reverse pegylated OXM exhibits improved biological activity and blood retention time (ti /2 ) compared to free OXM. In another embodiment, a reverse pegylated OXM exhibits improved blood C max levels compared to free OXM, thereby reducing potentially harmful side effects. In another embodiment, a reverse pegylated OXM exhibits improved biological activity compared to free OXM.
- a method of improving OXM's AUC, Cmax, t] 2, biological activity, or any combination thereof comprising or consisting of the step of conjugating a polyethylene glycol polymer (PEG polymer) to the amino terminus of free OXM via 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- PEG polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9-fluorenylmethoxycarbonyl
- the present invention further provides a method for improving the area under the curve (AUC) of oxyntomodulin, consisting of the step of conjugating a polyethylene glycol polymer (PEG polymer) to the amino terminus of said oxyntomodulin via 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9- fluorenylmethoxycarbonyl (FMS).
- AUC area under the curve
- the GLP-1 or glucagon agonist activity of any given glucagon analogue peptide may be quantified by determining an EC 50 value for that peptide in a selected assay for GLP-1 or glucagon activity.
- the EC50 value is a measure of the concentration at which half of that compound's maximal activity in the particular assay is achieved.
- the EC 50 value in an assay for GLP-1 or glucagon agonist activity will be referred to as EC 50 [GLP-1] and EC 50 [Glu] respectively.
- EC 50 values for different compounds are compared, it will be understood that they describe the activity of the relevant compounds in the same assay under otherwise identical conditions.
- the ratio EC 5 o[Glu]/EC 5 o[GLP-l] for the glucagon analogue peptide may be greater than the ratio EC 5 o[Glu]/ECso[GLP-l] for glucagon. This may be interpreted to mean that the glucagon analogue peptide has a greater selectivity for GLP-1 receptor than glucagon.
- improvement of OXM's AUC, C max , ti / , biological activity, or any combination thereof by conjugating a polyethylene glycol polymer (PEG polymer) to the amino terminus of free OXM via 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9- fluorenylmethoxycarbonyl (FMS) enables the reduction in dosing frequency of OXM.
- a method for reducing a dosing frequency of OXM comprising or consisting of the step of conjugating a polyethylene glycol polymer (PEG P-74757-PC polymer) to the amino terminus or lysine residues of OXM via 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- PEG P-74757-PC polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9-fluorenylmethoxycarbonyl
- OXM comprises the amino acid sequence of SEQ ID NO: 1.
- OXM consists of the amino acid sequence of SEQ ID NO: 1.
- SEQ ID NO: 1 comprises or consists of the following amino acid (AA) sequence: HSQGTFTSD YSKYLD SRJ AQDF VQ WLMNTKPvNRNNIA (SEQ ID NO: 1).
- OXM comprises or consists of the amino acid sequence depicted in CAS No. 62340-29-8.
- OXM is human OXM or any mammal OXM.
- OXM is also referred to as glucagon-37 or bioactive enteroglucagon.
- OXM is a dual GLP-1 /Glucagon receptor agonist.
- OXM is a biologically active fragment of OXM.
- biologically active OXM extends from amino acid 30 to amino acid 37 of SEQ ID NO: 1.
- biologically active OXM extends from amino acid 19 to amino acid 37 of SEQ ID NO: 1.
- OXM of the invention corresponds to an octapeptide from which the two C-terminal amino acids are deleted.
- OXM of the invention corresponds to any fragment of SEQ ID NO: 1 which retains OXM activity as described herein.
- OXM refers to a peptide homologue of the peptide of SEQ ID NO: 1.
- OXM amino acid sequence of the present invention is at least 40% homologous to the OXM sequence set forth in SEQ ID NO: 1 as determined using BlastP software of the National Center of Biotechnology Information (NCBI) using default parameters.
- OXM amino acid sequence of the present invention is at least 50% homologous to the OXM sequence set forth in SEQ ID NO: 1 as determined using BlastP software of the NCBI using default parameters.
- OXM amino acid sequence of the present invention is at least 60% homologous to the OXM sequence set forth in SEQ ID NO: 1 as determined using BlastP software of the NCBI using default parameters. In one embodiment, OXM amino acid sequence of the present invention is at least 70% homologous to the OXM sequence set forth in SEQ ID NO: 1 as determined using BlastP software of the NCBI using default parameters. In one embodiment, OXM amino acid sequence of the present invention is at least 80% homologous to the OXM sequence set forth in SEQ ID NO: 1 as determined using BlastP software of the NCBI using default parameters. P-74757-PC
- OXM amino acid sequence of the present invention is at least 90% homologous to the OXM sequence set forth in SEQ ID NO: 1 as determined using BlastP software of the NCBI using default parameters. In one embodiment, OXM amino acid sequence of the present invention is at least 95% homologous to the OXM sequence set forth in SEQ ID NO: 1 as determined using BlastP software of the NCBI using default parameters.
- the OXM derivatives or variants of the present invention contain several amino acid substitutions, and/or can be PEGylated or otherwise modified (e.g. recombinantly or chemically).
- the OXM provided herein also covers any analogue of the above OXM sequence. Any one or more amino acid residues in the sequence can be independently replaced with a conservative replacement as well known in the art i.e. replacing an amino acid with one of a similar chemical type such as replacing one hydrophobic amino acid with another. Alternatively, non-conservative amino acid mutations can be made that result in an enhanced effect or biological activity of OXM. In particular the OXM is modified to be resistant to cleavage and inactivation by dipeptidyl peptidase IV (DPP-IV)
- DPP-IV dipeptidyl peptidase IV
- the dual GLP-1 /Glucagon receptor agonist provided herein can be chemically modified.
- the OXM provided herein can be chemically modified.
- the amino acid side chains, the amino terminus and/or the carboxy acid terminus of OXM can be modified.
- the OXM can undergo one or more of alkylation, disulphide formation, metal complexation, acylation, esterification, amidation, nitration, treatment with acid, treatment with base, oxidation or reduction. Methods for carrying out these processes are well known in the art.
- the OXM is provided as a lower alkyl ester, a lower alkyl amide, a lower dialkyl amide, an acid addition salt, a carboxylate salt or an alkali addition salt thereof.
- the amino or carboxylic termini of the OXM may be derivatised by for example, esterification, amidation, acylation, oxidation or reduction.
- the carboxylic terminus of the OXM can be derivatised to form an amide moiety.
- the long-acting dual GLP-1 /Glucagon receptor agonist of the invention maintains the biological activity of the unmodified agonist.
- the OXM of the invention maintains the biological activity of unmodified P-74757-PC
- the long-acting OXM of the invention maintains the biological activity of unmodified OXM.
- the long-acting OXM of the invention comprising OXM biological activity.
- the biological activity of a long-acting OXM of the invention comprises reducing digestive secretions.
- the biological activity of a long-acting OXM of the invention comprises reducing and delaying gastric emptying.
- the biological activity of a long-acting OXM of the invention comprises the inhibition of the fed motility pattern in the small intestine.
- the biological activity of a long-acting OXM of the invention comprises the inhibition of acid secretion stimulated by pentagastrin.
- the biological activity of a long-acting OXM of the invention comprises an increase of gastric somatostatin release. In another embodiment, the biological activity of a long-acting OXM of the invention comprises potentiating the effects of peptide YY. In another embodiment, the biological activity of a long-acting OXM of the invention comprises the inhibition of ghrelin release. In another embodiment, the biological activity of long-acting OXM of the invention comprises the up-regulation of adiponectin. In another embodiment, the biological activity of long-acting OXM of the invention comprises reducing free fatty acids. . In another embodiment, the biological activity of long-acting OXM of the invention comprises reducing triglycerides.
- the biological activity of long-acting OXM of the invention comprises reducing cholesterol.
- the biological activity of a long-acting OXM of the invention comprises the stimulation of aminopyrine accumulation and cAMP production.
- the biological activity of a long-acting OXM of the invention comprises binding the GLP-1 receptor or the glucagon receptor.
- the biological activity of a long-acting OXM of the invention comprises stimulating H+ production by activating the adenylate cyclase.
- the biological activity of a long-acting OXM of the invention comprises inhibiting histamine-stimulated gastric acid secretion.
- the biological activity of a long-acting OXM of the invention comprises inhibiting food intake. In another embodiment, the biological activity of a long-acting OXM of the invention comprises stimulating insulin release. In another embodiment, the biological activity of a long-acting OXM of the invention comprises inhibiting exocrine pancreatic secretion. In another embodiment, the biological activity of a long-acting OXM of the invention comprises increasing insulin sensitivity. In another embodiment, the biological activity of a long-acting OXM of the invention comprises reducing glucose levels. P-74757-PC
- the terms "reducing the level of refers to a reduction of about 1- 10% relative to an original, wild-type, normal or control level. In another embodiment, the reduction is of about 11-20%. In another embodiment, the reduction is of about 21-30%. In another embodiment, the reduction is of about 31-40%. In another embodiment, the reduction is of about 41-50%. In another embodiment, the reduction is of about 51-60%. In another embodiment, the reduction is of about 61-70%). In another embodiment, the reduction is of about 71-80%). In another embodiment, the reduction is of about 81-90%. In another embodiment, the reduction is of about 91-95%). In another embodiment, the reduction is of about 96-100%.
- the terms "increasing the level of or "extending” refers to a increase of about 1-10% relative to an original, wild-type, normal or control level. In another embodiment, the increase is of about 11-20%). In another embodiment, the increase is of about 21-30%. In another embodiment, the increase is of about 31-40%. In another embodiment, the increase is of about 41-50%. In another embodiment, the increase is of about 51-60%. In another embodiment, the increase is of about 61-70%. In another embodiment, the increase is of about 71-80%. In another embodiment, the increase is of about 81-90%). In another embodiment, the increase is of about 91-95%o. In another embodiment, the increase is of about 96-100%.
- the present invention further provides a method of inducing glucose tolerance, improving glycemic control, or both in a subject in need thereof, comprising the step of administering to the subject an effective amount of a composition consisting of a dual GLP-1 /Glucagon receptor agonist linked to polyethylene glycol polymer (PEG polymer) via 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9- fluorenylmethoxycarbonyl (FMS) and a pharmaceutical acceptable carrier.
- PEG polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9- fluorenylmethoxycarbonyl
- the present invention further provides a method of inducing glucose tolerance, improving glycemic control, or both in a subject in need thereof, comprising the step of administering to the subject an effective amount of a composition consisting of an oxyntomodulin linked to polyethylene glycol polymer (PEG polymer) via 9- fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS) and a pharmaceutical acceptable carrier.
- PEG polymer polyethylene glycol polymer
- Fmoc 9- fluorenylmethoxycarbonyl
- FMS 2-sulfo-9-fluorenylmethoxycarbonyl
- the present invention further provides a method for extending the biological half life of a dual GLP-1 /Glucagon receptor agonist, consisting of the step of conjugating the agonist to polyethylene glycol polymer (PEG polymer) via a flexible linker P-74757-PC comprising 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- PEG polymer polyethylene glycol polymer
- Fmoc 9-fluorenylmethoxycarbonyl
- FMS 2-sulfo-9-fluorenylmethoxycarbonyl
- the present invention further provides a method for extending the biological half life of oxyntomodulin, consisting of the step of conjugating oxyntomodulin, a polyethylene glycol polymer (PEG polymer) and 9-fluorenylmethoxycarbonyl (Fmoc) or 2- sulfo-9-fluorenylmethoxycarbonyl (FMS) in a molar ratio of about 1 :1:0.5 to about 1:1:3.5.
- the molar ratio is 1 : 1:10 OXM to PEG to linker.
- the range is 1 :1:5- 1:1:9, In another embodiment, the range is 1:1:3.7-1:1-4.9.
- the present invention further provides a method for reducing food intake, reducing body weight, or both in a subject, comprising the step of administering to the subject a dual GLP-1 /Glucagon receptor agonist conjugated to polyethylene glycol polymer (PEG polymer) via a flexible linker, wherein said flexible linker is 9- fiuorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9-fluorenylmethoxycarbonyl (FMS).
- the subject is afflicted with diabetes.
- the subject is overweight.
- the subject is afflicted with obesity.
- the present invention further provides a method for reducing food intake, reducing body weight, or both in a subject, comprising the step of administering to the subject oxyntomodulin conjugated to polyethylene glycol polymer (PEG polymer) via a flexible linker, wherein said flexible linker is 9-fluorenylmethoxycarbonyl (Fmoc) or 2- sulfo-9-fluorenylmethoxycarbonyl (FMS).
- the subject is afflicted with diabetes.
- the subject is overweight.
- the subject is afflicted with obesity.
- the PEG-OXM compounds provided herein induce significant reduction of glucose level without increasing insulin level.
- the PEG- OXM compounds provided herein unexpectedly reduce glucose levels together with the reduction of fasted insulin levels following administration of a single dose of the PEG-OXM compounds (see Example 7, herein).
- the present invention provides a method for increasing insulin sensitivity in a subject, comprising the step of administering to the subject an effective amount of a composition comprising a dual GLP- 1/Glucagon receptor agonist conjugated to polyethylene glycol polymer (PEG polymer).
- the present invention unexpectedly shows a marked increase in insulin sensitivity following acute treatment in a subject with the dual GLP-1 /Glucagon receptor agonist composition provided herein (see Example 7).
- the agonist is conjugated to said polyethylene glycol polymer (PEG polymer) via a linker.
