WO2012156219A1 - Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same - Google Patents

Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same Download PDF

Info

Publication number
WO2012156219A1
WO2012156219A1 PCT/EP2012/058313 EP2012058313W WO2012156219A1 WO 2012156219 A1 WO2012156219 A1 WO 2012156219A1 EP 2012058313 W EP2012058313 W EP 2012058313W WO 2012156219 A1 WO2012156219 A1 WO 2012156219A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
acid sequence
less
sequence
sequences
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2012/058313
Other languages
English (en)
French (fr)
Other versions
WO2012156219A9 (en
Inventor
Heidi Rommelaere
Joost Alexander Kolkman
Michael John Scott Saunders
Ann Union
Yolande Chvatchko
Amanda E.I. Proudfoot
Alain Vicari
Denis BRUNIQUEL
Laurent Chevalet
Olivier Leger
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ablynx NV
Merck Patent GmbH
Original Assignee
Ablynx NV
Merck Patent GmbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=46245559&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2012156219(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to UAA201314154A priority Critical patent/UA117218C2/uk
Priority to KR1020137032085A priority patent/KR102083230B1/ko
Priority to NZ616761A priority patent/NZ616761A/en
Priority to JP2014508842A priority patent/JP6628965B2/ja
Priority to US14/115,549 priority patent/US10017568B2/en
Priority to EA201391632A priority patent/EA035973B9/ru
Priority to CN201280033175.1A priority patent/CN103717618B/zh
Priority to EP22169137.1A priority patent/EP4105231A1/en
Priority to AU2012257942A priority patent/AU2012257942B8/en
Priority to MX2013012844A priority patent/MX2013012844A/es
Priority to SG2013079371A priority patent/SG194632A1/en
Priority to ES12726593.2T priority patent/ES2662371T3/es
Priority to BR112013028407-2A priority patent/BR112013028407B1/pt
Application filed by Ablynx NV, Merck Patent GmbH filed Critical Ablynx NV
Priority to LTEP12726593.2T priority patent/LT2705058T/lt
Priority to DK12726593.2T priority patent/DK2705058T3/en
Priority to PH1/2013/502234A priority patent/PH12013502234A1/en
Priority to CA2834907A priority patent/CA2834907C/en
Priority to SI201231255T priority patent/SI2705058T1/en
Priority to EP12726593.2A priority patent/EP2705058B1/en
Priority to EP18150770.8A priority patent/EP3363815A1/en
Priority to HRP20180380TT priority patent/HRP20180380T1/hr
Publication of WO2012156219A1 publication Critical patent/WO2012156219A1/en
Publication of WO2012156219A9 publication Critical patent/WO2012156219A9/en
Priority to IL228813A priority patent/IL228813B/en
Anticipated expiration legal-status Critical
Priority to US16/002,135 priority patent/US10829552B2/en
Priority to US17/036,602 priority patent/US11773159B2/en
Priority to US17/679,675 priority patent/US20220195031A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • C07K16/244Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/24Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • the present invention relates to amino acid sequences that are directed against (as defined herein) any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof, as well as to compounds or constructs, and in particular proteins and polypeptides, that comprise or essentially consist of one or more such amino acid sequences (also referred to herein as "amino acid sequences of the invention", “compounds of the invention”, and “polypeptides of the invention”, respectively).
  • amino acid sequences of the invention are immunoglobulin single variable domains ("ISV's").
  • An immunoglobulin single variable domain is an amino acid sequence that:
  • - comprises an immunoglobulin fold or that, under suitable conditions (such as
  • an immunoglobulin fold i.e. by folding
  • an immunoglobulin variable domain such as, for example, a VH, VL or VHH domain
  • an immunoglobulin variable domain that comprises a functional antigen binding activity (in the sense that it does not require an interaction with another immunoglobulin variable domain (such as a VH-VL interaction) to form a functional antigen binding site).
  • ISV's of the invention Amino acid sequences of the invention that are ISV's are also referred to herein as "ISV's of the invention".
  • immunoglobulin single variable domains suitable for use in the invention will become clear from the further description herein, and for example comprise VHH's and/or (other) Nanobodies (preferred), such as humanized VHH's or camelized VH's, such as camelized human VH, dAb's and (single) domain antibodies.
  • the invention also relates to nucleic acids encoding such amino acid sequences and polypeptides (also referred to herein as "nucleic acids of the invention” or “nucleotide sequences of the invention”); to methods for preparing such amino acid sequences and polypeptides; to host cells expressing or capable of expressing such amino acid sequences or polypeptides; to compositions, and in particular to pharmaceutical compositions, that comprise such amino acid sequences, polypeptides, nucleic acids and/or host cells; and to uses of such amino acid sequences or polypeptides, nucleic acids, host cells and/or compositions, in particular for prophylactic, therapeutic or diagnostic purposes, such as the prophylactic, therapeutic or diagnostic purposes mentioned herein.
  • Interleukin- 17A is a T-cell derived pro-inflammatory molecule that stimulates epithelial, endothelial and fibroblastic cells to produce other inflammatory cytokines and chemokines including IL-6, IL-8, G-CSF, and MCP-1 [see, Yao, Z. et al., J. Immunol., 122 (12): 5483-5486 (1995); Yao, Z. et al.,
  • IL-17A also synergizes with other cytokines including TNF-a and IL-IB to further induce chemokine expression (Chabaud, M. , et al., J. Immunol. 161 ( 1 ) : 409- 14 (1998)). IL-17A exhibits pleitropic biological activities on various types of cells.
  • IL- 17A also has the ability to induce ICAM- 1 surface expression, proliferation of T cells, and growth and differentiation of CD34+ human progenitors into neutrophils.
  • IL- 17A has also been implicated in bone metabolism, and has been suggested to play an important role in pathological conditions characterized by the presence of activated T cells and TNF-a production such as rheumatoid arthritis and loosening of bone implants (Van Bezooijen et al., J. Bone Miner. Res., 14: 1513- 1521 [ 1999]).
  • IL- 17A Activated T cells of synovial tissue derived from rheumatoid arthritis patients were found to secrete higher amounts of IL- 17A than those derived from normal individuals or osteoarthritis patients (Chabaud et al., Arthritis Rheum., 42: 963-970 [1999]). It was suggested that this proinflammatory cytokine actively contributes to synovial inflammation in rheumatoid arthritis. Apart from its proinflammatory role, IL- 17A seems to contribute to the pathology of rheumatoid arthritis by yet another mechanism. For example, IL-17A has been shown to induce the expression of osteoclast differentiation factor (ODF) mRNA in osteoblasts (Kotake et al., J. Clin.
  • ODF osteoclast differentiation factor
  • ODF stimulates differentiation of progenitor cells into osteoclasts, the cells involved in bone resorption. Since the level of LL-17A is significantly increased in synovial fluid of rheumatoid arthritis patients, it appears that IL-17A induced osteoclast formation plays a crucial role in bone resorption in rheumatoid arthritis. LL-17A is also believed to play a key role in certain other autoimmune disorders such as multiple sclerosis (Matusevicius et al., Mult. Scler., 5: 101-104 (1999); Kurasawa, K.
  • IL-17A has further been shown, by intracellular signalling, to stimulate Ca2+ influx and a reduction in [cAMP] in human macrophages (Jovanovicetal., J. Immunol., 160: 3513 [1998]).
  • IL-17A induces the activation of NF-KB in fibroblasts, [Yao et al., Immunity, 3: 81 1 (1995), Jovanovic et al., supra], while it induces the activation of NF- ⁇ and mitogen- activated protein kinases in macrophages (Shalom-Barek et al., J. Biol. Chem., 273: 27467 [1998]).
  • LL-17A also shares sequence similarity with mammalian cytokine-like factor 7 that is involved in bone and cartilage growth.
  • Interleukin 17A is now recognized as the prototype member of an emerging family of cytokines (see review by Gaffen, 2009 Nature Review Immunology 9:556-567).
  • the large scale sequencing of the human and other vertebrate genomes has revealed the presence of additional genes encoding proteins clearly related to IL-17A, thus defining a new family of cytokines.
  • There are at least 6 members of the IL-17 family in humans and mice including IL-17B, IL-17C, IL-17D, IL-17E and IL-17F as well as 6 related receptors IL-17RA, IL- 17RB, IL-17RC (also known as IL-17 RL), IL-17RD and IL-17RF (Gaffen ibid.).
  • IL-17F IL-17 member
  • IL-17R human IL-17 receptor
  • the gene encoding human 1L-17F is located adjacent to that encoding IL-17A
  • IL-17A and IL-17F share about 50% amino acid identity whereas the other members of the IL- 17 family share a more limited 15-27% amino acid identity, suggesting that IL-17A and IL-17F form a distinct subgroup within the IL-17 family (Starnes et al., J Immunol, 167 (8): 4137-40 (2001); Aggarwal and Gurney J. Leukoc Biol, 71 (1) : 1-8 (2002) ).
  • IL-17F appears to have similar biological actions as IL-17A, and is able to promote the production of IL-6, IL-8, and G-CSF from a wide variety of cells. Similar to IL-17A, it is able to induce cartilage matrix release and inhibit new cartilage matrix synthesis (see US-2002-0177188-A1 published November 28, 2002). Thus, like IL-17A, IL- 17F may potentially contribute to the pathology of
  • IL-17A and IL-17F are induced in T cells by the action of interleukin 23 (IL-23) (Aggarwal et al., J. Biol. Chem., 278 (3): 1910-4 (2003)).
  • IL-17A and IL-17F share similar chromosomal localization and significant sequence similarity as well as the observation that IL- 17A and IL-17F appear to be induced with the same cell population in response to a specific stimuli has lead to the identification of a new human cytokine that is comprised of a covalent (via 2 disulfide bonds) heterodimer of IL-17A and IL- 17F (herein designated IL-17A/F), see also WO05/010044, Wright et al., J. Biol. Chem., 282: 13447 (2007); Kawaguchi et al., J. Allergy Clin. Immunol., 1 14: 1265 (2004); and Kolls, JK et al., Immunity, 21 : 467 (2004).
  • the amino acid sequences, polypeptides and compositions of the present invention can generally be used to modulate, and in particular inhibit and/or prevent, binding of any of IL- 17A, IL-17F and/or 1L-17A/F including combinations thereof to IL-17RA and/or IL-17RC complex, and thus to modulate, and in particular inhibit or prevent, the signalling that is mediated by the binding of any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof to IL-17RA and/or IL-17RC complex, to modulate the biological pathways in which the binding of any of IL-17A, IL-17F and/or IL- 17A/F including combinations thereof to IL- 17RA and/or IL-17RC complex is involved, and/or to modulate the biological mechanisms, responses and effects associated with such signalling or these pathways.
  • IL- 17 A, IL-17F and IL-17A/F signal via dimers and/or trimers of IL- 17RA and/or IL-17RC (Gaffen ibid.).
  • the amino acid sequences, polypeptides and compositions of the present invention can be used for the prevention and treatment (as defined herein) of immune related diseases and disorders (herein referred to as 'immune related diseases and disorders of the invention').