- the agonist is OXM.
- the linker is a flexible linker.
- the linker is 9-fluorenylmethoxycarbonyl (Fmoc) or 2-sulfo-9- fluorenylmethoxycarbonyl (FMS).
- the linker is a non-cleavable linker.
- the linker is N-(s-Maleimidocaproyloxu) succinimide ester (EMCS).
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention comprises inhibiting pancreatic secretion through a vagal neural indirect mechanism.
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention comprises reducing hydromineral transport through the small intestine.
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention comprises stimulating glucose uptake.
- the biological activity of a long-acting dual GLP- 1 /Glucagon receptor agonist of the invention comprises controlling/stimulating somatostatin secretion.
- the biological activity of a long-acting dual GLP- 1/Glucagon receptor agonist of the invention comprises reduction in both food intake and body weight gain. In another embodiment, the biological activity of a long-acting dual GLP- 1/Glucagon receptor agonist of the invention comprises reduction in adiposity. In another embodiment, the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention comprises appetite suppression. In another embodiment, the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention comprises induction of anorexia. In another embodiment, the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention comprises reducing body weight in overweight and obese subjects.
- the biological activity of a long- acting dual GLP-1 /Glucagon receptor agonist of the invention comprises inducing changes in the levels of the adipose hormones leptin and adiponectin.
- the biological activity of a long-acting dual GLP-l/Glucagon receptor agonist of the invention comprises increasing energy expenditure in addition to decreasing energy intake in overweight and obese subjects.
- the biological activity of a long- acting dual GLP-1 /Glucagon receptor agonist of the invention comprises decreasing plasma triglycerides and increased ketone bodies.
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention, following acute treatment comprises decreasing plasma triglycerides and increased ketone bodies.
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention, following acute P-74757-PC treatment comprises increasing expression of the gluconeogenic genes Pckl, Pgclcc, and Pdhal.
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention, following acute treatment comprises decreasing liver pools of acetyl-CoA, the main product of pyruvate decarboxylation, and malonyl-CoA.
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention following acute treatment comprises upregulating genes that induce fatty acid oxidation (FAO) in the liver, including Fg/21 and Cptla.
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention following acute treatment comprises downregulating lipogenic genes such as ChREBP.
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention, following acute treatment comprises upregulating Ldlr gene.
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention, following chronic treatment comprises decreasing leptin levels.
- the biological activity of a long-acting dual GLP-1 /Glucagon receptor agonist of the invention, following chronic treatment comprises increasing b- hydroxybutyrate levels.
- a PEG polymer is attached to the amino terminus or lysine residue of oxyntomodulin via Fmoc or FMS.
- the terms "attached” and “linked” are use interchangeably.
- the PEG polymer is linked to the a-amino side chain of OXM.
- the PEG polymer is linked to the ⁇ - amino side chain of OXM.
- the PEG polymer is linked to one or more ⁇ -amino side chain of OXM.
- the PEG polymer comprises a sulfhydryl moiety.
- PEG is linear. In another embodiment, PEG is branched. In another embodiment, PEG has a molecular weight in the range of 200 to 200,000 Da. In another embodiment, PEG has a molecular weight in the range of 5,000 to 80,000 Da. In another embodiment, PEG has a molecular weight in the range of 5,000 to 40,000 Da. In another embodiment, PEG has a molecular weight in the range of 20,000 Da to 40,000 Da.
- the PEGylating agent is usually used in its mono- methoxylated form where only one hydroxyl group at one terminus of the PEG molecule is P-74757-PC available for conjugation.
- a bifunctional form of PEG where both termini are available for conjugation may be used if, for example, it is desired to obtain a conjugate with two peptide or protein residues covalently attached to a single PEG moiety.
- branched PEGs are represented as R(PEG-OH) m in which R represents a central core moiety such as pentaerythritol or glycerol, and m represents the number of branching arms.
- the number of branching arms (m) can range from three to a hundred or more.
- the hydroxyl groups are subject to chemical modification.
- branched PEG molecules are described in U.S. Pat. No. 6,113,906, No. 5,919,455, No. 5,643,575, and No. 5,681,567, which are hereby incorporated by reference in their entirety.
- the GLP-1 /Glucagon receptor agonist is oxyntomodulin. In another embodiment, the GLP-1 /Glucagon receptor agonist is an oxyntomodulin variant.
- the present invention provides OXM with a PEG moiety which is not attached directly to the OXM, as in the standard pegylation procedure, but rather the PEG moiety is attached through a linker such as Fmoc or FMS.
- the linker is highly sensitive to bases and is removable under mild basic conditions.
- OXM connected to PEG via Fmoc or FMS is equivalently active to the free OXM.
- OXM connected to PEG via Fmoc or FMS is more active than the free OXM.
- OXM connected to PEG via Fmoc or FMS comprises different activity than the free OXM.
- OXM connected to PEG via Fmoc or FMS unlike the free OXM has central nervous system activity.
- reversible Pegylated OXM crosses the blood-brain barrier and acts on the hypothalamus to exert the biological activities provided herein.
- OXM connected to PEG via Fmoc or FMS unlike the free OXM can not enter the brain through the blood brain barrier.
- OXM connected to PEG via Fmoc or FMS comprises extended circulation half-life compared to the free OXM.
- OXM connected to PEG via Fmoc or FMS loses its PEG moiety together with the Fmoc or FMS moiety thus recovering the free OXM.
- the present invention provides a compound of the formula: (X)n— Y, wherein Y is a moiety of OXM bearing a free amino, carboxyl, or hydroxyl and X is a radical of formula (i): P-74757-PC
- Rj is a radical containing a protein or polymer carrier moiety; polyethylene glycol (PEG) moiety; R 2 is selected from the group consisting of hydrogen, alkyl, alkoxy, alkoxyalkyl, aryl, alkaryl, aralkyl, halogen, nitro, --SO3H, — SO 2 NHR, amino, ammonium, carboxyl, P0 3 H 2 , and OP0 3 H 2 ; R is selected from the group consisting of hydrogen, alkyl and aryl; R 3 and R 4 , the same or different, are each selected from the group consisting of hydrogen, alkyl and aryl; A is a covalent bond when the radical is linked to an amino or hydroxyl group of the OXM-Y; n is an integer of at least one, and pharmaceutically acceptable salts thereof.
- PEG polyethylene glycol
- alkyl alkoxy
- alkoxyalkyl aryl
- alkaryl alkaryl
- aralkyl alkyl radicals of 1-8, preferably 1-4 carbon atoms, e.g. methyl, ethyl, propyl, isopropyl and butyl, and aryl radicals of 6-10 carbon atoms, e.g. phenyl and naphthyl.
- halogen includes bromo, fluoro, chloro and iodo.
- R 2 , R 3 and R4 are each hydrogen and A is --OCO--, namely the 9-fluorenylmethoxycarbonyl radical (hereinafter "Fmoc").
- R is— S0 3 H at position 2 of the fluorene ring
- R 3 and R4 are each hydrogen
- A is --OCO-, namely the 2-sulfo-9-fluorenylmethoxycarbonyl radical (hereinafter "FMS").
- pegylation of OXM and preparation of the (PEG-Fmoc)n- OXM or (PEG-FMS)n- OXM conjugates includes attaching MAL-FMS-NHS or MAL- Fmoc-NHS to the amine component of OXM, thus obtaining a MAL-FMS- OXM or MAL- Fmoc- OXM conjugate, and then substituting PEG-SH for the maleimide moiety, producing the (PEG-FMS)n- OXM or (PEG-Fmoc)n- OXM conjugate, respectively.
- pegylation of OXM includes reacting MAL-FMS-NHS or MAL-Fmoc-NHS with PEG-SH, thus forming a PEG-FMS-NHS or PEG-Fmoc-NHS conjugate, and then reacting it with the amine component of OXM resulting in the desired (PEG-FMS)n- OXM or (PEG-Fmoc)n- OXM conjugate, respectively.
- pegylation of peptides/proteins such as OXM are described in United States Patent No. 7585837, which is incorporated herein by reference in its entirety.
- reverse-pegylation of peptides/proteins such as OXM with Fmoc or FMS are described in United States Patent No. 7585837.
- reverse pegylated OXM is composed of PEG-FMS-OXM and PEG-Fmoc-OXM herein identified by the formulas: (PEG-FMS)n-OXM or (PEG-Fmoc)n-OXM, wherein n is an integer of at least one, and OXM is linked to the FMS or Fmoc radical through at least one amino group.
- the long acting OXM described herein is both active in its pegylated form and in its peripheral form.
- the construction of (PEG-FMS)n-OXM or (PEG-Fmoc)n-OXM does not render this conjugate inactive.
- the construction of (PEG-FMS-OXM or (PEG-Fmoc)n-OXM does not render the OXM inactive.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for the prevention of hyperglycemia, for improving glycemic control, for treatment of diabetes mellitus selected from the group consisting of non-insulin dependent diabetes mellitus (in one embodiment, Type 2 diabetes), insulin-dependent diabetes mellitus (in one embodiment, Type 1 diabetes), and gestational diabetes mellitus, or any combination thereof.
- PEG-Fmoc-OXM and PEG-FMS-OXM and phannaceutical compositions comprising them are utilized for treating Type 2 Diabetes.
- PEG-Fmoc-OXM and PEG-FMS-OXM and phannaceutical compositions comprising them are utilized for increasing sensitivity to insulin. In another embodiment, PEG-Fmoc-OXM and PEG-FMS-OXM and phannaceutical compositions comprising them are utilized for reducing insulin resistance.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for the suppression of appetite.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for inducing satiety.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for the reduction of body weight.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for the reduction of body fat.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for the reduction of body mass index.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for the reduction of food consumption.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for treating obesity.
- PEG-Fmoc-OXM and PEG-FMS- OXM and phannaceutical compositions comprising them are utilized for treating diabetes mellitus associated with obesity.
- PEG-Fmoc-OXM and PEG-FMS- OXM and phannaceutical compositions comprising them are utilized for increasing heart rate.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for increasing the basal metabolic rate (BMR).
- BMR basal metabolic rate
- PEG-Fmoc-oxyntomodulin and PEG-FMS-oxyntomodulin and pharmaceutical compositions comprising them are utilized for increasing energy expenditure.
- PEG-Fmoc-oxyntomodulin and PEG-FMS-oxyntomodulin and phannaceutical compositions comprising them are utilized for inducing glucose tolerance.
- PEG-Fmoc-oxyntomodulin and PEG-FMS-oxyntomodulin and pharmaceutical compositions comprising them are utilized for inducing glycemic control.
- glycemic control refers to non-high and/or non-fluctuating blood glucose levels and/or non-high and/or non-fluctuating glycosylated hemoglobin levels.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for inhibiting weight increase.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for reducing blood glucose levels ( Figures 4A and 9).
- PEG-Fmoc-OXM and PEG-FMS-OXM and phannaceutical compositions comprising them are utilized for decreasing caloric intake.
- PEG- Fmoc-OXM and PEG-FMS-OXM and phannaceutical compositions comprising them are utilized for decreasing appetite.
- PEG-Fmoc-OXM and PEG-FMS- OXM and pharmaceutical compositions comprising them are utilized for weight control. In another embodiment, PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for inducing or promoting weight loss. In another embodiment, PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for maintaining any one or more of a desired body weight, a desired Body Mass Index, a desired appearance and good health. In another embodiment, PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for controlling a lipid profile.
- PEG-Fmoc-OXM and PEG-FMS-OXM and phannaceutical compositions comprising them are utilized for reducing P-74757-PC triglyceride levels.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for reducing glycerol levels (Figure 9D).
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for reducing cholesterol levels.
- the reduction in cholesterol levels is greater than the reduction observed after administration of native OXM ( Figure 9C).
- PEG-Fmoc-OXM and PEG- FMS-OXM and pharmaceutical compositions comprising them lower cholesterol levels by 60-70%.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them lower cholesterol levels by 50-100%.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them lower cholesterol levels by 50-80%. In another embodiment, PEG-Fmoc-OXM and PEG- FMS-OXM and pharmaceutical compositions comprising them lower cholesterol levels by 40-90%. In another embodiment, PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are utilized for increasing FfDL cholesterol levels.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them may be used for the purposes described herein without a significant decrease in effectiveness over the course of administration ( Figures 5A, 6A, and 7).
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them remains effective for 1 day.
- PEG- Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them remains effective for 2-6 days.
- PEG-Fmoc-OXM and PEG-FMS- OXM and pharmaceutical compositions comprising them remains effective for 1 week.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them remains effective for 2 weeks. In another embodiment, PEG- Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them remains effective for 3 weeks. In another embodiment, PEG-Fmoc-OXM and PEG-FMS- OXM and pharmaceutical compositions comprising them remains effective for 4 weeks. In another embodiment, PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them remains effective for 6 weeks.
- PEG- Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them P-74757-PC remains effective for 2 months.
- PEG-Fmoc-OXM and PEG-FMS- OXM and pharmaceutical compositions comprising them remains effective for 4 months.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them remains effective for 6 months.
- PEG- Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them remains effective for 1 year or more.
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them may be used for the purposes described herein and may be effective immediately upon administration of the first dose ( Figure 8A).
- PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them are effective after two or more doses have been administered.
- methods of utilizing PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them as described hereinabove are applied to a human subject afflicted with a disease or condition that can be alleviated, inhibited, and/or treated by OXM.
- methods of utilizing PEG-Fmoc-OXM and PEG- FMS-OXM and pharmaceutical compositions comprising them as described hereinabove are veterinary methods.
- methods of utilizing PEG-Fmoc-OXM and PEG-FMS-OXM and pharmaceutical compositions comprising them as described hereinabove are applied to animals such as farm animals, pets, and lab animals.
- a subject of the present invention is feline, canine, bovine, porcine, murine, aquine, etc.
- the present invention provides a method of treating or reducing a disease treatable or reducible by OXM or a pharmaceutical formulation comprising the same, in a subject, comprising the step of administering to a subject a therapeutically effective amount of PEG-Fmoc-OXM amd/or PEG-FMS-OXM as described herein, thereby treating or reducing a disease treatable or reducible by OXM in a subject.
- OXM "peptide” or “protein” as used herein encompasses native peptides (either degradation products, synthetically synthesized proteins or recombinant proteins) and peptidomimetics (typically, synthetically synthesized proteins), as well as peptoids and semipeptoids which are protein analogs, which have, in some embodiments, modifications rendering the proteins even more stable while in a body or more capable of penetrating into cells.
- Methods for preparing peptidomimetic compounds are well known in the art and are specified, for example, in Quantitative Drug Design, C.A. Ramsden Gd., Chapter 17.2, F. Choplin Pergamon Press (1992), which is incorporated by reference as if fully set forth herein. Further details in this respect are provided hereinunder.
- peptide bonds (-CO-NH-) within the peptide are substituted.
- the peptide bonds are substituted by N-methylated bonds (-N(CH3)- CO-).
- the peptide bonds are substituted by ester bonds (-C(R)H-C- 0-0-C(R)-N-).
- the peptide bonds are substituted by ketomethylen bonds (-CO-CH2-).
- the peptide bonds are substituted by a-aza bonds (-NH-N(R)-CO-), wherein R is any alkyl, e.g., methyl, carba bonds (-CH2-NH-).
- natural aromatic amino acids of the protein such as Tip, Tyr and Phe
- synthetic non-natural acid such as Phenylglycine, TIC, naphthylelanine (Nol), ring-methylated derivatives of Phe, halogenated derivatives of Phe or o-methyl-Tyr.
- the peptides of the present invention include one or more modified amino acid or one or more non-amino acid monomers (e.g. fatty acid, complex carbohydrates etc).
- amino acid or “amino acids” is understood to include the 20 naturally occurring amino acids; those amino acids often modified post-translationally in vivo, including, for example, hydroxyproline, phosphoserine and phosphothreonine; and other unusual amino acid including, but not limited to, 2-aminoadipic acid, hydroxylysine, isodesmosine, nor-valine, nor-leucine and ornithine.
- amino acid includes both D- and L-amino acids.
- the OXM of the present invention are utilized in therapeutics which requires OXM to be in a soluble fonn.
- OXM of the present invention includes one or more non-natural or natural polar amino acid, including, but not limited to, serine and threonine which are capable of increasing protein solubility due to their hydroxyl-containing side chain.
- OXM of present invention is biochemically synthesized such as by using standard solid phase techniques.
- these biochemical methods include exclusive solid phase synthesis, partial solid phase synthesis, fragment condensation, or classical solution synthesis.
- solid phase OXM synthesis procedures are well known to one skilled in the art and further described by John Morrow Stewart and Janis Dillaha Young, Solid Phase Protein Syntheses (2nd Ed., Pierce Chemical Company, 1984).
- synthetic proteins are purified by preparative high performance liquid chromatography [Creighton T. (1983) Proteins, structures and molecular principles. WH Freeman and Co. N.Y.] and the composition of which can be confirmed via amino acid sequencing by methods known to one skilled in the art.
- recombinant protein techniques are used to generate the OXM of the present invention.
- recombinant protein techniques are used for the generation of large amounts of the OXM of the present invention.
- recombinant techniques are described by Bitter et al., (1987) Methods in Enzymol. 153:516-544, Studier et al. (1990) Methods in Enzymol. 185:60-89, Brisson et al. (1984) Nature 310:511-514, Takamatsu et al. (1987) EMBO J. 3:17-311, Coruzzi et al. (1984) EMBO J.
- OXM of the present invention is synthesized using a polynucleotide encoding OXM of the present invention.
- the polynucleotide encoding OXM of the present invention is ligated into an expression vector, comprising a transcriptional control of a cis-regulatory sequence (e.g., promoter sequence).
- a cis-regulatory sequence e.g., promoter sequence
- the cis-regulatory sequence is suitable for directing constitutive expression of the OXM of the present invention.
- a polynucleotide refers to a single or double stranded nucleic acid sequence which be isolated and provided in the form of an RNA P-74757-PC sequence, a complementary polynucleotide sequence (cDNA), a genomic polynucleotide sequence and/or a composite polynucleotide sequences (e.g., a combination of the above).
- complementary polynucleotide sequence refers to a sequence, which results from reverse transcription of messenger RNA using a reverse transcriptase or any other RNA dependent DNA polymerase.
- the sequence can be subsequently amplified in vivo or in vitro using a DNA polymerase.
- genomic polynucleotide sequence refers to a sequence derived (isolated) from a chromosome and thus it represents a contiguous portion of a chromosome.
- composite polynucleotide sequence refers to a sequence, which is at least partially complementary and at least partially genomic.
- a composite sequence can include some exonal sequences required to encode the peptide of the present invention, as well as some intronic sequences interposing there between.
- the intronic sequences can be of any source, including of other genes, and typically will include conserved splicing signal sequences.
- intronic sequences include cis acting expression regulatory elements.
- polynucleotides of the present invention are prepared using PCR techniques, or any other method or procedure known to one skilled in the art.
- the procedure involves the ligation of two different DNA sequences (See, for example, "Current Protocols in Molecular Biology", eds. Ausubel et al., John Wiley & Sons, 1992).
- prokaryotic or eukaryotic cells can be used as host- expression systems to express the OXM of the present invention.
- these include, but are not limited to, microorganisms, such as bacteria transformed with a recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vector containing the protein coding sequence; yeast transformed with recombinant yeast expression vectors containing the protein coding sequence; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors, such as Ti plasmid, containing the protein coding sequence.
- microorganisms such as bacteria transformed with a recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vector containing the protein coding sequence
- yeast transformed with recombinant yeast expression vectors containing the protein coding sequence e.g., cauliflower mosaic virus, CaMV; tobacco
- non-bacterial expression systems are used (e.g. mammalian expression systems such as CHO cells) to express the OXM of the present invention.
- the expression vector used to express polynucleotides of the present invention in mammalian cells is pCI-DHFR vector comprising a CMV promoter and a neomycin resistance gene.
- a number of expression vectors can be advantageously selected depending upon the use intended for the protein expressed.
- large quantities of OXM are desired.
- vectors that direct the expression of high levels of the protein product, possibly as a fusion with a hydrophobic signal sequence, which directs the expressed product into the periplasm of the bacteria or the culture medium where the protein product is readily purified are desired.
- vectors adaptable to such manipulation include, but are not limited to, the pET series of E. coli expression vectors [Studier et al, Methods in Enzymol. 185:60-89 (1990)].
- yeast expression systems are used.
- a number of vectors containing constitutive or inducible promoters can be used in yeast as disclosed in U.S. Pat. Application. No: 5,932,447.
- vectors which promote integration of foreign DNA sequences into the yeast chromosome are used.
- the expression vector of the present invention can further include additional polynucleotide sequences that allow, for example, the translation of several proteins from a single mRNA such as an internal ribosome entry site (IRES) and sequences for genomic integration of the promoter-chimeric protein.
- IRS internal ribosome entry site
- mammalian expression vectors include, but are not limited to, pcDNA3, pcDNA3.1(+/-), pGL3, pZeoSV2(+/-), pSecTag2, pDisplay, pEF/myc/cyto, pCMV/myc/cyto, pCR3.1, pSinRep5, DH26S, DHBB, pNMTl, pNMT41, pNMT81, which are available from Invitrogen, pCI which is available from Promega, pMbac, pPbac, pBK- RSV and pBK-CMV which are available from Strategene, pTRES which is available from Clontech, and their derivatives.
- expression vectors containing regulatory elements from eukaryotic viruses such as retroviruses are used by the present invention.
- SV40 vectors include pSVT7 and pMT2.
- vectors derived from bovine papilloma virus include pBV-lMTHA, and vectors derived from Epstein Bar virus include pHEBO, and p205.
- exemplary vectors include pMSG, pAV009/A + , pMTO10/A + , pMAMneo-5, baculovirus pDSVE, and any other vector allowing expression of proteins under the direction of the SV-40 early promoter, SV-40 later promoter, metallothionein promoter, murine mammary tumor virus promoter, Rous sarcoma virus promoter, polyhedrin promoter, or other promoters shown effective for expression in eukaryotic cells.
- plant expression vectors are used.
- the expression of the dual GLP-l/Glucagon receptor agonist coding sequence is driven by a number of promoters.
- viral promoters such as the 35S RNA and 19S RNA promoters of CaMV [Brisson et al, Nature 310:511-514 (1984)], or the coat protein promoter to TMV [Takamatsu et al, EMBO J. 3:17-311 (1987)] are used.
- plant promoters are used such as, for example, the small subunit of RUBISCO [Coruzzi et al, EMBO J.
- constructs are introduced into plant cells using Ti plasmid, Ri plasmid, plant viral vectors, direct DNA transformation, microinjection, electroporation and other techniques well known to the skilled artisan. See, for example, Weissbach & Weissbach [Methods for Plant Molecular Biology, Academic Press, NY, Section VIII, pp 421-463 (1988)].
- Other expression systems such as insects and mammalian host cell systems, which are well known in the art, can also be used by the present invention.
- the expression construct of the present invention can also include sequences engineered to optimize stability, production, purification, yield or activity of the expressed protein.
- Various methods can be used to introduce the expression vector of the present invention into the host cell system.
- such methods are generally described in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Springs Harbor Laboratory, New York (1989, 1992), in Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1989), Chang et al, Somatic Gene Therapy, CRC Press, Ann Arbor, Mich. (1995), Vega et al., Gene Targeting, CRC Press, Ann Arbor Mich. (1995), Vectors: A Survey of Molecular Cloning Vectors and Their Uses, Butterworths, Boston Mass. (1988) and Gilboa et at.
- transformed cells are cultured under effective conditions, which allow for the expression of high amounts of recombinant OXM.
- effective culture conditions include, but are not limited to, effective media, bioreactor, temperature, pH and oxygen conditions that permit protein production.
- P-74757-PC an effective medium refers to any medium in which a cell is cultured to produce the recombinant OXM of the present invention.
- a medium typically includes an aqueous solution having assimilable carbon, nitrogen and phosphate sources, and appropriate salts, minerals, metals and other nutrients, such as vitamins.
- cells of the present invention can be cultured in conventional fermentation bioreactors, shake flasks, test tubes, microtiter dishes and petri plates.
- culturing is carried out at a temperature, pH and oxygen content appropriate for a recombinant cell.
- culturing conditions are within the expertise of one of ordinary skill in the art.
- resultant OXM of the present invention either remain within the recombinant cell, secreted into the fennentation medium, secreted into a space between two cellular membranes, such as the periplasmic space in E. coli; or retained on the outer surface of a cell or viral membrane.
- the phrase "recovering the recombinant OXM" used herein refers to collecting the whole fermentation medium containing the OXM and need not imply additional steps of separation or purification.
- OXM of the present invention is purified using a variety of standard protein purification techniques, such as, but not limited to, affinity chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reverse phase chromatography, concanavalin A chromatography, chromatofocusing and differential solubilization.
- standard protein purification techniques such as, but not limited to, affinity chromatography, ion exchange chromatography, filtration, electrophoresis, hydrophobic interaction chromatography, gel filtration chromatography, reverse phase chromatography, concanavalin A chromatography, chromatofocusing and differential solubilization.
- the expressed coding sequence can be engineered to encode the protein of the present invention and fused cleavable moiety.
- a fusion protein can be designed so that the protein can be readily isolated by affinity chromatography; e.g., by immobilization on a column specific for the cleavable moiety.
- a cleavage site is engineered between the protein and the cleavable moiety and the protein can be released from the chromatographic column by treatment with an appropriate enzyme or agent that specifically cleaves the fusion protein at this site [e.g., see Booth et al., Immunol. Lett. 19:65-70 (1988); and Gardella et ah, J.
- the OXM of the present invention is retrieved in “substantially pure” form.
- the phrase “substantially P-74757-PC pure” refers to a purity that allows for the effective use of the OXM in the applications described herein.
- the dual GLP-1 /Glucagon receptor agonist of the present invention can also be synthesized using in vitro expression systems.
- in vitro synthesis methods are well known in the art and the components of the system are commercially available.
- in vitro binding activity is ascertained by measuring the ability of native, recombinant and/or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein as well as pharmaceutical compositions comprising the same to treat or ameliorate diseases or conditions such as but not limited to: diabetes mellitus, obesity, eating disorders, metabolic disorders, etc.
- in vivo activity is deduced by known measures of the disease that is being treated.