  • immune related diseases and disorders of the invention can be defined as diseases and disorders that can be prevented and/or treated, respectively, by suitably administering to a subject in need thereof (i.e. having the disease or disorder or at least one symptom thereof and/or at risk of attracting or developing the disease or disorder) of either a polypeptide or composition of the invention (and in particular, of a
  • immune related diseases and disorders of the invention will be clear to the skilled person based on the disclosure herein, and for example include the following diseases and disorders: systemic lupus erythematosus, rheumatoid arthritis, osteoarthritis, juvenile chronic arthritis, spondyloarthropathies, systemic sclerosis, idiopathic inflammatory myopathies, Sjogren's syndrome, systemic vasculitis, sarcoidosis, autoimmune hemolytic anemia, autoimmune thrombocytopenia, thyroiditis, diabetes mellitus, immune-mediated renal disease, demyelinating diseases of the central and peripheral nervous systems such as multiple sclerosis, idiopathic demyelinating polyneuropathy or Guillain-Barre syndrome, and chronic inflammatory demyelinating polyneuropathy, hepatobiliary diseases such as infectious, autoimmune chronic active hepatitis, primary biliary cirrhosis, granulomatous hepatitis, and s
  • the amino acid sequences, polypeptides and compositions of the present invention can be used for the prevention and treatment of immune related diseases and disorders of the invention which are characterized by excessive and/or unwanted signalling mediated by any of IL- 17A, IL-17F and/or IL-17A/F including combinations thereof or by the pathway(s) in which any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof is involved.
  • immune related diseases and disorders of the invention will again be clear to the skilled person based on the disclosure herein.
  • amino acid sequences and polypeptides of the invention can for example be used to prevent and/or to treat all diseases and disorders that are currently being prevented or treated with active principles that can modulate any of IL- 17A, IL-17F and/or IL-17A/F including combinations thereof-mediated signalling, such as those mentioned in the prior art cited above. It is also envisaged that the polypeptides of the invention can be used to prevent and/or to treat all diseases and disorders for which treatment with such active principles is currently being developed, has been proposed, or will be proposed or developed in future.
  • polypeptides of the present invention may be used for the prevention and treatment of other diseases and disorders than those for which these known active principles are being used or will be proposed or developed; and/or that the polypeptides of the present invention may provide new methods and regimens for treating the diseases and disorders described herein.
  • amino acid sequences that are directed against (as defined herein) any of IL-17A, IL-17F and/or IL- 17 A/F including combinations thereof, in particular against any of IL- 17 A, IL- 17F and/or IL- 17A/F including combinations thereof from a warm-blooded animal, more in particular against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof from a mammal, and especially against any of human IL-17A, IL-17F and/or IL-17A/F including combinations thereof; and to provide proteins and polypeptides comprising or essentially consisting of at least one such amino acid sequence.
  • amino acid sequences, proteins, polypeptides and compositions that are described herein.
  • amino acid sequences used in the invention are preferably immunoglobulin single variable domains or "ISV's" as described herein, and the proteins and polypeptides used in the invention are preferably proteins and polypeptides that comprise one or more of such immunoglobulin single variable domains.
  • the invention provides amino acid sequences (and preferably ISV's) that are directed against (as defined herein) and/or can specifically bind (as defined herein) to any of IL- 17A, IL- 17F and/or IL- 17A/F including combinations thereof; as well as compounds and constructs, and in particular proteins and polypeptides, that comprise at least one such amino acid sequence.
  • the invention provides amino acid sequences (and preferably ISV's) that can bind to any of IL- 17A, IL-17F and/or IL- 17A/F including combinations thereof with an affinity (suitably measured and/or expressed as a D -value (actual or apparent), a A -value (actual or apparent), a kon-rate and/or a karate, or alternatively as an IC50 value, as further described herein) that is as defined herein; as well as compounds and constructs, and in particular proteins and polypeptides, that comprise at least one such amino acid sequence.
  • amino acid sequences and polypeptides of the invention are preferably such that they: bind to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof with a dissociation constant ( D ) of 10 "5 to 10 "12 moles/liter or less, such as 10 "5 to 10 " 15 moles/liter and preferably 10 "7 to 10 "12 moles/liter or less such as 10 "7 to 10 "15 moles/liter and more preferably 10 "8 to 10 " 12 moles/liter or 10 "8 to 10 "15 moles/liter (i.e.
  • D dissociation constant
  • K A association constant of 10 5 to 10 12 liter/ moles or more such as 10 5 to 10 15 liter/moles, and preferably 10 7 to 10 12 liter/moles or more such as 10 7 to 10 15 liter/ and more preferably 10 8 to 10 12 liter/moles or 10 8 to 10 15 liter/moles);
  • IL-17A binds to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof with a kon-rate of between 10 2 M " 's ' ' to about 10 7 M " 's ' ⁇ preferably between 10 3 M " 's " ' and
  • bind to any of EL- 17 A, IL-17F and/or IL-17A F including combinations thereof with a koff rate between 1 s " 1 (ti /2 0.69 s) and 10 "6 s " 1 (providing a near irreversible complex with a t
  • a monovalent amino acid sequence of the invention is preferably such that it will bind to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof with an affinity less than 500 nM, preferably less than 200 nM, more preferably less than 10 or 1 nM, such as less than 500 pM.
  • IC50 values for binding of the amino acid sequences or polypeptides of the invention to any of IL-17A, IL-17F and or IL-17A/F including combinations thereof will become clear from the further description and examples herein.
  • an amino acid sequence of the invention will usually contain within its amino acid sequence one or more amino acid residues or one or more stretches of amino acid residues (i.e. with each "stretch" comprising two or amino acid residues that are adjacent to each other or in close proximity to each other, i.e.
  • amino acid sequence of the invention via which the amino acid sequence of the invention can bind to any of IL-17A, DL- 17F and/or IL-17A/F including combinations thereof, which amino acid residues or stretches of amino acid residues thus form the "site" for binding to any of IL-17A, IL-17F and/or IL- 17A/F including combinations thereof (also referred to herein as the "antigen binding site").
  • amino acid sequences provided by the invention are preferably in essentially isolated form (as defined herein), or form part of a protein or polypeptide of the invention (as defined herein), which may comprise or essentially consist of one or more amino acid sequences of the invention and which may optionally further comprise one or more further amino acid sequences (all optionally linked via one or more suitable linkers).
  • the one or more amino acid sequences of the invention may be used as a binding unit in such a protein or polypeptide, which may optionally contain one or more further amino acid sequences that can serve as a binding unit (i.e.
  • IL-17A, IL-17F and/or IL- 17A F including combinations thereof so as to provide a monovalent, multivalent or multispecific polypeptide of the invention, respectively, all as described herein.
  • a protein or polypeptide may also be in essentially isolated form (as defined herein).
  • amino acid sequences and polypeptides of the invention as such preferably essentially consist of a single amino acid chain that is not linked via disulphide bridges to any other amino acid sequence or chain (but that may or may not contain one or more
  • Nanobodies - as described herein - may sometimes contain a disulphide bridge between CDR3 and CDR1 or FR2).
  • one or more amino acid sequences of the invention may be linked to each other and/or to other amino acid sequences (e.g. via disulphide bridges) to provide peptide constructs that may also be useful in the invention (for example Fab' fragments, F(ab') 2 fragments, ScFv constructs, "diabodies” and other multispecific constructs.
  • Fab' fragments, F(ab') 2 fragments, ScFv constructs, "diabodies” and other multispecific constructs for example Fab' fragments, F(ab') 2 fragments, ScFv constructs, "diabodies” and other multispecific constructs.
  • amino acid sequence of the invention when intended for administration to a subject (for example for therapeutic and/or diagnostic purposes as described herein), it is preferably either an amino acid sequence that does not occur naturally in said subject; or, when it does occur naturally in said subject, in essentially isolated form (as defined herein).
  • amino acid sequences of the invention are preferably directed against human any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof; whereas for veterinary purposes, the amino acid sequences and polypeptides of the invention are preferably directed against any of IL- 17 A, IL- 17F and/or IL-17A/F including combinations thereof from the species to be treated, or are at least cross-reactive with any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof from the species to be treated.
  • an amino acid sequence of the invention may optionally, and in addition to the at least one binding site for binding against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof, contain one or more further binding sites for binding against other antigens, proteins or targets.
  • 04G01-like sequences a "04G01-like sequence", "04G01-like /SV" or "04G01 -like building block” is defined as an ISV (as described herein) that comprises:
  • a CDR1 which comprises or essentially consists of either (i) the amino acid sequence IHVMG or (ii) an amino acid sequence that has only 3, 2 or 1 amino acid
  • a CDR2 which comprises or essentially consists of either (i) the amino acid sequence LIFSGGSADYADSVKG or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence LIFSGGSADYADSVKG; or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence LIFSGGSADYADSVKG; and/or
  • a CDR3 which comprises or essentially consists of either (i) the amino acid sequence EIGYYSGGTYYSSEAH or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence EIGYYSGGTYYSSEAH; or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence EIGYYSGGTYYSSEAH; in which the framework sequences present in such an ISV are as further described herein, and in which CDR1 , CDR2 and CDR3 are preferably such that the 04G01 -like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g.
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 04G01 -like ISV has a blocking activity of 0.3 ⁇ g/ml IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5nM and/or the 04G01 -like ISV has a blocking activity of 1.5 ⁇ g/ml IL-17A/F- induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably,
  • CDR1 and CDR2 are as defined under a) and b), respectively; or CDR1 and CDR3 are as defined under a) and c), respectively; or CDR2 and CDR3 are as defined under b) and c), respectively. More preferably, in such a 04G01-like sequence, CDR1 , CDR2 and CDR3 are all as defined under a), b) and c), respectively.
  • CDR1 , CDR2 and CDR3 are preferably such that the 04G01-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 04G01 -like ISV has a blocking activity of 0.3 g/ml IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5nM and/or the 04G01-like ISV has a blocking activity of 1.5 ⁇ g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or even more preferably
  • CDRl may comprise or essentially consist of the amino acid sequence IHVMG (with CDR2 and CDR3 being as defined under b) and c), respectively); and/or CDR2 may comprise or essentially consist of the amino acid sequence LIFSGGSADYADSVKG (with CDRl and CDR3 being as defined under a) and c), respectively); and/or CDR3 may comprise or essentially consist of the amino acid sequence EIGYYSGGTYYSSEAH (with CDRl and CDR2 being as defined under a) and b), respectively).
  • CDRl may comprise or essentially consist of the amino acid sequence IHVMG and CDR2 may comprise or essentially consist of the amino acid sequence
  • LIFSGGSADYADSVKG (with CDR3 being as defined under c) above); and/or CDRl may comprise or essentially consist of the amino acid sequence IHVMG and CDR3 may comprise or essentially consist of the amino acid sequence EIGYYSGGTYYSSEAH (with CDR2 being as defined under b) above); and/or CDR2 may comprise or essentially consist of the amino acid sequence LIFSGGSADYADSVKG and CDR3 may comprise or essentially consist of the amino acid sequence EIGYYSGGTYYSSEAH (with CDRl being as defined under a) above).