- a dose of reverse pegylated OXM of the present invention comprises from 0.005 to 0.1 milligrams/kg OXM peptide. In another embodiment, a dose of reverse pegylated OXM of the present invention comprises from 0.005 to 0.5 milligrams/kg OXM peptide. In another embodiment, a dose of reverse pegylated OXM of the present invention comprises from 0.05 to 0.1 micrograms OXM peptide. In another embodiment, a dose of reverse pegylated OXM of the present invention comprises from 0.005 to 0.1 milligrams/kg OXM peptide in an injectable solution.
- a dose of reverse pegylated OXM is administered once a day. In another embodiment, a dose of reverse pegylated OXM is administered once every 36 hours. In another embodiment, a dose of reverse pegylated OXM is administered once every 48 hours. In another embodiment, a dose of reverse pegylated OXM is administered once every 60 hours. In another embodiment, a dose of reverse pegylated OXM is administered once every 72 hours. In another embodiment, a dose of reverse pegylated OXM is administered once every 84 hours. In another embodiment, a dose of reverse pegylated OXM is administered once every 96 hours.
- a dose of reverse pegylated OXM is administered once every 5 days. In another embodiment, a dose of reverse pegylated OXM is administered once every 6 days. In another embodiment, a dose of reverse pegylated OXM is administered once every 7 days. In another embodiment, a dose of reverse pegylated OXM is administered once every 8-10 days. In another embodiment, a dose of reverse pegylated OXM is administered once every 10-12 days. In another embodiment, a dose of reverse pegylated OXM is administered once every 12-15 days. In another embodiment, a dose of reverse pegylated OXM is administered once every 15-25 days. P-74757-PC
- reverse pegylated OXM of the present invention is administered by an intramuscular (IM) injection, subcutaneous (SC) injection, or intravenous (IV) injection once a week.
- IM intramuscular
- SC subcutaneous
- IV intravenous
- the reverse pegylated OXM of the present invention can be provided to the individual per se. In one embodiment, the reverse pegylated OXM of the present invention can be provided to the individual as part of a pharmaceutical composition where it is mixed with a pharmaceutically acceptable carrier.
- a "pharmaceutical composition” refers to a preparation of long-acting OXM as described herein with other chemical components such as physiologically suitable carriers and excipients.
- the purpose of a pharmaceutical composition is to facilitate administration of a compound to an organism.
- a reverse pegylated OXM is accountable for the biological effect.
- any of the compositions of this invention will comprise at least a reverse pegylated OXM.
- the present invention provides combined preparations.
- "a combined preparation” defines especially a "kit of parts" in the sense that the combination partners as defined above can be dosed independently or by use of different fixed combinations with distinguished amounts of the combination partners i.e., simultaneously, concurrently, separately or sequentially.
- the parts of the kit of parts can then, e.g., be administered simultaneously or chronologically staggered, that is at different time points and with equal or different time intervals for any part of the kit of parts.
- the ratio of the total amounts of the combination partners in some embodiments, can be administered in the combined preparation.
- the combined preparation can be varied, e.g., in order to cope with the needs of a patient subpopulation to be treated or the needs of the single patient which different needs can be due to a particular disease, severity of a disease, age, sex, or body weight as can be readily made by a person skilled in the art.
- physiologically acceptable carrier and “pharmaceutically acceptable carrier” which be interchangeably used refer to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered compound.
- An adjuvant is included under these phrases.
- one of the ingredients included in the pharmaceutically acceptable carrier can be for example polyethylene glycol (PEG), a biocompatible polymer with a wide range of solubility in both organic and aqueous media (Mutter et al. (1979). P-74757-PC
- excipient refers to an inert substance added to a pharmaceutical composition to further facilitate administration of a long-acting OXN.
- excipients include calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils and polyethylene glycols.
- suitable routes of administration of the peptide of the present invention include oral, rectal, transmucosal, transnasal, intestinal or parenteral delivery, including intramuscular, subcutaneous and intramedullary injections as well as intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, or intraocular injections.
- the present invention also includes reverse pegylated OXM for use in the manufacture of a medicament for administration by a route peripheral to the brain for any of the methods of treatment described above.
- peripheral routes include oral, rectal, parenteral e.g. intravenous, intramuscular, or intraperitoneal, mucosal e.g. buccal, sublingual, nasal, subcutaneous or transdermal administration, including administration by inhalation.
- Preferred dose amounts of OXM for the medicaments are given below.
- the present invention provides a pharmaceutical composition
- a pharmaceutical composition comprising reverse pegylated OXM and a pharmaceutically suitable carrier, in a form suitable for oral, rectal, parenteral, e.g. intravenous, intramuscular, or intraperitoneal, mucosal e.g. buccal, sublingual, nasal, subcutaneous or transdermal administration, including administration by inhalation.
- parenteral e.g. intravenous, intramuscular, or intraperitoneal
- mucosal e.g. buccal, sublingual, nasal, subcutaneous or transdermal administration, including administration by inhalation.
- the dose per unit may be, for example, as described below or as calculated on the basis of the per kg doses given below.
- the preparation is administered in a local rather than systemic manner, for example, via injection of the preparation directly into a specific region of a patient's body.
- a reverse pegylated OXM is formulated in an intranasal dosage form.
- a reverse pegylated OXM is formulated in an injectable dosage form.
- the OXM peptide component within of the reverse pegylated OXM composition is administered in a range of 0.01-0.5 milligrams/kg body weight per 3 days (only the weight of the OXM within the reverse pegylated OXM composition is provided as the size of PEG can differ substantially).
- the OXM peptide component within of the reverse pegylated OXM P-74757-PC composition is administered in a range of 0.01-0.5 milligrams/kg body weight per 7 days.
- the OXM peptide component within of the reverse pegylated OXM composition is administered in a range of 0.01-0.5 milligrams/kg body weight per 10 days. In another embodiment, the OXM peptide component within of the reverse pegylated OXM composition is administered in a range of 0.01-0.5 milligrams/kg body weight per 14 days. In another embodiment, unexpectedly, the effective amount of OXM in a reverse pegylated OXM composition is 1/4-1/10 of the effective amount of free OXM. In another embodiment, unexpectedly, reverse pegylation of OXM enables limiting the amount of OXM prescribed to a patient by at least 50% compared with free OXM.
- reverse pegylation of OXM enables limiting the amount of OXM prescribed to a patient by at least 70% compared with free OXM. In another embodiment, unexpectedly, reverse pegylation of OXM enables limiting the amount of OXM prescribed to a patient by at least 75% compared with free OXM. In another embodiment, unexpectedly, reverse pegylation of OXM enables limiting the amount of OXM prescribed to a patient by at least 80% compared with free OXM. In another embodiment, unexpectedly, reverse pegylation of OXM enables limiting the amount of OXM prescribed to a patient by at least 85% compared with free OXM. In another embodiment, unexpectedly, reverse pegylation of OXM enables limiting the amount of OXM prescribed to a patient by at least 90% compared with free OXM.
- the OXM peptide component within of the reverse pegylated OXM composition is administered in a range of 0.01-0.5 milligrams/kg body weight once every 3 days (only the weight of the OXM within the reverse pegylated OXM composition is provided as the size of PEG can differ substantially).
- the OXM peptide component within of the reverse pegylated OXM composition is administered in a range of 0.01- 0.5 milligrams/kg body weight once every 7 days.
- the OXM peptide component within of the reverse pegylated OXM composition is administered in a range of 0.01- 0.5 milligrams/kg body weight once every 10 days.
- the OXM peptide component within of the reverse pegylated OXM composition is administered in a range of 0.01- 0.5 milligrams/kg body weight once every 14 days.
- reverse pegylated OXM compared to free OXM both reduces the effective dosing frequency by at least 2-fold and reduces the effective weekly dose by at least
- reverse pegylated OXM compared to free OXM both reduces the effective dosing frequency by at least 3 -fold and reduces the effective weekly dose by at least
- reverse pegylated OXM compared to free OXM both reduces the effective dosing frequency by at least 4-fold and reduces the effective weelcly dose by at least
- reverse pegylated OXM compared to free OXM both reduces the effective dosing frequency by at least 5-fold and reduces the effective weekly dose by at least
- reverse pegylated OXM compared to free OXM both reduces the effective dosing frequency by at least 6-fold and reduces the effective weekly dose by at least
- effective dosing frequency and effective weekly dose are based on: (1) the weight of administered OXM component within the reverse pegylated OXM composition; and (2) the weight of administered OXM component within the free OXM (unmodified OXM) composition.
- the methods of the invention include increasing the compliance of patients afflicted with chronic illnesses that are in need of OXM therapy.
- the methods of the invention enable reduction in the dosing frequency of OXM by reverse pegylating OXM as described hereinabove.
- the term compliance comprises adherence.
- the methods of the invention include increasing the compliance of patients in need of OXM therapy by reducing the frequency of administration of OXM.
- reduction in the frequency of administration of the OXM is achieved thanks to reverse pegylation which render the OXM more stable and more potent.
- reduction in the frequency of administration of the OXM is achieved as a result of increasing Tl/2 of the OXM.
- reduction in the frequency of administration of the OXM is achieved as a result of reducing blood clearance of OXM. In another embodiment, reduction in the frequency of administration of the OXM is achieved as a result of increasing Tl/2 of the OXM. In another embodiment, reduction in the frequency of administration of the OXM is achieved as a result of increasing the AUC measure of the OXM.
- a reverse pegylated OXM is administered to a subject once a day. In another embodiment, a reverse pegylated OXM is administered to a subject once every two days. In another embodiment, a reverse pegylated OXM is administered to a subject once every three days. In another embodiment, a reverse pegylated OXM is administered to a subject once every four days. In another embodiment, a reverse pegylated OXM is administered to a subject once every five days. In another embodiment, a reverse P-74757-PC pegylated OXM is administered to a subject once every six days. In another embodiment, a reverse pegylated OXM is administered to a subject once every week.
- a reverse pegylated OXM is administered to a subject once every 7-14 days. In another embodiment, a reverse pegylated OXM is administered to a subject once every 10-20 days. In another embodiment, a reverse pegylated OXM is administered to a subject once every 5-15 days. In another embodiment, a reverse pegylated OXM is administered to a subject once every 15-30 days.
- a pegylated OXM is administered to a subject once a day. In another embodiment, a pegylated OXM is administered to a subject once every two days. In another embodiment, a pegylated OXM is administered to a subject once every three days. In another embodiment, a pegylated OXM is administered to a subject once every four days. In another embodiment, a pegylated OXM is administered to a subject once every five days. In another embodiment, a pegylated OXM is administered to a subject once every six days. In another embodiment, a pegylated OXM is administered to a subject once every week.
- a pegylated OXM is administered to a subject once every 7-14 days. In another embodiment, a pegylated OXM is administered to a subject once every 10-20 days. In another embodiment, a pegylated OXM is administered to a subject once every 5-15 days. In another embodiment, a pegylated OXM is administered to a subject once every 15-30 days.
- pegylated OXM variants provided herein unexpectedly reduce glucose together with reduction of fasted insulin levels following administration of a single dose of the PEG-OXM variant.
- the pegylated OXM variants provided herein lead to increasing the sensitivity of a subject to insulin (see Example 6).
- Oral administration in one embodiment, comprises a unit dosage fonn comprising tablets, capsules, lozenges, chewable tablets, suspensions, emulsions and the like.
- unit dosage forms comprise a safe and effective amount of OXM of the invention, each of which is in one embodiment, from about 0.7 or 3.5 mg to about 280 mg/70 kg, or in another embodiment, about 0.5 or 10 mg to about 210 mg/70 kg.
- the pharmaceutically-acceptable carriers suitable for the preparation of unit dosage forms for peroral administration are well-known in the art.
- tablets typically comprise conventional pharmaceutically-compatible adjuvants as inert diluents, such as calcium carbonate, sodium carbonate, mannitol, lactose and cellulose; binders such as starch, gelatin and sucrose; disintegrants such as starch, alginic acid and croscarmelose; lubricants such as magnesium stearate, stearic acid and talc.
- glidants such as silicon dioxide can be used to improve flow characteristics of the P-74757-PC powder-mixture.
- coloring agents such as the FD&C dyes, can be added for appearance.
- Sweeteners and flavoring agents such as aspartame, saccharin, menthol, peppermint, and fruit flavors, are useful adjuvants for chewable tablets.
- Capsules typically comprise one or more solid diluents disclosed above.
- the selection of carrier components depends on secondary considerations like taste, cost, and shelf stability, which are not critical for the purposes of this invention, and can be readily made by a person skilled in the art.
- the oral dosage form comprises predefined release profile.
- the oral dosage form of the present invention comprises an extended release tablets, capsules, lozenges or chewable tablets.
- the oral dosage form of the present invention comprises a slow release tablets, capsules, lozenges or chewable tablets.
- the oral dosage form of the present invention comprises an immediate release tablets, capsules, lozenges or chewable tablets.
- the oral dosage form is formulated according to the desired release profile of the long-acting OXM as known to one skilled in the art.
- compositions for use in the methods of this invention comprise solutions or emulsions, which in another embodiment are aqueous solutions or emulsions comprising a safe and effective amount of the compounds of the present invention and optionally, other compounds, intended for topical intranasal administration.
- the compositions comprise from about 0.001% to about 10.0% w/v of a subject compound, more preferably from about 00.1% to about 2.0, which is used for systemic delivery of the compounds by the intranasal route.
- the pharmaceutical compositions are administered by intravenous, intra-arterial, subcutaneous or intramuscular injection of a liquid preparation.
- liquid formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
- the pharmaceutical compositions are administered intravenously, and are thus formulated in a form suitable for intravenous administration.