  • CDRl , CDR2 and CDR3 are preferably such that the 04G01-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 04G01-like ISV has a blocking activity of 0.3 ⁇ IL- 17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5nM and/or the 04G01 -like ISV has a blocking activity of 1.5 ⁇ g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or even more preferably of less
  • a "04G01-like sequence", "04G01-like 75V” or "04G0/- like building block” is an ISV that comprises:
  • a CDR1 which is either (i) the amino acid sequence IHVMG or (ii) an amino acid sequence that has only 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence IHVMG; and/or
  • a CDR2 which is either (i) the amino acid sequence LIFSGGSADYADSVKG or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence
  • LIFSGGSADYADSV G or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence LIFSGGSADYADSVKG; and/or
  • a CDR3 which is either (i) the amino acid sequence EIGYYSGGTYYSSEAH or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence
  • EIGYYSGGTYYSSEAH or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence EIGYYSGGTYYSSEAH; in which the framework sequences present in such an ISV are as further described herein, and in which CDR1 , CDR2 and CDR3 are preferably such that the 04G01-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • Alphascreen assays e.g. such as described herein
  • cell based assays e.g. such as described herein
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 04G01-like ISV has a blocking activity of 0.3 ⁇ g/ml IL- 17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5nM and/or the 04G01 -like ISV has a blocking activity of 1.5 ⁇ g/ml IL-17A/F- induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80
  • CDR1 and CDR2 are as defined under d) and e), respectively; or CDR1 and CDR3 are as defined under d) and f), respectively; or CDR2 and CDR3 are as defined under e) and f), respectively. More preferably, in such a 04G01 -like sequence, CDR1, CDR2 and CDR3 are all as defined under d), e) and f)» respectively. Again, in such an 04G01-like sequence, CDR1 , CDR2 and CDR3 are preferably such that the 04G01 -like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g.
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 04G01-like ISV has a blocking activity of 0.3 ⁇ g/ml IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5nM and/or the 04G01-like ISV has a blocking activity of 1.5 ⁇ IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM,
  • CDR1 is the amino acid sequence IHVMG (with CDR2 and CDR3 being as defined under e) and f), respectively); and/or CDR2 is the amino acid sequence
  • CDR3 is the amino acid sequence EIGYYSGGTYYSSEAH (with CDR1 and CDR2 being as defined under d) and e), respectively).
  • CDR1 is the amino acid sequence IHVMG and CDR2 is the amino acid sequence LIFSGGSADYADSVKG (with CDR3 being as defined under f) above); and/or CDR 1 is the amino acid sequence IHVMG and CDR3 is the amino acid sequence EIGYYSGGTYYSSEAH (with CDR2 being as defined under e) above); and/or CDR2 is the amino acid sequence LIFSGGSADYADSV G and CDR3 is EIGYYSGGTYYSSEAH (with CDR1 being as defined under d) above).
  • CDR1 , CDR2 and CDR3 are preferably such that the 04G01-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 04G01-like ISV has a blocking activity of 0.3 ⁇ IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5nM and/or the 04G01-like ISV has a blocking activity of 1.5 ⁇ / ⁇ 1 IL- 17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or even more preferably of less than
  • CDR1 is the amino acid sequence IHVMG
  • CDR2 is the amino acid sequence LIFSGGSADYADSVKG
  • CDR3 is the amino acid sequence EIGYYSGGTYYSSEAH.
  • the framework sequences may be as further described herein.
  • the framework sequences are such that the framework sequences have at least 80%, such as at least 85%, for example at least 90%, such as at least 95% sequence identity with the framework sequences of 04G01 (which, for example, can be determined by determining the overall degree of sequence identity of a given sequence with the sequence of 04G01 while disregarding the CDR's in the calculation).
  • the combination of CDR's and frameworks present in a given sequence are preferably such that the resulting 04G01 -like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT- 1080 cell based assay, for instance, such as described in Example 9.
  • the 04G01 -like ISV has a blocking activity of 0.3 ⁇ IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5nM and/or the 04G01-like ISV has a blocking activity of 1.5 ⁇ IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or even more preferably of less than 35nM.
  • a 04G01-like sequence is an ISV that has at least 70%, such at least 80%, for example at least 85%, such as at least 90% or more than 95% sequence identity with SEQ ID NO: 635.
  • the CDR's may be according to the specifically preferred aspect described above, and may in particularly (but without limitation) be IHVMG (CDR1);
  • the combination of CDR's and frameworks present in such a 04G01-like ISV are preferably such that the resulting 04G01-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 04G01-like ISV has a blocking activity of 0.3 ⁇ g/ml IL-17A-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM and/or the 04G01-like ISV has a blocking activity of 1.5 ⁇ IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or even more preferably of less
  • any 04G01 -like sequence may be a humanized and/or sequence optimized sequence, as further described herein.
  • 16A04-like sequences a " 16A04-like sequence ", "16A04-like ISV” or "16A04-like building block” is defined as an ISV (as described herein) that comprises: a) a CDR1 which comprises or essentially consists of either (i) the amino acid sequence SYVVG or (ii) an amino acid sequence that has only 2 or (preferably) 1 amino acid difference(s) (as defined herein) with the amino acid sequence SYVVG; and/or b) a CDR2 which comprises or essentially consists of either (i) the amino acid sequence AISGSGDSIYYAVSE D or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence AISGSGDSIYYAVSEKD; or (iii) an amino acid sequence that
  • a CDR3 which comprises or essentially consists of either (i) the amino acid sequence DQEFGYLRFGRSEY or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence DQEFGYLRFGRSEY; or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence DQEFGYLRFGRSEY; in which the framework sequences present in such an ISV are as further described herein, and in which CDR1 , CDR2 and CDR3 are preferably such that the 16A04-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g.
  • the blocking activity is determined by a HT-1080 cell based assay, such as, for instance, described in Example 9.
  • the 16A04-like ISV has a blocking activity of 4.5 ⁇ IL- 17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM, more preferably, less than 250 nM or even less, such as less than 200 nM or 180 nM, 175 nM, 160 nM or even more preferably of less than 150 nM and/or the 16A04-like ISV has a blocking activity of 1.5 g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or
  • CDR1 and CDR2 are as defined under a) and b), respectively; or CDR1 and CDR3 are as defined under a) and c), respectively; or CDR2 and CDR3 are as defined under b) and c), respectively. More preferably, in such a 16A04-like sequence, CDR1, CDR2 and CDR3 are all as defined under a), b) and c), respectively.
  • CDR1 , CDR2 and CDR3 are preferably such that the 16A04-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, such as, for instance, described in Example 9.
  • the 16A04-like ISV has a blocking activity of 4.5 ⁇ g ml IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM, more preferably, less than 250 nM or even less, such as less than 200 nM or 180 nM, 175 nM, 160 nM or even more preferably of less than 150 nM and/or the 16A04-like ISV has a blocking activity of 1.5 ⁇ IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably of less than 50nM.
  • CDR1 may comprise or essentially consist of the amino acid sequence SYVVG (with CDR2 and CDR3 being as defined under b) and c), respectively); and/or CDR2 may comprise or essentially consist of the amino acid sequence AISGSGDSIYYAVSEKD (with CDR1 and CDR3 being as defined under a) and c), respectively); and/or CDR3 may comprise or essentially consist of the amino acid sequence DQEFGYLRFGRSEY (with CDR1 and CDR2 being as defined under a) and b), respectively).
  • CDR1 may comprise or essentially consist of the amino acid sequence SYVVG and CDR2 may comprise or essentially consist of the amino acid sequence
  • AISGSGDSIYYAVSEKD (with CDR3 being as defined under c) above); and/or CDR1 may comprise or essentially consist of the amino acid sequence SYVVG and CDR3 may comprise or essentially consist of the amino acid sequence DQEFGYLRFGRSEY (with CDR2 being as defined under b) above); and/or CDR2 may comprise or essentially consist of the amino acid sequence AISGSGDSIYYAVSEKD and CDR3 may comprise or essentially consist of the amino acid sequence DQEFGYLRFGRSEY (with CDR1 being as defined under a) above).
  • CDR 1 , CDR2 and CDR3 are preferably such that the 16A04-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, such as, for instance, described in Example 9.
  • the 16A04-like ISV has a blocking activity of 4.5 ⁇ IL-17F-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 300 nM, more preferably, less than 250 nM or even less, such as less than 200 nM or 180 nM, 175 nM, 160 nM or even more preferably of less than 150 nM and/or the 16A04-like ISV has a blocking activity of 1.5 ⁇ IL-17A/F-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably of less than 50nM.
  • a "16A04-like sequence", “16A04-like ISV” or “16A04- like building block” is an ISV that comprises:
  • a CDR1 which is either (i) the amino acid sequence SYVVG or (ii) an amino acid sequence that has only 2 or (preferably) 1 amino acid difference(s) (as defined herein) with the amino acid sequence SYVVG; and/or
  • a CDR2 which is either (i) the amino acid sequence AISGSGDSIYYAVSE D or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence
  • AISGSGDSIYYAVSEKD or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence AISGSGDSIYYAVSEKD; and/or
  • a CDR3 which is either (i) the amino acid sequence DQEFGYLRFGRSEY or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence
  • DQEFGYLRFGRSEY or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence
  • DQEFGYLRFGRSEY in which the framework sequences present in such an ISV are as further described herein, and in which CDR1 , CDR2 and CDR3 are preferably such that the 16A04-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, such as, for instance, described in Example 9.
  • the 16A04-like ISV has a blocking activity of 4.5 ⁇ IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM, more preferably, less than 250 nM or even less, such as less than 200 nM or 180 nM, 175 nM, 160 nM or even more preferably of less than 150 nM and/or the 16A04-like ISV has a blocking activity of 1.5 ⁇ IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably of less than 50nM.
  • CDR1 and CDR2 are as defined under d) and e), respectively; or CDR1 and CDR3 are as defined under d) and f), respectively; or CDR2 and CDR3 are as defined under e) and 0» respectively. More preferably, in such a 16A04-like sequence, CDR1 , CDR2 and CDR3 are all as defined under d), e) and 0, respectively. Again, in such an 16A04-like sequence, CDR1, CDR2 and CDR3 are preferably such that the 16A04-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g.
  • the blocking activity is determined by a HT-1080 cell based assay, such as, for instance, described in Example 9.
  • the 16A04-like ISV has a blocking activity of 4.5 ⁇ IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM, more preferably, less than 250 nM or even less, such as less than 200 nM or 180 nM, 175 nM, 160 nM or even more preferably of less than 150 nM and/or the 16A04-Iike ISV has a blocking activity of 1.5 g/ml IL- 17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM
  • CDR1 is the amino acid sequence SYVVG (with CDR2 and CDR3 being as defined under e) and f) > respectively); and/or CDR2 is the amino acid sequence
  • AISGSGDSIYYAVSEKD (with CDR1 and CDR3 being as defined under d) and f), respectively); and/or CDR3 is the amino acid sequence DQEFGYLRFGRSEY (with
  • CDR1 and CDR2 being as defined under d) and e), respectively).