- the pharmaceutical compositions are administered intra-arterially, and are thus formulated in a form suitable for intra-arterial administration.
- the pharmaceutical compositions are administered intramuscularly, and are thus formulated in a form suitable for intramuscular administration.
- the pharmaceutical compositions are administered topically to body surfaces, and are thus formulated in a form suitable for topical administration.
- Suitable topical formulations include gels, ointments, creams, lotions, drops and the like.
- the compounds of the present invention are combined with an additional appropriate therapeutic agent or agents, prepared and applied as solutions, suspensions, or emulsions in a physiologically acceptable diluent with or without a pharmaceutical carrier.
- compositions of the present invention are manufactured by processes well known in the art, e.g., by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes.
- compositions for use in accordance with the present invention is formulated in conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of OXM into preparations which, can be used pharmaceutically.
- formulation is dependent upon the route of administration chosen.
- injectables, of the invention are formulated in aqueous solutions.
- injectables, of the invention are formulated in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer.
- physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer.
- penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
- the preparations described herein are formulated for parenteral admmistration, e.g., by bolus injection or continuous infusion.
- formulations for injection are presented in unit dosage form, e.g., in ampoules or in multidose containers with optionally, an added preservative.
- compositions are suspensions, solutions or emulsions in oily or aqueous vehicles, and contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- compositions also comprise, in another embodiment, preservatives, such as benzalkomum chloride and thimerosal and the like; chelating agents, such as edetate sodium and others; buffers such as phosphate, citrate and acetate; tonicity agents such as sodium chloride, potassium chloride, glycerin, mannitol and others; antioxidants such as ascorbic acid, acetylcystine, sodium metabisulfote and others; aromatic agents; viscosity adjusters, such as polymers, including cellulose and derivatives thereof; and polyvinyl alcohol and acid and bases to adjust the pH of these aqueous compositions as needed.
- the compositions also comprise, in some embodiments, local anesthetics or other actives.
- the compositions can be used as sprays, mists, drops, and the like.
- compositions for parenteral administration include aqueous solutions of the active preparation in water-soluble form.
- P-74757-PC suspensions of long acting OXM are prepared as appropriate oily or water based injection suspensions.
- Suitable lipophilic solvents or vehicles include, in some embodiments, fatty oils such as sesame oil, or synthetic fatty acid esters such as ethyl oleate, triglycerides or liposomes.
- Aqueous injection suspensions contain, in some embodiments, substances, which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol or dextran.
- the suspension also contain suitable stabilizers or agents which increase the solubility of long acting OXM to allow for the preparation of highly concentrated solutions.
- the active compound can be delivered in a vesicle, in particular a liposome (see Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez- Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
- a liposome see Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez- Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
- the pharmaceutical composition delivered in a controlled release system is formulated for intravenous infusion, implantable osmotic pump, transdermal patch, liposomes, or other modes of administration.
- a pump is used (see Langer, supra; Sefton, CRC Crit. Ref. Biomed. Eng. 14:201 (1987); Buchwald et al., Surgery 88:507 (1980); Saudek et al, N. Engl. J. Med 321:574 (1989).
- polymeric materials can be used.
- a controlled release system can be placed in proximity to the therapeutic target, i.e., the brain, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984). Other controlled release systems are discussed in the review by Langer ⁇ Science 249:1527-1533 (1990).
- long acting OXM is in powder form for constitution with a suitable vehicle, e.g., sterile, pyrogen-free water based solution, before use.
- a suitable vehicle e.g., sterile, pyrogen-free water based solution
- Compositions are formulated, in some embodiments, for atomization and inhalation administration. In another embodiment, compositions are contained in a container with attached atomizing means.
- the preparation of the present invention is formulated in rectal compositions such as suppositories or retention enemas, using, e.g., conventional suppository bases such as cocoa butter or other glycerides.
- compositions suitable for use in context of the present invention include compositions wherein long acting OXM is contained in an amount effective to achieve the intended purpose.
- a therapeutically effective amount means an amount of long acting OXM effective to prevent, alleviate or ameliorate symptoms of disease or prolong the survival of the subject being treated.
- determination of a therapeutically effective amount is well within the capability of those skilled in the art.
- compositions also comprise preservatives, such as benzalkonium chloride and thimerosal and the like; chelating agents, such as edetate sodium and others; buffers such as phosphate, citrate and acetate; tonicity agents such as sodium chloride, potassium chloride, glycerin, mannitol and others; antioxidants such as ascorbic acid, acetylcystine, sodium metabisulfote and others; aromatic agents; viscosity adjustors, such as polymers, including cellulose and derivatives thereof; and polyvinyl alcohol and acid and bases to adjust the pH of these aqueous compositions as needed.
- the compositions also comprise local anesthetics or other actives.
- the compositions can be used as sprays, mists, drops, and the like.
- substances which can serve as pharmaceutically-acceptable carriers or components thereof are sugars, such as lactose, glucose and sucrose; starches, such as com starch and potato starch; cellulose and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose, and methyl cellulose; powdered tragacanth; malt; gelatin; talc; solid lubricants, such as stearic acid and magnesium stearate; calcium sulfate; vegetable oils, such as peanut oil, cottonseed oil, sesame oil, olive oil, corn oil and oil of theobroma; polyols such as propylene glycol, glycerine, sorbitol, mannitol, and polyethylene glycol; alginic acid; emulsifiers, such as the TweenTM brand emulsifiers; wetting agents, such sodium lauryl sulfate; coloring agents; flavoring agents; tableting agents, stabilizers; antioxidants
- sugars such as
- a pharmaceutically-acceptable carrier to be used in conjunction with the compound is basically determined by the way the compound is to be administered. If the subject compound is to be injected, in one embodiment, the pharmaceutically-acceptable carrier is sterile, physiological saline, with a blood-compatible suspending agent, the pH of which has been adjusted to about 7.4.
- compositions further comprise binders (e.g. acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone), disintegrating agents (e.g.
- binders e.g. acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone
- disintegrating agents e.g.
- cornstarch potato starch, alginic acid, silicon dioxide, croscarmelose sodium, crospovidone, guar gum, sodium starch glycolate), buffers (e.g., Tris- HCI., acetate, phosphate) of various pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid salts), protease inhibitors, surfactants (e.g.
- sodium lauryl sulfate permeation enhancers
- solubilizing agents e.g., glycerol, polyethylene glycerol
- anti-oxidants e.g., ascorbic acid, sodium metabisulfite, butylated hydroxyanisole
- stabilizers e.g. hydroxypropyl cellulose, hyroxypropylmethyl cellulose
- viscosity increasing agents e.g. carbomer, colloidal silicon P-74757-PC dioxide, ethyl cellulose, guar gum
- sweeteners e.g. aspartame, citric acid
- preservatives e.g., Thimerosal, benzyl alcohol, parabens
- lubricants e.g.
- stearic acid magnesium stearate, polyethylene glycol, sodium lauryl sulfate), flow-aids (e.g. colloidal silicon dioxide), plasticizers (e.g. diethyl phthalate, triethyl citrate), emulsifiers (e.g. carbomer, hydroxypropyl cellulose, sodium lauryl sulfate), polymer coatings (e.g., poloxamers or poloxamines), coating and film forming agents (e.g. ethyl cellulose, acrylates, polymethacrylates) and/or adjuvants.
- plasticizers e.g. diethyl phthalate, triethyl citrate
- emulsifiers e.g. carbomer, hydroxypropyl cellulose, sodium lauryl sulfate
- polymer coatings e.g., poloxamers or poloxamines
- coating and film forming agents e.g. ethyl cellulose
- Typical components of carriers for syrups, elixirs, emulsions and suspensions include ethanol, glycerol, propylene glycol, polyethylene glycol, liquid sucrose, sorbitol and water.
- typical suspending agents include methyl cellulose, sodium carboxymethyl cellulose, cellulose (e.g. AvicelTM, RC-591), tragacanth and sodium alginate;
- typical wetting agents include lecithin and polyethylene oxide sorbitan (e.g. polysorbate 80).
- Typical preservatives include methyl paraben and sodium benzoate.
- peroral liquid compositions also contain one or more components such as sweeteners, flavoring agents and colorants disclosed above.
- compositions also include incorporation of the active material into or onto particulate preparations of polymeric compounds such as polylactic acid, polglycolic acid, hydrogels, etc, or onto liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts, or spheroplasts.)
- polymeric compounds such as polylactic acid, polglycolic acid, hydrogels, etc, or onto liposomes, microemulsions, micelles, unilamellar or multilamellar vesicles, erythrocyte ghosts, or spheroplasts.
- particulate compositions coated with polymers e.g. poloxamers or poloxamines
- polymers e.g. poloxamers or poloxamines
- compounds modified by the covalent attachment of water-soluble polymers such as polyethylene glycol, copolymers of polyethylene glycol and polypropylene glycol, carboxymethyl cellulose, dextran, polyvinyl alcohol, polyvinylpyrrolidone or polyproline.
- the modified compounds exhibit substantially longer half- lives in blood following intravenous injection than do the corresponding unmodified compounds.
- modifications also increase the compound's solubility in aqueous solution, eliminate aggregation, enhance the physical and chemical stability of the compound, and greatly reduce the immunogenicity and reactivity of the compound.
- the desired in vivo biological activity is achieved by the administration of such polymer-compound abducts less frequently or in lower doses than with the unmodified compound.
- preparation of effective amount or dose can be estimated initially from in vitro assays.
- a dose can be formulated in animal models and such information can be used to more accurately determine useful doses in humans.
- toxicity and therapeutic efficacy of the long acting agonist can be determined by standard pharmaceutical procedures in vitro, in cell cultures or experimental animals.
- the data obtained from these in vitro and cell culture assays and animal studies can be used in formulating a range of dosage for use in human.
- the dosages vary depending upon the dosage form employed and the route of administration utilized.
- the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. [See e.g., Fingl, et al., (1975) "The Pharmacological Basis of Therapeutics", Ch. 1 p.l].
- dosing can be of a single or a plurality of administrations, with course of treatment lasting from several days to several weeks or until cure is effected or diminution of the disease state is achieved.
- the amount of a composition to be administered will, of course, be dependent on the subject being treated, the severity of the affliction, the manner of administration, the judgment of the prescribing physician, etc.
- compositions including the preparation of the present invention formulated in a compatible pharmaceutical carrier are also be prepared, placed in an appropriate container, and labeled for treatment of an indicated condition.
- a pegylated or reverse pegylated dual GLP-l/Glucagon receptor agonist as described herein is administered via systemic administration.
- a pegylated or reverse pegylated dual GLP-l/Glucagon receptor agonist as described herein is administered by intravenous, intramuscular or subcutaneous injection.
- a pegylated or reverse pegylated dual GLP-l/Glucagon receptor agonist as described herein is lyophilized (i.e., freeze-dried) preparation in combination with complex organic excipients and stabilizers such as nonionic surface active agents (i.e., surfactants), various sugars, organic polyols and/or human serum albumin.
- a pharmaceutical composition comprises a lyophilized pegylated or reverse pegylated dual GLP-l/Glucagon receptor agonist as described herein in sterile water for injection.
- a pharmaceutical composition comprises a lyophilized pegylated or reverse pegylated dual GLP-l/Glucagon receptor agonist as described herein in P-74757-PC sterile PBS for injection.
- a pharmaceutical composition comprises a lyophilized pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein in sterile 0.9% NaCl for injection.
- the pharmaceutical composition comprises a pegylated or reverse pegylated dual GLP-l/Glucagon receptor agonist as described herein and complex carriers such as human serum albumin, polyols, sugars, and anionic surface active stabilizing agents. See, for example, WO 89/10756 (Hara et al.- containing polyol and p- hydroxybenzoate).
- the pharmaceutical composition comprises a reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein and lactobionic acid and an acetate/glycine buffer.
- the pharmaceutical composition comprises a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein and amino acids, such as arginine or glutamate that increase the solubility of interferon compositions in water.
- the pharmaceutical composition comprises a lyophilized pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein and glycine or human serum albumin (HSA), a buffer (e g. acetate) and an isotonic agent (e.g NaCl).
- the pharmaceutical composition comprises a lyophilized pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein and phosphate buffer, glycine and HSA.
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein is stabilized when placed in buffered solutions having a pH between about 4 and 7.2.
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein is stabilized with an amino acid as a stabilizing agent and in some cases a salt (if the amino acid does not contain a charged side chain).
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein is a liquid composition comprising a stabilizing agent at between about 0.3% and 5% by weight which is an amino acid.
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein provides dosing accuracy and product safety.
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-l/Glucagon receptor agonist as described herein provides a biologically active, stable liquid formulation for use in injectable P-74757-PC applications.
- the phannaceutical composition comprises a non- lyophilized pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein.
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein provides a liquid formulation permitting storage for a long period of time in a liquid state facilitating storage and shipping prior to administration.
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein comprises solid lipids as matrix material.
- the injectable pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein comprises solid lipids as matrix material.
- the production of lipid microparticles by spray congealing was described by Lucasr (Speiser and al., Phann. Res. 8 (1991) 47-54) followed by lipid nanopellets for peroral administration (Speiser EP 0167825 (1990)).
- lipids, which are used, are well tolerated by the body (e. g. glycerides composed of fatty acids which are present in the emulsions for parenteral nutrition).