  • CDR1 is the amino acid sequence SYVVG and CDR2 is the amino acid sequence AISGSGDSIYYAVSEKD (with CDR3 being as defined under f) above); and/or CDR1 is the amino acid sequence SYVVG and CDR3 is the amino acid sequence DQEFGYLRFGRSEY (with CDR2 being as defined under e) above); and/or CDR2 is the amino acid sequence AISGSGDSIYYAVSEKD and CDR3 is DQEFGYLRFGRSEY (with CDR1 being as defined under d) above).
  • CDR1 , CDR2 and CDR3 are preferably such that the 16A04- like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, such as, for instance, described in Example 9.
  • the 16A04-like ISV has a blocking activity of 4.5 ⁇ IL-17F-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 300 nM, more preferably, less than 250 nM or even less, such as less than 200 nM or 180 nM, 175 nM, 160 nM or even more preferably of less than 150 nM and/or the 16A04-like ISV has a blocking activity of 1.5 g/ml IL- 17A/F- induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 65 nM, 60 n
  • CDR 1 is the amino acid sequence SYVVG
  • CDR2 is the amino acid sequence AISGSGDSIYYAVSEKD
  • CDR3 is the amino acid sequence DQEFGYLRFGRSEY.
  • the framework sequences may be as further described herein.
  • the framework sequences are such that the framework sequences have at least 80%, such as at least 85%, for example at least 90%, such as at least 95% sequence identity with the framework sequences of 16A04 (which, for example, can be determined by determining the overall degree of sequence identity of a given sequence with the sequence of 16A04 while disregarding the CDR's in the calculation).
  • the combination of CDR's and frameworks present in a given sequence are preferably such that the resulting 16A04-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, such as, for instance, described in Example 9.
  • the 16A04-like ISV has a blocking activity of 4.5 ig/ml H_-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM, more preferably, less than 250 nM or even less, such as less than 200 nM or 180 nM, 175 nM, 160 nM or even more preferably of less than 150 nM and/or the 16A04-like ISV has a blocking activity of 1.5 ⁇ g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably of less than 50nM.
  • a 16A04-like sequence is an ISV that has at least 70%, such at least 80%, for example at least 85%, such as at least 90% or more than 95% sequence identity with SEQ ID NO: 648.
  • the CDR's may be according to the specifically preferred aspect described above, and may in particularly (but without limitation) be SYVVG (CDR1);
  • the combination of CDR's and frameworks present in such a 16A04-like ISV are preferably such that the resulting 16A04-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, such as, for instance, described in Example 9.
  • the 16A04-like ISV has a blocking activity of 4.5 g/ml IL-17F-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 300 nM, more preferably, less than 250 nM or even less, such as less than 200 nM or 180 nM, 175 nM, 160 nM or even more preferably of less than 150 nM and/or the 16A04-like ISV has a blocking activity of 1.5 ⁇ £/ ⁇ 1 IL-17A/F-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably of less than 50nM.
  • any 16A04-like sequence may be a humanized sequence, as further described herein.
  • 13B03-Hke sequences a "13B03-like sequence", "13B03-like ISV” or "I3B03-like building block” is defined as an ISV (as described herein) that comprises:
  • a CDR1 which comprises or essentially consists of either (i) the amino acid sequence INWFG or (ii) an amino acid sequence that has only 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence INWFG; and/or
  • a CDR2 which comprises or essentially consists of either (i) the amino acid sequence GIRWSDAYTEYANSVKG or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence GIRWSDAYTEYANSVKG; or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence GIRWSDAYTEYANSVKG; and/or
  • a CDR3 which comprises or essentially consists of either (i) the amino acid sequence DLSTVRY or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence DLSTVRY; or (iii) an amino acid sequence that has only 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence DLSTVRY; in which the framework sequences present in such an ISV are as further described herein, and in which CDR1 , CDR2 and CDR3 are preferably such that the 13B03-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g.
  • the blocking activity is determined by a HT- 1080 cell based assay, for instance, such as described in Example 9.
  • the 13B03-Iike ISV has a blocking activity of 0.3 ⁇ g/ml IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13B03-like ISV has a blocking activity of 4.5 ⁇ IL-17F- induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 300
  • CDR1 and CDR2 are as defined under a) and b), respectively; or CDR1 and CDR3 are as defined under a) and c), respectively; or CDR2 and CDR3 are as defined under b) and c), respectively. More preferably, in such a 13B03-like sequence, CDR 1 , CDR2 and CDR3 are all as defined under a), b) and c), respectively.
  • CDR1 , CDR2 and CDR3 are preferably such that the 13B03-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13B03-like ISV has a blocking activity of 0.3 ⁇ IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13B03-like ISV has a blocking activity of 4.5 ⁇ IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 300 nM, 250 nM or even less, such as less than 200 nM or 175 nM, 160 nM, or 155 nM or even more preferably of less than 150 nM and/or the 13B03-like ISV has
  • CDR1 may comprise or essentially consist of the amino acid sequence INWFG (with CDR2 and CDR3 being as defined under b) and c), respectively); and/or CDR2 may comprise or essentially consist of the amino acid sequence GIRWSDAYTEYANSVKG (with CDR1 and CDR3 being as defined under a) and c), respectively); and/or CDR3 may comprise or essentially consist of the amino acid sequence DLSTVRY (with CDR1 and CDR2 being as defined under a) and b), respectively).
  • CDR1 may comprise or essentially consist of the amino acid sequence INWFG and CDR2 may comprise or essentially consist of the amino acid sequence
  • CDR1 may comprise or essentially consist of the amino acid sequence INWFG and CDR3 may comprise or essentially consist of the amino acid sequence DLSTVRY (with CDR2 being as defined under b) above); and/or CDR2 may comprise or essentially consist of the amino acid sequence GIRWSDAYTEYANSVKG and CDR3 may comprise or essentially consist of the amino acid sequence DLSTVRY (with CDR1 being as defined under a) above).
  • CDR1 , CDR2 and CDR3 are preferably such that the 13B03-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13B03-like ISV has a blocking activity of 0.3 ⁇ IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13B03-like ISV has a blocking activity of 4.5 ⁇ IL-17F-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 350 nM, more preferably, less than 300 nM, 250 nM or even less, such as less than 200 nM or 175 nM, 160 nM, or 155 nM or even more preferably of less than 150 nM and/or the 13B03-like ISV has
  • a "13B03-like sequence", “13B03-like ISV or "13B03- like building block” is an ISV that comprises:
  • a CDRl which is either (i) the amino acid sequence INWFG or (ii) an amino acid sequence that has only 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence ENWFG; and/or
  • a CDR2 which is either (i) the amino acid sequence GIRWSDAYTEYANSV G or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence
  • GIRWSDAYTEYANSVKG or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence GIRWSDAYTEYANSVKG; and/or
  • a CDR3 which is either (i) the amino acid sequence DLSTVRY or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence DLSTVRY; or (iii) an amino acid sequence that has only 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence DLSTVRY; in which the framework sequences present in such an ISV are as further described herein, and in which CDRl , CDR2 and CDR3 are preferably such that the 13B03-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g.
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13B03-like ISV has a blocking activity of 0.3 ⁇ IL- 17 A- induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13B03-like ISV has a blocking activity of 4.5 ⁇ g/ml IL-17F- induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 350 nM, more preferably, less than
  • CDRl and CDR2 are as defined under d) and e), respectively; or CDRl and CDR3 are as defined under d) and f), respectively; or CDR2 and CDR3 are as defined under e) and f), respectively. More preferably, in such a 13B03-like sequence, CDRl , CDR2 and CDR3 are all as defined under d), e) and f)» respectively.
  • CDRl , CDR2 and CDR3 are preferably such that the 13B03-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT- 1080 cell based assay, for instance, such as described in Example 9.
  • the 13B03-like ISV has a blocking activity of 0.3 g/ml IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13B03-like ISV has a blocking activity of 4.5 ⁇ IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 300 nM, 250 nM or even less, such as less than 200 nM or 175 nM, 160 nM, or 155 nM or even more preferably of less than 150 nM and/or the 13B03-like I
  • CDR l is the amino acid sequence INWFG (with CDR2 and CDR3 being as defined under e) and f) > respectively); and/or CDR2 is the amino acid sequence
  • GIRWSDAYTEYANSV G (with CDR l and CDR3 being as defined under d) and 0, respectively); and/or CDR3 is the amino acid sequence DLSTVRY (with CDR1 and CDR2 being as defined under d) and e), respectively).
  • CDR1 is the amino acid sequence INWFG and CDR2 is the amino acid sequence GIRWSDAYTEYANSV G (with CDR3 being as defined under f) above); and/or CDR1 is the amino acid sequence INWFG and CDR3 is the amino acid sequence DLSTVRY (with CDR2 being as defined under e) above); and/or CDR2 is the amino acid sequence GIRWSDAYTEYANSVKG and CDR3 is DLSTVRY (with CDR1 being as defined under d) above).
  • CDR1, CDR2 and CDR3 are preferably such that the 13B03-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13B03-like ISV has a blocking activity of 0.3 ⁇ IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an
  • the 13B03-like ISV has a blocking activity of 4.5 g/ml IL-17F- induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 300 nM, 250 nM or even less, such as less than 200 nM or 175 nM, 160 nM, or 155 nM or even more preferably of less than 150 nM and/or the 13B03-like ISV has a blocking activity of 1.5 ⁇ g ml IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less
  • CDR1 is the amino acid sequence INWFG
  • CDR2 is the amino acid sequence GIRWSDAYTEYANSVKG
  • CDR3 is the amino acid sequence DLSTVRY.
  • the framework sequences may be as further described herein.
  • the framework sequences are such that the framework sequences have at least 80%, such as at least 85%, for example at least 90%, such as at least 95% sequence identity with the framework sequences of 13B03 (which, for example, can be determined by determining the overall degree of sequence identity of a given sequence with the sequence of 13B03 while disregarding the CDR's in the calculation).
  • the combination of CDR's and frameworks present in a given sequence are preferably such that the resulting 13B03-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13B03-like ISV has a blocking activity of 0.3 g/ml IL- 17A-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13B03-like ISV has a blocking activity of 4.5 ⁇ IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 300 nM, 250 nM or even less, such as less than 200 nM or 175 nM, 160 nM, or 155 nM or even more preferably of less than 150 nM and/or the 13B03-
  • a 13B03-like sequence is an ISV that has at least 70%, such at least 80%, for example at least 85%, such as at least 90% or more than 95% sequence identity with SEQ ID NO: 662.
  • the CDR's may be according to the specifically preferred aspect described above, and may in particularly (but without limitation) be INWFG (CDR1 );
  • the combination of CDR's and frameworks present in such a 13B03-like ISV are preferably such that the resulting 13B03-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13B03-like ISV has a blocking activity of 0.3 ⁇ IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13B03-like ISV has a blocking activity of 4.5 ⁇ g/ml IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 300 nM, 250 nM or even less, such as less than 200 nM or 175 nM, 160 nM, or 155 nM or even more preferably of less than 150 nM and/or the 13B03-like
  • any 13B03-like sequence may be a humanized and/or sequence optimized sequence, as further described herein.