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein is in the fonn of liposomes (J. E. Diederichs and al., Pharm./nd. 56 (1994) 267- 275).
- the phannaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein comprises polymeric microparticles.
- the injectable phannaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein comprises polymeric microparticles.
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP- 1 /Glucagon receptor agonist as described herein comprises nanoparticles.
- the pharmaceutical composition comprising a reverse pegylated dual GLP- 1/Glucagon receptor agonist as described herein comprises liposomes.
- the phannaceutical composition comprising a pegylated or reverse pegylated OXM as described herein comprises lipid emulsion.
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP- 1/Glucagon receptor agonist as described herein comprises microspheres.
- the pharmaceutical composition comprising a pegylated or reverse pegylated P-74757-PC dual GLP-1 /Glucagon receptor agonist as described herein comprises lipid nanoparticles.
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein comprises lipid nanoparticles comprising amphiphilic lipids.
- the pharmaceutical composition comprising a pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist as described herein comprises lipid nanoparticles comprising a drug, a lipid matrix and a surfactant.
- the lipid matrix has a monoglyceride content which is at least 50% w/w.
- compositions of the present invention are presented in a pack or dispenser device, such as an FDA approved kit, which contain one or more unit dosage forms containing the long acting dual GLP-1 /Glucagon receptor agonist.
- the pack for example, comprise metal or plastic foil, such as a blister pack.
- the pack or dispenser device is accompanied by instructions for administration.
- the pack or dispenser is accommodated by a notice associated with the container in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals, which notice is reflective of approval by the agency of the form of the compositions or human or veterinary administration. Such notice, in one embodiment, is labeling approved by the U.S. Food and Drug Administration for prescription drugs or of an approved product insert.
- the pegylated or reverse pegylated dual GLP-1 /Glucagon receptor agonist of the present invention can be provided to the individual with additional active agents to achieve an improved therapeutic effect as compared to treatment with each agent by itself.
- measures e.g., dosing and selection of the complementary agent
- Oxyntomodulin of sequence HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA (SEQ ID NO: 1) was synthesized by the solid phase method employing the Fmoc-strategy throughout the peptide chain assembly (Almac Sciences, Scotland).
- the peptide sequence was assembled using the following steps: (1) Capping: the resin was capped using 0.5M acetic anhydride (Fluka) solution in DMF (Rathburn); (2) De-protection: Fmoc-protecting group was removed from P-74757-PC the growing peptide chain using 20% v/v piperidine (Rathburn) solution in DMF (Rathburn); and (3) Amino Acid Coupling: 0.5 M Amino acid (Novabiochem) solution in DMF (Rathburn) was activated using 1M HOBt (Carbosynth) solution in DMF (Rathburn) and 1M DIC (Carbosynth) solution in DMF (Rathburn). Four equivalents of each amino acid were used per coupling.
- Fluka acetic anhydride
- De-protection Fmoc-protecting group was removed from P-74757-PC the growing peptide chain using 20% v/v piperidine (Ra
- the crude peptide was cleaved from the resin, and the protecting groups were removed by stirring in a cocktail of Triisopropylsilane (Fluka), water, dimethylsulphide (Aldrich), ammonium iodide (Aldrich) and TFA (Applied Biosystems) for 4 hours. The crude peptide was then collected by precipitation from cold diethyl ether.
- Triisopropylsilane Fluka
- water dimethylsulphide
- Aldrich ammonium iodide
- TFA Applied Biosystems
- MAL-Fmoc-NHS (7) A clean dry 500ml RBF with overhead agitation was charged triphosgene (1.58g, 0.35eq.) in dry THF (55ml) to form a solution at ambient. The solution was cooled to about 0°C with an ice/water bath, and a solution of NHS (0.67g, 0.38eq) in dry THF (19ml) was added dropwise over 10 minutes under nitrogen at 0°C. The resultant solution was stirred for 30 minutes. A further portion of NHS (1.34g, 0.77eq) in dry THF (36ml) was added dropwise at 0°C over 10 minutes and stirred for 15 minutes.
- MAL-FMS-NHS test reaction: to a solution of MAL-Fmoc-NHS (lOOmg, 0.2mmol) in trifluoroacetic acid (10ml), chlorosulfonic acid (0.5ml) was added. After 15 minutes, ice-cold diethyl ether (90ml) was added and the product precipitated. The material was collected by centrif igation, washed with diethyl ether and dried under vacuum. 41.3mg (35%) of beige solid was obtained.
- PEG-Fmoc-OXM conjugation Conjugation with PEG, Fmoc and OXM were performed on a molar ratio of 1:1:1 e.g. PEG40-SH (44mg, in 4.4ml water equivalent to 1.0 ⁇ ) added to peptide (4.5mg, equivalent to 1.0 ⁇ ) and NaHC03 (1M, 0.1ml) added. Fmoc (Almac, lOmg/ml in DMF, 50 ⁇ 1) added with stirring. Reaction stirred for 24h at RT.
- PEG-FMS-OXM conjugation All conjugations were performed at 1:1:1 molar ratio between the PEG the linker and OXM with the following reagents: PEG40-SH and PEG30-SH (NOF), FMS (Almac), EMCS (Termo Scientific), OXM (Almac).
- PEG40-SH was P-74757-PC dissolved in 0.1M sodium phosphate buffer (Sigma) pH 7.2 to a concentration of lOmg/mL. The solution was added to one equivalent of purified OXM peptide (Almac).
- MAL-FMS- NHS (Almac) linker was dissolved in DMF to a concentration of lOmg/mL one equivalent added to the reaction.
- the mixture was stirred for 30 minutes.
- the solution was neutralised to pH 4 using glacial acetic acid (Fisher).
- the neutralised mixture was filtered (0.45 ⁇ ) and separated using preparative chromatography.
- the reaction mixture was filtered and purified by preparative HPLC (Phenomenex Luna CI 8) lyophilized and stored frozen.
- OXM content was determined using amino acid analysis (AAA) or basic hydrolysis.
- AAA amino acid analysis
- a defined quantity of lyophilized OXM conjugate was dissolved in water at a concentration of 20 mg/ml.
- the concentration of the peptide was accurately quantitated by acid-hydrolyzing an aliquot followed by quantitative amino acid analysis; the ideal fraction is the one having close agreement between the calculated absorbance at 280nm and the peptide content.
- CHO-K1 cells over-expressing GLP-1 receptor (Millipore HTS163C2) were seeded in 96 wells half-area white plate (Greiner) at a density of 200,000 cells/ml and incubated for 24 hours at 37°C. The cells were incubated with escalating concentrations of OXM (ALMAC), PEG40-EMCS-OXM and PEG40-Fmoc-OXM with or without rat serum 1% (Bio reclamation). Cells' cAMP concentrations were quantified by HTRF assay (Cisbio 62AM4PEB), and the EC50 parameter was analyzed by PRISM software.
- AMAC OXM
- PEG40-EMCS-OXM PEG40-Fmoc-OXM
- Bio reclamation Bio reclamation
- mice C57BL/6 male mice were fasted overnight and weighed, and blood glucose levels were measured by tail vein sampling using a handheld glucometer.
- Mice were IP injected with PBS (vehicle), OXM (333nmol/kg), PEG 40 -EMCS-OXM (non-reversible pegylated OXM, 333nmol/kg body weight peptide content) and PEG40-Fmoc-OXM (202nmol/kg body weight peptide content) and PEG 40 -OSU (546nmol/kg) as control.
- PBS vehicle
- OXM 333nmol/kg
- PEG 40 -EMCS-OXM non-reversible pegylated OXM, 333nmol/kg body weight peptide content
- PEG40-Fmoc-OXM 202nmol/kg body weight peptide content
- PEG 40 -OSU 546nmol/kg
- Glucose 1.5gr/kg was administered IP either 15min after test article administration (vehicle, OXM and PEG 4 o-Osu) or 120 min after PEG 4 o-Fmoc-OXM administration. Blood glucose levels were measured by tail vein sampling prior to glucose administration and 10, 20, 30, 60 and 120 min after glucose administration using a handheld glucometer.
- Study 1 C57BL/6J mice (4-6 weeks of age, Harlan UK Limited, Bicester, Oxon, UK), were group housed upon arrival in polypropylene cages. All animals had free access to a high fat diet (D12451; 45% of kcal derived from fat; Research Diets, New Jersey, USA) and tap water at all times. Animals were maintained on a normal phase 12 h light-dark cycle (lights on 07:00). Animals were exposed to the appropriate diet for at least 6 months (until the average body weight was approximately 50g).
- a high fat diet D12451; 45% of kcal derived from fat; Research Diets, New Jersey, USA
- mice were singly housed in polypropylene cages for a further two-week period and placed on reverse phase lighting (lights off for 8 h from 09:30 - 17:30 h). During the second week of single housing, animals began a once-daily handling protocol and a 7-day baseline period. Subsequently, mice were dosed with vehicle or test drug as given below in Table 1:
- Study 2 was carried out as described for Study 1. Following a baseline period, animals were dosed according to the following design described in Table 2:
- Study 3 was carried out as described for Study 1&2 with one difference, the mice at the beginning of the experiment were weight 45-46g. Following a baseline period, animals were dosed according to the following design described in Table 3:
- OXM and Sibutramine were formulated in PBS while PEG40-EMCS-OXM, PEG40-FMS-OXM and PEG-SH were formulated in 147mM NaCl lOmM citrate buffer pH 6. OXM content in PEG40-FMS-OXM and PEG40-EMCS-OXM were determined by AAA.
- Body weight and food intake are expressed as mean values ⁇ SEM. Body weight, body weight gain, daily and average food intake data and cumulative food intake were analysed by ANCOVA with baseline as a covariate, followed by appropriate comparisons (two-tailed) to determine significant differences from the control group. P ⁇ 0.05 is considered to be statistically significant. Baseline was Day 1 value for body weight or the average food or water consumption over the baseline period.
- OXM peptide was synthesized by the solid phase method employing the Fmoc- strategy throughout the peptide chain assembly.
- the peptide was purified by preparative HPLC using Phenomenex Luna CI 8 (250 x 30mm) column by applying gradient between solution A (0.1% TFA+H 2 0) and B (0.1% TFA + MeC ). Peptide purity was above 95%, the molecular weight was 4449 Da (measured by MALDI).
- Conjugation of OXM peptide to PEG 40 -SH through Fmoc linker was performed in the presence of NaHC0 3 . The reaction mixture was stirred for 24h at RT followed by filtration and purification by preparative HPLC (Jupiter C5).
- Conjugate molecular weight was analyzed by MALDI and OXM peptide content was analyzed by AAA.
- the average OXM peptide content was 189 g OXM per lmg PEGio-Fmoc-OXM conjugate 132 ⁇ g OXM per lmg PEG 20 -Fmoc-OXM conjugate, 61 ⁇ g OXM per lmg PEG 40 -Fmoc-OXM conjugate and 40 ⁇ g OXM per lmg PEG 40 -FMS-OXM conjugate.
- Table 3 Non-compartmental PK parameters of OXM and PEGio-Fmoc-OXM and PEG 2 o-Fmoc-OXM following SC administration in rats.
- Table 4 PK parameters of OXM and PEG 40 -Fmoc-OXM following IV or SC administration in rats. P-74757-PC
- Native OXM demonstrated improved activity compared to PEG 4 o-Fmoc-OXM and PEG 40 -EMCS-OXM which had comparable in-vitro activity (EC50 of 2.53x10-9, 2.07x10-6 and 5.87x10-7 for OXM, PEG40-EMCS-OXM and PEG40-Fmoc- OXM respectively, Figure 3).
- OXM pegylation didn't abrogate completely the GLP-1 receptor activation induced by OXM.
- the IPGTT model was applied. Overnight fasted C57BL/6 mice were injected IP with OXM peptide or PEG 4 o-Fmoc-OXM followed by IP injection of glucose and measurement of blood glucose levels from the tail vein by glucometer.
- OXM 333nmol/kg
- PEG 40 -EMCS-OXM non -reversible pegylated OXM, 333nmol/kg body weight peptide content
- PEG40- Fmoc-OXM 202nmol/kg body weight peptide content
- Reversible pegylated long acting OXM reduce body weight and inhibit food intake in DIO mice
- OXM The pharmacological activity of OXM was further evaluated in DIO mice following SC injection of native OXM, and reversibly-pegylated OXM.
- Body weight and food intake were measured daily for 8 days with a final measurement of body weight on day 12. Twice a day injection of OXM resulted in a moderate reduction in both body weight (6% weight loss on Day 8 compared to vehicle control group) and statistically significant inhibition of food intake.
- OXM is a potential peptide for the treatment of metabolic disorders such as diabetes and obesity, as demonstrated by the weight lost obtained by native OXM in over weight and obese healthy subject (Wynne et al, 2005). Yet, due to the short half-life of the peptide and its low stability in-vivo, repeated daily administrations of supra-physiological doses are required in order to achieve a pharmacological effect in humans.
- This patent provides effective means for stabilizing OXM in physiological conditions by reversibly pegylating the acting OXM thus rendering long-acting. Unexpectedly, the modified OXM-the pegylated version is active and is not a mere pro-drug.
- Reversibly-pegylated OXM demonstrated superior pharmacokinetic profile in rats with a substantial increase in the exposure and elongated half-life compared to native OXM.