  • one further embodiment of the invention concerns also a polypeptide comprising
  • CDR2 and CDR3 sequences (i) and (ii) may in total comprise up to four single amino acid deletions, insertions and/or substitutions;
  • polypeptide specifically binds to IL-17A and/or IL-17F and wherein preferably the polypeptide specifically binds to IL- 17A with a Kd of less than 50 pM and to IL-17F with a Kd of less than 5 nM.
  • the polypeptide of this embodiment specifically binds to at least one epitope of IL- I 7A selected from the amino acids L74, Y85 and N88 of IL-17A.
  • the polypeptide of this embodiment specifically binds to at least three epitopes of IL- 17A, e.g. at least to amino acids L74, Y85 and N88 of IL-17A (SEQ ID NO: 839).
  • Prefered is also a polypeptide comprising
  • polypeptide specifically binds to IL-17A and/or IL-17F (preferably each with a Kd of less than 5 nM) but not to any of IL-17B, IL-17C, IL-17D and IL- 17E.
  • this polypeptide specifically binds to at least amino acids L74, Y85 and N88 of IL-17A (SEQ ID NO: 839).
  • all of the above polypeptides comprising a CDR2 and/or CDR3 sequences can be used and are effective for the treatment of a disease as disclosed herein.
  • 13E02-like sequences a "13E02-like sequence", "13E02-like ISV or "13E02-like building block" is defined as an ISV (as described herein) that comprises:
  • a CDR1 which comprises or essentially consists of either (i) the amino acid sequence AMG or (ii) an amino acid sequence that has 1 amino acid difference(s) (as defined herein) with the amino acid sequence AMG; and/or
  • a CDR2 which comprises or essentially consists of either (i) the amino acid sequence AISGSGDDTYYADSV G or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence AISGSGDDTYYADSVKG; or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence AISGSGDDTYYADSVKG; and/or
  • a CDR3 which comprises or essentially consists of either (i) the amino acid sequence RRGLYYVWDSNDYEN or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence RRGLYYVWDSNDYEN; or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence RRGLYYVWDSNDYEN; in which the framework sequences present in such an ISV are as further described herein, and in which CDR1 , CDR2 and CDR3 are preferably such that the 13E02-Iike ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g.
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13E02-like ISV has a blocking activity of 0.3 ⁇ EL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13E02-like ISV has a blocking activity of 4.5 ⁇ g/ml IL-17F- induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 250 n
  • CDR2 and CDR3 are as defined under b) and c), respectively. More preferably, in such a 13E02-like sequence, CDR1 , CDR2 and CDR3 are all as defined under a), b) and c), respectively. Again, in such an 13E02-like sequence, CDR1 , CDR2 and CDR3 are preferably such that the 13E02-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • Alphascreen assays e.g. such as described herein
  • cell based assays e.g. such as described herein
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13E02-like ISV has a blocking activity of 0.3 ⁇ g/ml IL- 17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13E02-like ISV has a blocking activity of 4.5 ⁇ g/ml IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 250 nM, 200 nM or even less, such as less than 175 nM or 150
  • CDR1 may comprise or essentially consist of the amino acid sequence AMG (with CDR2 and CDR3 being as defined under b) and c), respectively); and/or CDR2 may comprise or essentially consist of the amino acid sequence AISGSGDDTYYADSVKG (with CDR1 and CDR3 being as defined under a) and c), respectively); and/or CDR3 may comprise or essentially consist of the amino acid sequence RRGLYYVWDSNDYEN (with CDR1 and CDR2 being as defined under a) and b), respectively).
  • CDR1 may comprise or essentially consist of the amino acid sequence AMG and CDR2 may comprise or essentially consist of the amino acid sequence
  • CDR1 may comprise or essentially consist of the amino acid sequence AMG and CDR3 may comprise or essentially consist of the amino acid sequence RRGLYYVWDSNDYEN
  • CDR1 , CDR2 and CDR3 are preferably such that the 13E02-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13E02-like ISV has a blocking activity of 0.3 ⁇ g/ml IL-17A-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13E02-like ISV has a blocking activity of 4.5 ⁇ g/ml IL- 17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 250 nM, 200 nM or even less, such as less than 175 nM or
  • a "13E02-like sequence", "J3E02-like ISV” or “13E02- like building block” is an ISV that comprises:
  • a CDR1 which is either (i) the amino acid sequence AMG or (ii) an amino acid
  • a CDR2 which is either (i) the amino acid sequence A ISGSGDDT Y Y ADS V G or
  • amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence
  • AISGSGDDTYYADSVKG or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence AISGSGDDTYYADSVKG; and/or
  • CDR3 which is either (i) the amino acid sequence RRGLYYVWDSNDYEN or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence
  • RRGLYYVWDSNDYEN or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence
  • RRGLYYVWDSNDYE in which the framework sequences present in such an ISV are as further described herein, and in which CDR1 , CDR2 and CDR3 are preferably such that the 13E02-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT- 1080 cell based assay, for instance, such as described in Example 9.
  • the 13E02-like ISV has a blocking activity of 0.3 ⁇ g/mI IL- 17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13E02-Iike ISV has a blocking activity of 4.5 ⁇ g/ml IL- 17F- induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 250 nM, 200 nM or even less, such as less than 175 nM or 150 nM, 140 nM, or 125 nM or even more preferably of less than 1 10 nM
  • CDR1 and CDR2 are as defined under d) and e), respectively; or CDR1 and CDR3 are as defined under d) and f), respectively; or CDR2 and CDR3 are as defined under e) and 0. respectively. More preferably, in such a 13E02-like sequence, CDR1 , CDR2 and CDR3 are all as defined under d), e) and f) > respectively.
  • CDR 1 , CDR2 and CDR3 are preferably such that the 13E02-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13E02-like ISV has a blocking activity of 0.3 ⁇ g/ml IL- 17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13E02-like ISV has a blocking activity of 4.5 ⁇ g/ml IL- 17F-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 350 nM, more preferably, less than 250 nM, 200 nM or even less, such as less than 175 nM or 150 nM, 140 nM, or 125 nM or even more preferably of less than 1 10 nM and
  • CDR1 is the amino acid sequence AMG (with CDR2 and CDR3 being as defined under e) and f), respectively); and/or CDR2 is the amino acid sequence
  • AISGSGDDTYYADSVKG (with CDR1 and CDR3 being as defined under d) and f), respectively); and/or CDR3 is the amino acid sequence RRGLYYVWDSNDYEN (with CDR1 and CDR2 being as defined under d) and e), respectively).
  • CDR1 is the amino acid sequence AMG and CDR2 is the amino acid sequence AISGSGDDTYYADSVKG (with CDR3 being as defined under f) above); and/or CDR1 is the amino acid sequence AMG and CDR3 is the amino acid sequence RRGLYYVWDSNDYEN (with CDR2 being as defined under e) above); and/or CDR2 is the amino acid sequence AISGSGDDTYYADSVKG and CDR3 is RRGLYYVWDSNDYEN (with CDR1 being as defined under d) above).
  • CDR1, CDR2 and CDR3 are preferably such that the 13E02- like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13E02-like ISV has a blocking activity of 0.3 ⁇ ⁇ ⁇ IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13E02-Iike ISV has a blocking activity of 4.5 ⁇ IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 250 nM, 200 nM or even less, such as less than 175 nM or 150 nM,
  • CDR1 is the amino acid sequence AMG
  • CDR2 is the amino acid sequence AISGSGDDTYYADSVKG
  • CDR3 is the amino acid sequence RRGLYYVWDSNDYEN.
  • the framework sequences may be as further described herein.
  • the framework sequences are such that the framework sequences have at least 80%, such as at least 85%, for example at least 90%, such as at least 95% sequence identity with the framework sequences of 13E02 (which, for example, can be determined by determining the overall degree of sequence identity of a given sequence with the sequence of 13E02 while disregarding the CDR's in the calculation).
  • the combination of CDR's and frameworks present in a given sequence are preferably such that the resulting 13E02-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13E02-like ISV has a blocking activity of 0.3 ⁇ g ml IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13E02-like ISV has a blocking activity of 4.5 ⁇ g/ml IL-17F-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 350 nM, more preferably, less than 250 nM, 200 nM or even less, such as less than 175 nM or 1 0 nM, 140 nM, or 125 nM or even more preferably of less than 1 10 nM and
  • a 13E02-like sequence is an ISV that has at least 70%, such at least 80%, for example at least 85%, such as at least 90% or more than 95% sequence identity with SEQ ID NO: 664.
  • the CDR's may be according to the specifically preferred aspect described above, and may in particularly (but without limitation) be AMG (CDR1 );
  • the combination of CDR's and frameworks present in such a 13E02-like ISV are preferably such that the resulting 13E02-like ISV has a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • the 13E02-like ISV has a blocking activity of 0.3 ⁇ g/ml IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the 13E02-like ISV has a blocking activity of 4.5 ⁇ IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM, more preferably, less than 250 nM, 200 nM or even less, such as less than 175 nM or 150 nM, 140 nM, or 125 nM or even more preferably of less than 110 nM and/or the 13E02-like
  • any 13E02-like sequence may be a humanized and/or sequence optimized sequence, as further described herein.
  • one further embodiment of the invention concerns also a polypeptide comprising
  • CDR2 and CDR3 sequences (i) and (ii) may in total comprise up to four single amino acid deletions, insertions and/or substitutions;
  • polypeptide specifically binds to IL- 17A and/or IL- 17F and wherein preferably the polypeptide specifically binds to IL- 17A with a Kd of less than 50 pM and to IL-17F with a Kd of less than 5 nM.
  • the polypeptide of this embodiment specifically binds to at least one epitope of IL- 17A selected from the amino acids L74, Y85 and N88 of IL-17A.
  • the polypeptide of this embodiment specifically binds to at least three epitopes of IL-17A, e.g. at least to amino acids L74, Y85 and N88 of IL-17A (SEQ ID NO: 839).
  • Prefered is also a polypeptide comprising (iii) a CDR2 having the amino acid sequence AISGSGDDTYYADSVKG; and/or
  • CDR2 and CDR3 sequenes (i) and (ii) may in total comprise up to four single amino acid deletions, insertions and/or substitutions;
  • polypeptide specifically binds to IL-17A and/or IL-17F (preferably each with a Kd of less than 5 nM) but not to any of IL-17B, IL-17C, IL-17D and IL-17E.
  • this polypeptide specifically binds to at least amino acids L74, Y85 and N88 of IL-17A (SEQ ID NO: 839).
  • polypeptides comprising a CDR2 and/or CDR3 sequences can be used and are effective for the treatment of a disease as disclosed herein.
  • a polypeptide of the invention preferably specifically binds to at least three epitopes of IL-17A and/or IL-17F, e.g.
  • Class 1 amino acid sequence an amino acid sequence of the invention (and in
  • ISV as described herein
  • IL- 17A with (at least one of, and most preferably both of) the receptors IL- 17RA or IL- 17RC of the receptor complex, but that is essentially not capable of inhibiting the interaction of IL-17A/F interaction with either of IL- 17RA or IL-17RC.
  • Class 1 amino acid sequences are given in the further description herein (see for example Tables 5-8);
  • Class 2 amino acid sequence an amino acid sequence of the invention (and in
  • Class 2 amino acid sequences are given in the further description herein (see for example Tables 5-8).
  • Some preferred, but non-limiting examples of Class 2 amino acid sequences of the invention are the "04G01-like sequences" (as defined herein), with humanized and/or sequence-optimized variants of 04G01 (see for example Tables 23 and 24) being particularly preferred;
  • Class 3 amino acid sequence an amino acid sequence of the invention (and in particular an ISV as described herein) that is capable of inhibiting the interaction of IL- 17F with (at least one of, and most preferably both of) the receptors IL-17RA or IL-17RC of the receptor complex.
  • Class 3 amino acid sequences of the invention may also be capable of (at least partially) inhibiting the interaction of IL-17A/F with (at least one of, and most preferably both of) the receptors IL-17RA or IL-17RC of the receptor complex.
  • Class 3 amino acid sequences of the invention are the "16A04-like sequences" (as defined herein), with humanized and/or sequence-optimized variants of 16A04 (such as for example IL17MS3063, see Table 30) being particularly preferred.
  • Class 3 amino acid sequences are directed against and/or bind to R47, R73, 186 and/or N89 of hIL-17F, including combinations thereof (see for example Table 1 1);
  • Class 4 amino acid sequence (also referred to herein as a “cross-reactive amino acid sequence” and also indicated with an “X”): an amino acid sequence of the invention (and in particular an ISV as described herein) that is capable of inhibiting the interaction of both IL-17A and IL- 17F, hence including IL- 17A/F, with (at least one of, and most preferably both of) the receptors IL-17RA or IL-17RC of the receptor complex.
  • Class 4 amino acid sequences of the invention are the "13B03-like sequences" (as defined herein) and the “13E02-like sequences” (also as defined herein), with humanized and/or sequence- optimized variants of 13B03 (such as for example IL17MS3068, see e.g. Table 26) and 13E02 (such as for example IL17MS3069 and IL17MS3070, see Table 28), respectively, being particularly preferred.
  • Class 4 amino acid sequences are directed against and/or bind to L74, Y85 and/or N88 of hIL-17A (see for example Table 1 1 ).
  • Class 2 amino acid sequences are more preferred than Class 1 amino acid sequences
  • Class 3 and/or Class 4 amino acid sequences are in turn more preferred than Class 2 amino acid sequences.
  • ISV's of the invention belonging to each of these Classes are given in the examples herein.
  • amino acid sequences of the invention can be used as building blocks to provide the compounds, constructs, proteins and polypeptides of the invention.
  • the invention also makes it possible to combine amino acid sequences of the invention (and in particular ISV's of the invention) that belong to different Classes into a single compound, construct, protein or polypeptide of the invention.
  • such compounds, constructs, proteins or polypeptides of the invention may for example and without limitation comprise or essentially consist of:
  • an amino acid sequence of the invention (and in particular, an ISV of the invention) and one or more (such as one or two) other groups, residues, moieties or binding units (as further described herein, for example a group, residue, moiety or binding unit that increases the half-life of the amino acid sequence of the invention), which are linked to each other either directly or preferably via one or more suitable linkers (as further described herein);
  • a compound, construct, protein or polypeptide of the invention comprises one or more one or more (such as one or two) other groups, residues, moieties or binding units, these are preferably (but without limitation) either (i) one or more other immunoglobulin single variable domains (for example, directed to a target other than IL-17A, IL-17F or IL-17A/F, i.e.
  • a group, residue, moiety or binding unit that increases the half-life of the amino acid sequence(s) of the invention which may for example be a group, residue, moiety or binding unit that is directed to a serum protein such as (human) serum albumin (for example, an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin, as further described herein).
  • a serum protein such as (human) serum albumin (for example, an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin, as further described herein).
  • such compounds, constructs, proteins or polypeptides of the invention may comprise or essentially consist of: An amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 1 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • An amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 2 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • An amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 3 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 4 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • Two amino acid sequences of the invention (and in particular, two ISV's of the invention) both belonging to Class 1 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • Two amino acid sequences of the invention (and in particular, two ISV's of the invention) both belonging to Class 2 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • Two amino acid sequences of the invention (and in particular, two ISV's of the invention) both belonging to Class 3 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • Two amino acid sequences of the invention (and in particular, two ISV's of the invention) both belonging to Class 4 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • An amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 1 (as defined herein), an amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 2 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • An amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 1 (as defined herein), an amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 3 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • An amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 1 (as defined herein), an amino acid sequence of the invention (and in particular, an IS V of the invention) belonging to Class 4 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • An amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 2 (as defined herein), an amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 3 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • An amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 2 (as defined herein), an amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 4 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • An amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 3 (as defined herein), an amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 4 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • one of the compounds, constructs, proteins or polypeptides of the invention comprises a Class 2 sequence
  • it is preferably a 04G01 -like sequence (as defined herein), and more preferably a humanized and/or sequence- optimized variant of 04G01.
  • a further aspect of the invention is a compound, construct, protein or polypeptide of the invention as described herein (and in particular, as described in the preceding paragraphs) that comprises a Class 2 amino acid sequence, wherein said Class
  • 2 amino acid sequence is a 04G01-like sequence (as defined herein), and more preferably a humanized and/or sequence-optimized variant of 04G01.
  • one of the compounds, constructs, proteins or polypeptides of the invention comprises a Class 3 sequence
  • it is preferably a 16A04-like sequence (as defined herein), and more preferably a humanized and/or sequence- optimized variant of 16A04.
  • a further aspect of the invention is a compound, construct, protein or polypeptide of the invention as described herein (and in particular, as described in the preceding paragraphs) that comprises a Class 3 amino acid sequence, wherein said Class
  • 3 amino acid sequence is a 16A04-like sequence (as defined herein), and more preferably a humanized and/or sequence-optimized variant of 16A04.
  • a Class 4 sequence comprises a Class 4 sequence, it is preferably a 13B03-like sequence (as defined herein), and more preferably a humanized and/or sequence- optimized variant of 13B03, or a 13E02-like sequence (as defined herein), and more preferably a humanized and/or sequence-optimized variant of 13E02.
  • a further aspect of the invention is a compound, construct, protein or polypeptide of the invention as described herein (and in particular, as described in the preceding paragraphs) that comprises a Class 4 amino acid sequence, wherein said Class 4 amino acid sequence is a 13B03-like sequence (as defined herein), and more preferably a humanized and/or sequence-optimized variant of 13B03, and/or a 13E02-like sequence (as defined herein), and more preferably a humanized and/or sequence-optimized variant of 13E02.
  • compounds, constructs, proteins or polypeptides of the invention may comprise or essentially consist of:
  • An amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 3 (as defined herein), an amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 4 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • such a compound, construct, protein or polypeptide of the invention preferably comprises a "13B03-like sequence" (as defined herein, and more preferably a humanized and/or sequence-optimized variant of 13B03) or a "13E02-like sequence” (as defined herein, and more preferably a humanized and/or sequence-optimized variant of 13E02) as the Class 4 sequence and a "16A04-like sequence” (as defined herein, and more preferably a humanized and/or sequence-optimized variant of 16A04) as the Class 3 sequence.
  • IL17MS3084 IL17MS3085, IL17MS3086 and IL17MS3087 (see Example 26 and Table 33).
  • Other examples of such/similar compounds, constructs, proteins or polypeptides of the invention will be clear to the skilled person based on the disclosure herein.
  • Two amino acid sequences of the invention (and in particular, two ISV's of the invention) both belonging to Class 4 (as defined herein), and a group, residue, moiety or binding unit that increases the half-life of said amino acid sequence (and preferably an ISV that is directed to a serum protein and in particular to serum albumin, or a peptide that is directed to a serum protein and in particular to serum albumin), optionally suitably linked via one or more suitable linkers.
  • such a compound, construct, protein or polypeptide of the invention preferably comprises two "13B03-like sequences" (as defined herein, and more preferably two humanized and/or sequence-optimized variants of 13B03) , which may be the same or different, or two "13E02-like sequences" (as defined herein, and more preferably a humanized and/or sequence-optimized variant of 13E02), which again may be the same or different, with compounds, constructs, proteins or polypeptides of the invention that comprise or essentially consist of two "13B03-like sequences" being particularly preferred.
  • polypeptide of the invention is IL17MS3079 (see Example 26 and Table 33).
  • Other examples of such/similar compounds, constructs, proteins or polypeptides of the invention will be clear to the skilled person based on the disclosure herein.
  • Some specifically preferred but non-limiting compounds, constructs, proteins or polypeptides of the invention may comprise or essentially consist of:
  • 13B03-like sequences (as defined herein, and more preferably two humanized and/or sequence-optimized variants of 13B03) , which may be the same or different (and are preferably the same) and one ISV against human serum albumin or a peptide directed to human serum albumin, optionally suitably linked via one or more suitable linkers (as described herein);
  • 13B03-like sequence (as defined herein, and more preferably a humanized and/or sequence-optimized variant of 13B03), a "16A04-like sequence” (as defined herein, and more preferably a humanized and/or sequence-optimized variant of 16A04) and one ISV against human serum albumin or a peptide directed to human serum albumin, optionally suitably linked via one or more suitable linkers (as described herein);
  • 13E02-like sequence (as defined herein, and more preferably a humanized and/or sequence-optimized variant of 13E02), a "16A04-like sequence” (as defined herein, and more preferably a humanized and/or sequence-optimized variant of 16A04) and one ISV against human serum albumin or a peptide directed to human serum albumin, optionally suitably linked via one or more suitable linkers (as described herein).
  • the compounds, constructs, proteins or polypeptides of the invention have a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 9.
  • compounds, constructs, proteins or polypeptides of the invention comprising an amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 1 (as defined herein), said compounds, constructs, proteins or polypeptides preferably have a blocking activity of 0.3 g/ml EL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM, 18 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, or 11 nM or even more preferably of less than ⁇ .