- PEG 40 -conjugate demonstrated a superior prolonging effect compared to PEG 10 or PEG 20 . Therefore, the PEG 40 was further evaluated in pharmacological studies ( Figures 1 and 2).
- PEG 40 -FMS-OXM exhibited a prolonged anti-obesity P-74757-PC effect and improved efficacy considering that the cumulative dose of OXM administered during the study for PEG 4 o-FMS-OXM was almost 4 times lower compared to the group administered with native OXM.
- Non-reversible pegylated OXM PEG 40 -EMCS-OXM
- PEG 40 -EMCS-OXM was shown to improve glucose tolerance in IPGTT test. It was therefore imperative to evaluate the food regulation activity of conventional pegylation compared to reversibly pegylated OXM and native OXM in the DIO model.
- Administration of 5000nmol/kg of PEG 40 -EMCS-OXM every three days resulted in a negligible reduction in body weight although inhibition of food intake was evident up to 3 days post dosing (Figure 6).
- the moderate inhibition of food intake probably results from the direct activity of OXM in the gastrointestinal tract and correlates with the peripheral activity observed in the IPGTT model.
- the reversible pegylation strategy is aiming to overcome the loss of activity often observed in conventional pegylation while retaining the prolonging effect of the drug.
- the pegylated prodrug bioactivity is dramatically lost or even abolished the advantage in applying reversible pegylation was previously proven (United States Patent No. 7585837).
- PEG 40 -EMCS- OXM was shown to be active both in-vitro and in the IPGTT model in-vivo. Therefore, it was possible that this molecule will also induce satiety and reduce body weight following SC administration to mice. However, this was shown to be incorrect as PEG 40 -EMCS-OXM fail P-74757-PC to reduce body weight in DIO mice while PEG 40 -FMS-OXM had a marked effect.
- mice C57BL/6J mice (4-6 weeks of age, Harlan UK Limited, Bicester, Oxon, UK), were exposed P-74757-PC to a high fat diet (D12451; 45% of kcal derived from fat; Research Diets, New Jersey, USA) for at least 6 months (until the average body weight is approximately 50g).
- a high fat diet D12451; 45% of kcal derived from fat; Research Diets, New Jersey, USA
- animals were singly housed and placed on reverse phase lighting (lights off for 8 h from 09:30 - 17:30 h).
- animals began a once-daily handling protocol and during the second week (baseline period), they were dosed with the appropriate vehicle b.i.d. or once a week as they were dosed during the treatment period) by a subcutaneous route.
- terminal plasma samples were collected (24 hours after the final dose on Day 29) by cardiac puncture and assayed for insulin, P-74757-PC glucose, cholesterol and triglycerides using the mouse ultrasensitive insulin ELISA (80- INSMSU-E10), Thennoelectron Infinity glucose reagent (TR15421), Thennoelectron Infinity cholesterol reagent (TR13421) and the Sigma Triglyceride kit (TR0100).
- Final carcass weights were recorded after terminal blood sampling and carcasses frozen at -20°C.
- Body fat, protein, water and ash levels of the carcasses were detennined using standard chemical analysis techniques. Only fat, protein, water and ash content were measured, since other components (mainly carbohydrate) fonn less than 2% of total body composition.
- Carcass water was detennined by freeze-drying the mouse carcasses to constant weight. Dried carcasses were then ground in a laboratory grinder ready for subsequent analyses. Carcass fat was determined on the freeze-dried samples using a modified Soxhlet extraction protocol (petroleum ether at 40-60°C) with a Tecator Soxtec 2050 system (Foss UK Ltd, Wheldrake, UK) according to the manufacturer's recommended protocol.
- Carcass protein was detennined using a micro-Kjeldahl procedure on the freeze-dried samples using a Tecator 2012 digestion block and 2200 distilling unit (Foss UK Ltd). Residual carcass ash was detennined by firing the freeze-dried samples at high temperatures using a muffle ashing furnace.
- Terminal plasma insulin, cholesterol and triglycerides were analysed by general linear model with treatment as a factor and bleeding order and baseline body weight as covariates followed by appropriate comparisons (two-tailed) to determine significant differences from the relevant vehicle group. A log transfonnation and/or robust regression techniques were used if appropriate.
- Glucose tolerance in DIO mice after weekly injections with reversible PEGylated OXM was comparable to the glucose tolerance elicited by a twice per day injection of native oxyntomodulin at Day 2 ( Figure 8A) and at Day 23 ( Figure 8B).
- Reverse PEGylation was shown to be safe and tolerable in different toxicological rodent animal models. Reverse PEGylation also enables elongation of OXM half-life, while maintaining its potential to penetrate target tissues (e.g. penetrate the BBB).
- Reversibly PEGylated OXM demonstrated superior long acting properties, supporting once weekly injection in humans.
- Reversibly PEGylated OXM reduced the body weight by a specific reduction in fat (Body Composition assessment).
- Reversibly PEGylated OXM improved the glycemic and lipidemic profiles.
- Reversibly PEGylated OXM is expected to provide long-term therapy for obesity and Type II Diabetes patients via its impressive effects on glycemic activity and fat loss.
- the DIO model was carried out at RenaSci Ltd Company (Nottingham, UK). 57BL/6J mice (4 - 6 weeks of age, Harlan UK Limited, Bicester, Oxon, UK), were exposed to a high fat diet (D 12451 ; 45% of kcal derived from fat; Research Diets, New Jersey, USA) for at least 6 months (until the average body weight was approximately 50g). Two weeks prior to drug administration, animals were singly housed, where they began an acclimation period.
- mice On the first week, the handling period, animals began a once-daily handling protocol and during the second week, the baseline period, they were dosed with the appropriate vehicle; (b.i.d or once a week as they were dose during the treatment period) by a subcutaneous route. During the baseline and the treatment period food intake, water intake and body weight were recorded daily. On the morning of day 1 the mice were dosed followed by an overnight fasting. On days 2, 24h following administration (groups A-E) or prior to the morning dosing (groups F-H), the mice were sampled for fasting glucose and fasting insulin. All blood samples (approximately 20 ⁇ 1) were taken from the tail vein.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Diabetes (AREA)
- Organic Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Endocrinology (AREA)
- Hematology (AREA)
- Epidemiology (AREA)
- Obesity (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Emergency Medicine (AREA)
- Child & Adolescent Psychology (AREA)
- Toxicology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Medicinal Preparation (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA2837710A CA2837710C (en) | 2011-06-02 | 2012-06-04 | Pegylated oxyntomodulin conjugates with improved linkers |
| MX2013014069A MX346957B (es) | 2011-06-02 | 2012-06-04 | Agonistas de receptor de glp-1/glucagón de acción prolongada. |
| BR112013030933A BR112013030933A2 (pt) | 2011-06-02 | 2012-06-04 | agonistas do receptor de glp-1/glucágon de ação prolongada |
| HK15102153.2A HK1201478A1 (en) | 2011-06-02 | 2012-06-04 | Long-acting glp-1/glucagon receptor agonists |
| MX2015011960A MX386803B (es) | 2011-06-02 | 2012-06-04 | Agonistas de receptor de glp-1/glucagón de acción prolongada. |
| JP2014513790A JP6182134B2 (ja) | 2011-06-02 | 2012-06-04 | 長時間作用型glp−1/グルカゴン受容体アゴニスト |
| EA201391764A EA201391764A1 (ru) | 2011-06-02 | 2012-06-04 | Агонисты рецептора glp-1/глюкагона длительного действия |
| EP12793107.9A EP2714070B1 (en) | 2011-06-02 | 2012-06-04 | Long-acting glp-1/glucagon receptor agonists |
| CN201280038726.3A CN104023739A (zh) | 2011-06-02 | 2012-06-04 | 长效glp-1/胰高血糖素受体激动剂 |
| ES12793107T ES2981891T3 (es) | 2011-06-02 | 2012-06-04 | Agonistas del receptor de GLP-1/glucagón de acción prolongada |
| US14/123,106 US20140349922A1 (en) | 2011-06-02 | 2012-06-04 | Long-acting glp-1/glucagon receptor agonists |
| AU2012261869A AU2012261869B2 (en) | 2011-06-02 | 2012-06-04 | Long-acting GLP-1/Glucagon receptor agonists |
| KR1020137035156A KR102092206B1 (ko) | 2011-06-02 | 2012-06-04 | 장기-작용성 glp-1/글루카곤 수용체 작용제 |
| IL229732A IL229732B (en) | 2011-06-02 | 2013-11-28 | Long-acting glp-1/glucagon receptor agonists |
| US14/725,883 US10166295B2 (en) | 2011-06-02 | 2015-05-29 | Pegylated OXM variants |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161492448P | 2011-06-02 | 2011-06-02 | |
| US61/492,448 | 2011-06-02 | ||
| US201261624589P | 2012-04-16 | 2012-04-16 | |
| US61/624,589 | 2012-04-16 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/123,106 A-371-Of-International US20140349922A1 (en) | 2011-06-02 | 2012-06-04 | Long-acting glp-1/glucagon receptor agonists |
| PCT/IL2013/050481 Continuation-In-Part WO2013183052A1 (en) | 2011-06-02 | 2013-06-04 | Pegylated oxm variants |
| US14/725,883 Continuation-In-Part US10166295B2 (en) | 2011-06-02 | 2015-05-29 | Pegylated OXM variants |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2012167251A1 true WO2012167251A1 (en) | 2012-12-06 |
Family
ID=47259955
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/040744 Ceased WO2012167251A1 (en) | 2011-06-02 | 2012-06-04 | Long-acting glp-1/glucagon receptor agonists |
Country Status (17)
Cited By (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013183052A1 (en) * | 2012-06-04 | 2013-12-12 | Prolor Biotech Inc. | Pegylated oxm variants |
| US9249407B2 (en) | 2006-02-03 | 2016-02-02 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US9458444B2 (en) | 2006-02-03 | 2016-10-04 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| WO2016193969A2 (en) | 2015-05-29 | 2016-12-08 | Opko Biologics Ltd. | Pegylated oxyntomodulin variants |
| US9522945B2 (en) | 2012-04-19 | 2016-12-20 | Opko Biologics Ltd. | Long-acting oxyntomodulin variants and methods of producing same |
| US9663778B2 (en) | 2009-07-09 | 2017-05-30 | OPKO Biologies Ltd. | Long-acting coagulation factors and methods of producing same |
| US9808534B2 (en) | 2012-11-20 | 2017-11-07 | Opko Biologics Ltd. | Method of increasing the hydrodynamic volume of polypeptides by attaching to gonadotrophin carboxy terminal peptides |
| US9828417B2 (en) | 2006-02-03 | 2017-11-28 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| WO2017212494A1 (en) * | 2016-06-09 | 2017-12-14 | Opko Biologics Ltd. | Long-acting oxyntomodulin formulation and methods of producing and administering same |
| EP3148571A4 (en) * | 2014-05-30 | 2017-12-20 | Hanmi Pharm. Co., Ltd. | Composition for treating diabetes mellitus comprising insulin and a glp-1/glucagon dual agonist |
| US9884901B2 (en) | 2006-02-03 | 2018-02-06 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US9896494B2 (en) | 2006-02-03 | 2018-02-20 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing same |
| US9908924B2 (en) | 2006-02-03 | 2018-03-06 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US10017557B2 (en) | 2015-08-28 | 2018-07-10 | Hanmi Pharm. Co., Ltd. | Insulin analogs and use thereof |
| US10159715B2 (en) | 2014-05-29 | 2018-12-25 | Hanmi Pharm. Co., Ltd | Method for treating diabetes comprising long-acting insulin analogue conjugate and long-acting insulinotropic peptide conjugate |
| US10166295B2 (en) | 2011-06-02 | 2019-01-01 | Opko Biologics Ltd. | Pegylated OXM variants |
| US10221228B2 (en) | 2006-02-03 | 2019-03-05 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US10253082B2 (en) | 2014-01-20 | 2019-04-09 | Hanmi Pharm. Co., Ltd | Long-acting insulin and use thereof |
| US10351615B2 (en) | 2006-02-03 | 2019-07-16 | Opko Biologics Ltd. | Methods of treatment with long-acting growth hormone |
| EP3406264A4 (en) * | 2015-12-29 | 2019-07-17 | Pegbio Co., Ltd. | COMPOSITION WITH GLP-1 RECEPTOR AGONISTS AND GLUCAGON RECEPTOR AGONIST AND USE THEREOF |
| WO2020165900A1 (en) | 2019-02-11 | 2020-08-20 | Opko Biologics Ltd. | Long-acting glp-2 analogs |