  • compounds, constructs, proteins or polypeptides of the invention comprising an amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 2 (as defined herein), said compounds, constructs, proteins or polypeptides preferably have a blocking activity of 0.3 ⁇ IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5nM and/or said compounds, constructs, proteins or polypeptides have a blocking activity of 1.5 ⁇ IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200 nM, 150 nM or
  • compounds, constructs, proteins or polypeptides of the invention comprising an amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 3 (as defined herein), said compounds, constructs, proteins or polypeptides preferably have a blocking activity of 0.3 ⁇ g/ml EL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5nM and/or said compounds, constructs, proteins or polypeptides have a blocking activity of 1.5 ⁇ g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 250 nM, more preferably, less than 200
  • compounds, constructs, proteins or polypeptides of the invention comprising an amino acid sequence of the invention (and in particular, an ISV of the invention) belonging to Class 4 (as defined herein), said compounds, constructs, proteins or polypeptides preferably have a blocking activity of 0.3 ⁇ IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an 1C50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, and/or the said compounds, constructs, proteins or polypeptides have a blocking activity of 4.5 ⁇ IL- 17F-induced IL-6 production in human fibrosarcoma HT- 1080 cells with an IC50 of less than 350 nM, more preferably, less than 250 nM, 200
  • the blocking activity of the compounds, constructs, proteins or polypeptides of the invention which comprise more than one (building block of) Class 1 , 2, 3 or 4 amino acid sequences, can be determined according to any of the assays as described above, wherein said compounds, constructs, proteins or polypeptides of the invention preferably have a blocking activity similarly to the blocking activity of each of its constituents, i.e. a blocking activity similarly to the blocking activity of each of the (building blocks of) Class 1 , 2, 3 or 4 amino acid sequences comprised in said compounds, constructs, proteins or polypeptides of the invention.
  • Some specific but non- limiting examples of the abovementioned preferred compounds, constructs, proteins or polypeptides of the invention are:
  • each 13B03-like sequence is independently chosen from IL17MS3067 or IL17MS3068, and further consists of one ISV against human serum albumin or a peptide directed to human serum albumin (such as Alb-8/Alb-l 1 ); all optionally suitably linked via one or more suitable linkers (as described herein).
  • IL17MS3079 A specific preferred but-non-limiting example of such a polypeptide is IL17MS3079.
  • Compounds, constructs, proteins or polypeptides that consists of a 13B03-like sequence that is independently chosen from IL37MS3067 or IL17MS3068, a 16A04-like sequence that is independently chosen from IL17MS3063 (or IL17MS3063 without the El D substitution) and one ISV against human serum albumin or a peptide directed to human serum albumin (such as Alb-8/Alb-l l ), optionally suitably linked via one or more suitable linkers (as described herein).
  • Specific preferred but-non-limiting examples of such polypeptides are IL17MS3084 and IL17MS3085.
  • Compounds, constructs, proteins or polypeptides that consists of a 13E02-like sequence that is independently chosen from IL17MS3069 or IL17MS3070, a 16A04-like sequence that is independently chosen from 1L17MS3063 (or 1L17MS3063 without the E1D substitution) and one ISV against human serum albumin or a peptide directed to human serum albumin (such as Alb-8/Alb-l 1), optionally suitably linked via one or more suitable linkers (as described herein).
  • Specific preferred but-non-limiting examples of such polypeptides are IL17MS3086, IL17MS3087 and IL17MS3091.
  • Compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with BL17MS3079 are preferred.
  • the compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3079 have a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT- 1080 cell based assay, for instance, such as described in Example 26.
  • said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3079 have a blocking activity of InM IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, such as 4 nM, 3 nM, 2 nM or even less than 1 nM and/or said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least
  • the compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3084 have a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 26.
  • said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3084 have a blocking activity of InM IL-17A-induced 1L-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, such as 4 nM, 3 nM, 2 nM or even less than 1 nM and/or said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90%
  • the compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3085 have a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 26.
  • said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3085 have a blocking activity of I nM BL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less than 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, such as 4 nM, 3 nM, 2 nM or even less than 1 nM and/or said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at
  • the compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3086 have a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein), Kinetic Exclusion Assay "KinExA” technology (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 26.
  • said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3086 have a blocking activity of 1 nM IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells with an
  • the binding activity is determined by a KinExAtechnology based assay, for instance, such as described in Example 29.
  • said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3086 (i.e.
  • IL17MS3091 excluding the tag of IL17MS3091 ) have a equilibrium dissociation constant (Kd) in solution with hIL- 17A of less than 50 pM, more preferably, less than 40 pM, 30 pM or even less, such as less than 20 pM or 15 pM, 10 pM, 9 pM, 8 pM, 7 pM or 6 pM or even more preferably of less than 5 pM, such as 4 pM, 3 pM, 2 pM or even less than 1 pM, such as less than 0.5 pM and/or said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with
  • IL17MS3086 (i.e. excluding the tag of IL17MS3091 ) have a equilibrium dissociation constant (Kd) in solution with hIL-17F of less than 100 pM, more preferably, less than 80 pM, 60 pM or even less, such as less than 50 pM, 40 pM, 30 pM, 20 pM or 15 pM, 10 pM, 9 pM, 8 pM, 7 pM or 6 pM or even more preferably of less than 5 pM, such as 4 pM, or 3 pM or even less than 2 pM, such as less than 1.5 pM.
  • Kd equilibrium dissociation constant
  • Compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3087 are preferred.
  • the compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3087 have a blocking activity, which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by means of Alphascreen assays (e.g. such as described herein) or by cell based assays (e.g. such as described herein).
  • the blocking activity is determined by a HT-1080 cell based assay, for instance, such as described in Example 26.
  • said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90% sequence identity (as defined herein) with IL17MS3087 have a blocking activity of InM IL-17A-induced EL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more preferably, less man 100 nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM, such as 4 nM, 3 nM, 2 nM or even less than 1 nM and/or said compounds, constructs, proteins or polypeptides that have at least 80%, such as at least 85%, preferably at least 90%
  • the efficacy of the amino acid sequences and polypeptides of the invention, and of compositions comprising the same, can be tested using any suitable in vitro assay, cell-based assay, in vivo assay and/or animal model known per se, or any combination thereof, depending on the specific disease or disorder involved.
  • suitable assays and animal models will be clear to the skilled person, and for example include e.g. AlphaScreen, inExA and Inhibition of IL-17A; -F; -A/F-induced IL-6 production in human fibrosarcoma HT-1080 cells (see experimental part), as well as the assays and animal models used in the
  • amino acid sequences and polypeptides that are directed against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof from a first species of warm-blooded animal may or may not show cross-reactivity with any of IL- 17 A, IL-17F and/or IL-17A/F including combinations thereof from one or more other species of warm-blooded animal.
  • amino acid sequences and polypeptides directed against human any of IL- 17A, IL-17F and/or IL- 17A/F including combinations thereof may or may not show cross reactivity with any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof from one or more other species of primates (such as, without limitation, monkeys from the genus Macaco, (such as, and in particular, cynomolgus monkeys (Macaca fascicularis) and/or rhesus monkeys (Macaca mulatto) and baboon (Papio ursinus)) and/or with any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof from one or more species of animals that are often used in animal models for diseases (for example mouse, rat, rabbit, pig or dog), and in particular in animal models for diseases and disorders associated with any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof (such
  • amino acid sequences and polypeptides of the invention that are cross-reactive with any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof from multiple species of mammal will usually be advantageous for use in veterinary applications, since it will allow the same amino acid sequence or polypeptide to be used across multiple species.
  • amino acid sequences and polypeptides directed against any of IL-17A, IL-17F and/or IL- 17A/F including combinations thereof from one species of animal can be used in the treatment of another species of animal, as long as the use of the amino acid sequences and/or polypeptides provide the desired effects in the species to be treated.
  • the present invention is in its broadest sense also not particularly limited to or defined by a specific antigenic determinant, epitope, part, domain, subunit or confirmation (where applicable) of any of 1L-17A, IL-17F and/or 1L-17A/F including combinations thereof against which the amino acid sequences and polypeptides of the invention are directed.
  • the amino acid sequences and polypeptides may or may not be directed against an
  • interaction site (as defined herein).
  • the amino acid sequences and polypeptides of the invention are preferably directed against an interaction site (as defined herein), and in particular against an epitope or similar epitopes on any of IL-17A, IL-17F and/or IL-17A/F that allows blocking of a biological response by a single or bi-specific binding unit (see also the different Classes of indentified binding molecules of the invention in the experimental part (e.g. Table 1 ).
  • amino acid sequences and polypeptides of the invention are directed against an epitope that allows binding and/or blocking a biological response to IL- 17A, IL- 17F and IL-17A/F, and are as further defined herein.
  • a polypeptide of the invention may contain two or more amino acid sequences of the invention (and preferably ISV's), wherein at least one amino acid sequence of the invention (preferably an ISV) is directed against or binds to the amino acid(s) L74, Y85 and/or N88 of hIL-17A (SEQ ID NO: 839), and/or wherein at least one amino acid sequence of the invention (preferably an ISV) is directed against or binds to the amino acid(s) R47, R73, 186 and/or N89 of hIL-17F (SEQ ID NO: 840), including combinations thereof.
  • the present invention relates to an amino acid sequence according to the invention, wherein the amino acid sequence is directed against and/or that can specifically bind to human IL- 17 A and IL- 17A/F (Class 2), wherein the amino acid sequence binds to a L74A, a Y85A and/or a H54A IL-17A mutant with significantly reduced affinity as compared to binding to the wildtype IL-17A sequence.
  • Class 2 human IL- 17 A and IL- 17A/F
  • the present invention relates to an amino acid sequence according to the invention, wherein said amino acid sequence is directed against and/or that can specifically bind to human IL-17A, IL-17F and IL-17A/F (Class 4), wherein the amino acid sequence binds to a L74A, a Y85A and/or a N88A IL-17A mutant with significantly reduced affinity as compared to binding to the wildtype IL-17A sequence.
  • the present invention relates to an amino acid sequence according to the invention, wherein said amino acid sequence is directed against and/or that can specifically bind to human IL17F and wherein the amino acid sequence binds to a R47A or R73A or I86A or N89A IL-17F mutant with significantly reduced affinity as compared to binding to the wildtype IL-17F sequence.
  • significantly reduced affinity means an affinity which is lower than the reference affinity.
  • significantly reduced affinity means that the affinity is lower by a factor of at least 1.1 , 1.2, 1.3, 1.4, 1.5, 2, 3, 5, 10, 20, 30, 40, 50 or by a factor of at least 100 compared to the reference affinity as indicated.
  • a polypeptide of the invention may contain two or more amino acid sequences of the invention (and preferably ISV's) that are directed against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
  • polypeptides will bind to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof with increased avidity compared to a single amino acid sequence of the invention (for instance, as determined by KinExA technology as described in Example 22).
  • Such a polypeptide may, for example, comprise two amino acid sequences of the invention that are directed against the same antigenic determinant, epitope, part, domain, subunit or
  • At least one amino acid sequence of the invention is directed against an interaction site (as defined herein), although the invention in its broadest sense is not limited thereto.
  • the amino acid sequences and polypeptides may be such that they compete with the cognate binding partner (e.g. the ligand, receptor or other binding partner, as applicable) for binding to the target, and/or such that they (fully or partially) neutralize binding of the binding partner to the target.
  • the cognate binding partner e.g. the ligand, receptor or other binding partner, as applicable
  • an amino acid sequence of the invention can bind to two or more antigenic determinants, epitopes, parts, domains, subunits or confirmations of any of IL-17A, IL-17F and/or 1L-17A/F including combinations thereof.