| US10960058B2 (en) | 2015-06-19 | 2021-03-30 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US11197915B2 (en) | 2013-10-21 | 2021-12-14 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US11396534B2 (en) | 2016-09-23 | 2022-07-26 | Hanmi Pharm. Co., Ltd. | Insulin analogs with reduced affinity to insulin receptor and use thereof |
| US11752216B2 (en) | 2017-03-23 | 2023-09-12 | Hanmi Pharm. Co., Ltd. | Insulin analog complex with reduced affinity for insulin receptor and use thereof |
| US11976106B2 (en) | 2016-07-11 | 2024-05-07 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US12203113B2 (en) | 2009-07-09 | 2025-01-21 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US12441776B2 (en) | 2018-11-30 | 2025-10-14 | Eirgen Pharma Ltd. | Oxyntomodulin peptide analog formulations |
| US12459982B2 (en) | 2014-12-10 | 2025-11-04 | Opko Biologistics Ltd. | Methods of producing long acting CTP-modified growth hormone polypeptides |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| TW201706291A (zh) * | 2015-07-10 | 2017-02-16 | 賽諾菲公司 | 作為選擇性肽雙重glp-1/升糖素受體促效劑之新毒蜥外泌肽(exendin-4)衍生物 |
| CN108602894A (zh) * | 2015-10-30 | 2018-09-28 | 纽约州立大学研究基金会 | 胃泌酸调节素类似物及其制备和使用方法 |
| US11376345B2 (en) | 2017-11-23 | 2022-07-05 | Sentigel Ab | Hydrogel composition and its uses |
| CN117586373A (zh) * | 2022-08-10 | 2024-02-23 | 成都奥达生物科技有限公司 | 一种长效双激动剂化合物 |
| WO2025258939A1 (ko) | 2024-06-12 | 2025-12-18 | 주식회사 에스엔바이오사이언스 | 펩타이드 유도체와 알부민을 포함하는 약제학적 조성물 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998005361A2 (en) | 1996-08-07 | 1998-02-12 | Yeda Research And Development Co. Ltd. | Long-acting drugs and pharmaceutical compositions comprising them |
| US20060171920A1 (en) | 2003-04-08 | 2006-08-03 | Yeda Research And Development Co., Ltd. | Reversible pegylated drugs |
| US20100144617A1 (en) | 2006-02-22 | 2010-06-10 | Ranabir Sinha Roy | Oxyntomodulin Derivatives |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2010033240A2 (en) * | 2008-09-19 | 2010-03-25 | Nektar Therapeutics | Carbohydrate-based drug delivery polymers and conjugates thereof |
| MX2011009803A (es) * | 2009-03-20 | 2011-09-30 | Hanmi Holdings Co Ltd | Metodo para preparar un polipeptido conjugado fisiologicamente activo en un sitio especifico. |
| AR079344A1 (es) * | 2009-12-22 | 2012-01-18 | Lilly Co Eli | Analogo peptidico de oxintomodulina, composicion farmaceutica que lo comprende y uso para preparar un medicamento util para tratar diabetes no insulinodependiente y/u obesidad |
-
2012
- 2012-06-04 KR KR1020137035156A patent/KR102092206B1/ko active Active
- 2012-06-04 EA EA201391764A patent/EA201391764A1/ru unknown
- 2012-06-04 MX MX2015011960A patent/MX386803B/es unknown
- 2012-06-04 MX MX2013014069A patent/MX346957B/es active IP Right Grant
- 2012-06-04 SG SG10201606243YA patent/SG10201606243YA/en unknown
- 2012-06-04 BR BR112013030933A patent/BR112013030933A2/pt not_active IP Right Cessation
- 2012-06-04 CA CA2837710A patent/CA2837710C/en active Active
- 2012-06-04 HK HK15102153.2A patent/HK1201478A1/xx unknown
- 2012-06-04 AU AU2012261869A patent/AU2012261869B2/en active Active
- 2012-06-04 US US14/123,106 patent/US20140349922A1/en active Pending
- 2012-06-04 CN CN201280038726.3A patent/CN104023739A/zh active Pending
- 2012-06-04 EP EP12793107.9A patent/EP2714070B1/en active Active
- 2012-06-04 WO PCT/US2012/040744 patent/WO2012167251A1/en not_active Ceased
- 2012-06-04 JP JP2014513790A patent/JP6182134B2/ja active Active
- 2012-06-04 ES ES12793107T patent/ES2981891T3/es active Active
-
2013
- 2013-11-28 IL IL229732A patent/IL229732B/en unknown
- 2013-12-02 CL CL2013003450A patent/CL2013003450A1/es unknown
- 2013-12-27 CO CO13301132A patent/CO6980619A2/es unknown
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1998005361A2 (en) | 1996-08-07 | 1998-02-12 | Yeda Research And Development Co. Ltd. | Long-acting drugs and pharmaceutical compositions comprising them |
| US20060171920A1 (en) | 2003-04-08 | 2006-08-03 | Yeda Research And Development Co., Ltd. | Reversible pegylated drugs |
| US20100144617A1 (en) | 2006-02-22 | 2010-06-10 | Ranabir Sinha Roy | Oxyntomodulin Derivatives |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP2714070A4 |
Cited By (51)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11066658B2 (en) | 2006-02-03 | 2021-07-20 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US10144921B2 (en) | 2006-02-03 | 2018-12-04 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US9908924B2 (en) | 2006-02-03 | 2018-03-06 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US9249407B2 (en) | 2006-02-03 | 2016-02-02 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US9458444B2 (en) | 2006-02-03 | 2016-10-04 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US10119132B2 (en) | 2006-02-03 | 2018-11-06 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US9896494B2 (en) | 2006-02-03 | 2018-02-20 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing same |
| US9884901B2 (en) | 2006-02-03 | 2018-02-06 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US10640758B2 (en) | 2006-02-03 | 2020-05-05 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US10351615B2 (en) | 2006-02-03 | 2019-07-16 | Opko Biologics Ltd. | Methods of treatment with long-acting growth hormone |
| US10030060B2 (en) | 2006-02-03 | 2018-07-24 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing same |
| US10221228B2 (en) | 2006-02-03 | 2019-03-05 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US9828417B2 (en) | 2006-02-03 | 2017-11-28 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US9663778B2 (en) | 2009-07-09 | 2017-05-30 | OPKO Biologies Ltd. | Long-acting coagulation factors and methods of producing same |
| US12203113B2 (en) | 2009-07-09 | 2025-01-21 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US10538755B2 (en) | 2009-07-09 | 2020-01-21 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US10166295B2 (en) | 2011-06-02 | 2019-01-01 | Opko Biologics Ltd. | Pegylated OXM variants |
| US9522945B2 (en) | 2012-04-19 | 2016-12-20 | Opko Biologics Ltd. | Long-acting oxyntomodulin variants and methods of producing same |
| CN109096387B (zh) * | 2012-06-04 | 2021-11-30 | 奥普科生物制品有限公司 | 聚乙二醇化的oxm变体 |
| WO2013183052A1 (en) * | 2012-06-04 | 2013-12-12 | Prolor Biotech Inc. | Pegylated oxm variants |
| US10537646B2 (en) | 2012-06-04 | 2020-01-21 | Opko Biologics Ltd. | Pegylated OXM variants |
| CN104684576A (zh) * | 2012-06-04 | 2015-06-03 | 奥普科生物制品有限公司 | 聚乙二醇化的oxm变体 |
| CN109096387A (zh) * | 2012-06-04 | 2018-12-28 | 奥普科生物制品有限公司 | 聚乙二醇化的oxm变体 |
| AU2018201623B2 (en) * | 2012-06-04 | 2019-08-29 | Opko Biologics Ltd. | Pegylated OXM variants |
| KR102092025B1 (ko) * | 2012-06-04 | 2020-03-24 | 옵코 바이오로직스 리미티드 | 페길화된 옥신토모둘린 변이체 |
| KR20150021087A (ko) * | 2012-06-04 | 2015-02-27 | 옵코 바이오로직스 리미티드 | 페길화된 옥신토모둘린 변이체 |
| AU2013273135B2 (en) * | 2012-06-04 | 2017-12-07 | Opko Biologics Ltd. | Pegylated OXM variants |
| CN104684576B (zh) * | 2012-06-04 | 2019-08-06 | 奥普科生物制品有限公司 | 聚乙二醇化的oxm变体 |
| US9821070B2 (en) | 2012-06-04 | 2017-11-21 | Opko Biologics Ltd. | Pegylated OXM variants |
| US9808534B2 (en) | 2012-11-20 | 2017-11-07 | Opko Biologics Ltd. | Method of increasing the hydrodynamic volume of polypeptides by attaching to gonadotrophin carboxy terminal peptides |
| US12029780B2 (en) | 2013-10-21 | 2024-07-09 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US11197915B2 (en) | 2013-10-21 | 2021-12-14 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| US10253082B2 (en) | 2014-01-20 | 2019-04-09 | Hanmi Pharm. Co., Ltd | Long-acting insulin and use thereof |
| US10159715B2 (en) | 2014-05-29 | 2018-12-25 | Hanmi Pharm. Co., Ltd | Method for treating diabetes comprising long-acting insulin analogue conjugate and long-acting insulinotropic peptide conjugate |
| US10188703B2 (en) | 2014-05-30 | 2019-01-29 | Hanmi Pharm. Co., Ltd. | Method for treating diabetes mellitus by a composition comprising insulin and a GLP-1/glucagon dual agonist |
| EP3148571A4 (en) * | 2014-05-30 | 2017-12-20 | Hanmi Pharm. Co., Ltd. | Composition for treating diabetes mellitus comprising insulin and a glp-1/glucagon dual agonist |
| US12459982B2 (en) | 2014-12-10 | 2025-11-04 | Opko Biologistics Ltd. | Methods of producing long acting CTP-modified growth hormone polypeptides |
| AU2016273045B2 (en) * | 2015-05-29 | 2020-11-26 | Opko Biologics Ltd. | Pegylated oxyntomodulin variants |
| WO2016193969A2 (en) | 2015-05-29 | 2016-12-08 | Opko Biologics Ltd. | Pegylated oxyntomodulin variants |
| EP3302571A4 (en) * | 2015-05-29 | 2019-01-23 | OPKO Biologics Ltd. | VARIANTS OF PEGYLATED OXYNTOMODULIN |
| US10960058B2 (en) | 2015-06-19 | 2021-03-30 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US10647753B2 (en) | 2015-08-28 | 2020-05-12 | Hanmi Pharm. Co., Ltd. | Insulin analogs and use thereof |
| US10017557B2 (en) | 2015-08-28 | 2018-07-10 | Hanmi Pharm. Co., Ltd. | Insulin analogs and use thereof |
| US10894076B2 (en) | 2015-12-29 | 2021-01-19 | Pegbio Co., Ltd. | Composition comprising GLP-1 receptor agonist and glucagon receptor agonist and application thereof |
| EP3406264A4 (en) * | 2015-12-29 | 2019-07-17 | Pegbio Co., Ltd. | COMPOSITION WITH GLP-1 RECEPTOR AGONISTS AND GLUCAGON RECEPTOR AGONIST AND USE THEREOF |
| WO2017212494A1 (en) * | 2016-06-09 | 2017-12-14 | Opko Biologics Ltd. | Long-acting oxyntomodulin formulation and methods of producing and administering same |
| US11976106B2 (en) | 2016-07-11 | 2024-05-07 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US11396534B2 (en) | 2016-09-23 | 2022-07-26 | Hanmi Pharm. Co., Ltd. | Insulin analogs with reduced affinity to insulin receptor and use thereof |
| US11752216B2 (en) | 2017-03-23 | 2023-09-12 | Hanmi Pharm. Co., Ltd. | Insulin analog complex with reduced affinity for insulin receptor and use thereof |
| US12441776B2 (en) | 2018-11-30 | 2025-10-14 | Eirgen Pharma Ltd. | Oxyntomodulin peptide analog formulations |
| WO2020165900A1 (en) | 2019-02-11 | 2020-08-20 | Opko Biologics Ltd. | Long-acting glp-2 analogs |
Also Published As
| Publication number | Publication date |
|---|---|
| JP6182134B2 (ja) | 2017-08-16 |
| CA2837710C (en) | 2022-11-08 |
| AU2012261869B2 (en) | 2017-01-05 |
| JP2014516993A (ja) | 2014-07-17 |
| MX2013014069A (es) | 2014-08-22 |
| HK1201478A1 (en) | 2015-09-04 |
| EP2714070A1 (en) | 2014-04-09 |
| KR20140083929A (ko) | 2014-07-04 |
| MX386803B (es) | 2025-03-19 |
| IL229732B (en) | 2021-10-31 |
| EP2714070B1 (en) | 2024-03-20 |
| MX346957B (es) | 2017-04-06 |
| US20140349922A1 (en) | 2014-11-27 |
| CA2837710A1 (en) | 2012-12-06 |
| ES2981891T3 (es) | 2024-10-11 |
| EA201391764A1 (ru) | 2014-07-30 |
| SG10201606243YA (en) | 2016-09-29 |
| BR112013030933A2 (pt) | 2018-04-24 |
| CN104023739A (zh) | 2014-09-03 |
| EP2714070A4 (en) | 2015-03-04 |
| IL229732A0 (en) | 2014-01-30 |
| CO6980619A2 (es) | 2014-06-27 |
| CL2013003450A1 (es) | 2015-01-16 |
| KR102092206B1 (ko) | 2020-03-24 |
| AU2012261869A1 (en) | 2014-01-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2012261869B2 (en) | Long-acting GLP-1/Glucagon receptor agonists | |
| AU2018201623B2 (en) | Pegylated OXM variants | |
| US10166295B2 (en) | Pegylated OXM variants | |
| AU2016273045B2 (en) | Pegylated oxyntomodulin variants | |
| US20190160152A1 (en) | Long-acting oxyntomodulin formulation and methods of producing and administering same |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12793107 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2837710 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2013/014069 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2014513790 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013003450 Country of ref document: CL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201391764 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13301132 Country of ref document: CO |
|
| ENP | Entry into the national phase |
Ref document number: 20137035156 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2012261869 Country of ref document: AU Date of ref document: 20120604 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112013030933 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112013030933 Country of ref document: BR Kind code of ref document: A2 Effective date: 20131129 |