  • the antigenic determinants, epitopes, parts, domains or subunits of any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof to which the amino acid sequences and/or polypeptides of the invention bind may be essentially the same (for example, if any of IL-17A, IL-17F and or IL-17A/F including combinations thereof contains repeated structural motifs or occurs in a multimeric form) or may be different (and in the latter case, the amino acid sequences and polypeptides of the invention may bind to such different antigenic determinants, epitopes, parts, domains, subunits of any of IL-17A, IL- 17F and/or IL-17A/F including combinations thereof with an affinity and/or specificity which may be the same or different).
  • amino acid sequences and polypeptides of the invention will generally bind to all naturally occurring or synthetic analogs, variants, mutants, alleles, parts and fragments of any of IL-17A, IL- 17F and/or IL-17A/F including combinations thereof; or at least to those analogs, variants, mutants, alleles, parts and fragments of any of IL-17A, IL-17F and/or IL- 17A/F including combinations thereof that contain one or more antigenic determinants or epitopes that are essentially the same as the antigenic
  • amino acid sequences and polypeptides of the invention may bind to such analogs, variants, mutants, alleles, parts and fragments with an affinity and/or specificity that are the same as, or that are different from (i.e.
  • the affinity and specificity with which the amino acid sequences of the invention bind to wild- type
  • any of IL- 17A, IL- 17F and/or IL-17A/F including combinations thereof. It is also included within the scope of the invention that the amino acid sequences and polypeptides of the invention bind to some analogs, variants, mutants, alleles, parts and fragments of any of IL- 17A, IL-17F and/or IL-17A/F including combinations thereof, but not to others.
  • proteins or polypeptides that contain two or more amino acid sequences (and preferably ISV's) directed against any of IL-17A, IL- 17F and/or IL-17A/F including combinations thereof may bind with higher avidity to any of IL- 17A, IL- 17F and/or IL- 17A/F including combinations thereof than the corresponding monomeric amino acid sequence(s).
  • proteins or polypeptides that contain two or more amino acid sequences directed against different epitopes of any of IL- 17A, IL-17F and/or IL-17A/F including combinations thereof may (and usually will) bind with higher avidity than each of the different monomers, and proteins or polypeptides that contain two or more amino acid sequences directed against any of IL-17A, IL- 17F and/or IL- 17A F including combinations thereof may (and usually will) bind also with higher avidity to a multimer of any of IL- 17A, IL- 17F and/or IL- 17A/F including combinations thereof.
  • amino acid sequences and polypeptides of the invention will at least bind to those forms of any of IL- 17A, IL-17F and/or 1L-17A/F including combinations thereof (including monomeric, multimeric and associated forms) that are the most relevant from a biological and/or therapeutic point of view, as will be clear to the skilled person.
  • Such parts, fragments, analogs, mutants, variants, alleles and/or derivatives will usually contain (at least part of) a functional antigen-binding site for binding against any of IL- 17A, IL-17F and/or IL- 17A/F including combinations thereof; and more preferably will be capable of specific binding to any of IL- 17 A, IL-17F and/or IL-17A/F including combinations thereof, and even more preferably capable of binding to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof with an affinity (suitably measured and/or expressed as a Ko-value (actual or apparent), a KA- value (actual or apparent), a koflect-rate and/or a k 0 ff-rate, or alternatively as an IC50 value, as further described herein) that is as defined herein.
  • a functional antigen-binding site for binding against any of IL- 17A, IL-17F and/or IL- 17A/F including
  • fragments or polypeptides of the invention may also be provided by suitably combining (i.e. by linking or genetic fusion) one or more (smaller) parts or fragments as described herein.
  • the amino acid sequence of the invention is an ISV
  • such a part, fragment, analog, mutant, variant, allele and/or derivative may be a part, fragment, analog, mutant, variant, allele and/or derivative of such an ISV.
  • analogs, mutants, variants, alleles, derivatives have an increased half- life in serum (as further described herein) compared to the amino acid sequence from which they have been derived.
  • an amino acid sequence of the invention may be linked (chemically or otherwise) to one or more groups or moieties that extend the half-life (such as PEG), so as to provide a derivative of an amino acid sequence of the invention with increased half-life.
  • the amino acid sequence of the invention may be an amino acid sequence that comprises an immunoglobulin fold or may be an amino acid sequence that, under suitable conditions (such as physiological conditions) is capable of forming an immunoglobulin fold (i.e. by folding).
  • suitable conditions such as physiological conditions
  • such an amino acid sequence when properly folded so as to form an immunoglobulin fold, is capable of specific binding (as defined herein) to any of IL-17A, IL- 17F and/or IL-17A/F including combinations thereof; and more preferably capable of binding to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof with an affinity (suitably measured and/or expressed as a Ko-value (actual or apparent), a K A -value (actual or apparent), a l rate and/or a k 0f rrate, or alternatively as an IC50 value, as further described herein) that is as defined herein.
  • parts, fragments, analogs, mutants, variants, alleles and/or derivatives of such amino acid sequences are preferably such that they comprise an immunoglobulin fold or are capable for forming, under suitable conditions, an immunoglobulin fold.
  • amino acid sequences of the invention may be amino acid sequences that essentially consist of 4 framework regions (FR1 to FR4 respectively) and 3 complementarity determining regions (CDR1 to CDR3 respectively); or any suitable fragment of such an amino acid sequence (which will then usually contain at least some of the amino acid residues that form at least one of the CDR's, as further described herein).
  • the amino acid sequences of the invention may in particular be an immunoglobulin sequence or a suitable fragment thereof, and more in particular be an immunoglobulin variable domain sequence or a suitable fragment thereof, such as light chain variable domain sequence (e.g. a VL-sequence) or a suitable fragment thereof; or a heavy chain variable domain sequence (e.g. a Vn-sequence) or a suitable fragment thereof.
  • an immunoglobulin variable domain sequence or a suitable fragment thereof such as light chain variable domain sequence (e.g. a VL-sequence) or a suitable fragment thereof; or a heavy chain variable domain sequence (e.g. a Vn-sequence) or a suitable fragment thereof.
  • the amino acid sequence of the invention when it is a heavy chain variable domain sequence, it may be a heavy chain variable domain sequence that is derived from a conventional four-chain antibody (such as, without limitation, a VH sequence that is derived from a human antibody) or be a so-called Vm-sequence (as defined herein) that is derived from a so-called “heavy chain antibody” (as defined herein).
  • a conventional four-chain antibody such as, without limitation, a VH sequence that is derived from a human antibody
  • Vm-sequence as defined herein
  • the invention is not limited as to the origin of the amino acid sequence (or ISV) of the invention (or of the nucleotide sequence of the invention used to express it), or as to the way that the amino acid sequence or nucleotide sequence of the invention is (or has been) generated or obtained.
  • the amino acid sequences of the invention may be naturally occurring amino acid sequences (from any suitable species) or synthetic or semi-synthetic amino acid sequences.
  • the amino acid sequence is a naturally occurring immunoglobulin sequence (from any suitable species) or a synthetic or semi-synthetic immunoglobulin sequence, including but not limited to "humanized” (as defined herein) immunoglobulin sequences (such as partially or fully humanized mouse or rabbit immunoglobulin sequences, and in particular partially or fully humanized VHH sequences or Nanobodies), "camelized” (as defined herein) immunoglobulin sequences, as well as immunoglobulin sequences that have been obtained by techniques such as affinity maturation (for example, starting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, veneering, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing.
  • affinity maturation for example, starting from synthetic, random or naturally occurring immunoglobulin sequences
  • CDR grafting veneering
  • nucleotide sequences of the invention may be naturally occurring nucleotide sequences or synthetic or semi-synthetic sequences, and may for example be sequences that are isolated by PCR from a suitable naturally occurring template (e.g. DNA or RNA isolated from a cell), nucleotide sequences that have been isolated from a library (and in particular, an expression library), nucleotide sequences that have been prepared by introducing mutations into a naturally occurring nucleotide sequence (using any suitable technique known per se, such as mismatch PCR), nucleotide sequence that have been prepared by PCR using overlapping primers, or nucleotide sequences that have been prepared using techniques for DNA synthesis known per se.
  • a suitable naturally occurring template e.g. DNA or RNA isolated from a cell
  • nucleotide sequences that have been isolated from a library and in particular, an expression library
  • nucleotide sequences that have been prepared by introducing mutations into a naturally occurring nucleotide sequence using any suitable
  • amino acid sequences of the invention are preferably
  • immunoglobulin single variable domains by which is meant an immunoglobulin variable domain that comprises a functional antigen binding (in the sense that it does not require an interaction with another immunoglobulin variable domain - such as a VH-VL interaction - to form a functional antigen binding site).
  • the amino acid sequence of the invention may in particular be a domain antibody (or an amino acid sequence that is suitable for use as a domain antibody), a single domain antibody (or an amino acid sequence that is suitable for use as a single domain antibody), a "dAb” (or an amino acid sequence that is suitable for use as a dAb) or a NanobodyTM (as defined herein, and including but not limited to a VHH sequence); other single variable domains, or any suitable fragment of any one thereof.
  • dAb or an amino acid sequence that is suitable for use as a dAb
  • NanobodyTM as defined herein, and including but not limited to a VHH sequence
  • Domantis Ltd although less preferred in the context of the present invention because they are not of mammalian origin, single domain antibodies or single variable domains can be derived from certain species of shark (for example, the so- called "IgNAR domains", see for example WO 05/18629).
  • the amino acid sequence of the invention may be a Nanobody® (as defined herein) or a suitable fragment thereof.
  • Nanobody®, Nanobodies® and Nanoclone® are registered trademarks ofAblyiuc N.V.
  • Such Nanobodies directed against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof will also be referred to herein as "Nanobodies of the invention”.
  • Nanobodies of the so-called "VH3 class” i.e. Nanobodies with a high degree of sequence homology to human germline sequences of the VH3 class such as DP-47, DP-51 or DP-29
  • VH3 class i.e. Nanobodies with a high degree of sequence homology to human germline sequences of the VH3 class such as DP-47, DP-51 or DP-29
  • the invention in its broadest sense generally covers any type of Nanobody directed against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof, and for example also covers the Nanobodies belonging to the so-called "VH4 class" (i.e. Nanobodies with a high degree of sequence homology to human germline sequences of the VH4 class such as DP-78), as for example described in WO
  • VH4 class i.e. Nanobodies with a high degree of sequence homology to human germline sequences of the VH4 class such as DP-78
  • Nanobodies in particular VHH sequences and partially humanized
  • Nanobodies can in particular be characterized by the presence of one or more "Hallmark residues" (as described herein) in one or more of the framework sequences (again as further described herein).
  • Nanobody can be defined as an amino acid sequence with the (general) structure
  • FR1 to FR4 refer to framework regions 1 to 4, respectively, and in which CDR 1 to CDR3 refer to the complementarity determining regions 1 to 3, respectively, and in which one or more of the Hallmark residues are as further defined herein.
  • a Nanobody can be an amino acid sequence with the (general) structure FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4
  • FR1 to FR4 refer to framework regions 1 to 4, respectively, and in which CDR1 to CDR3 refer to the complementarity determining regions 1 to 3, respectively, and in which the framework sequences are as further defined herein.
  • Nanobody can be an amino acid sequence with the (general) structure
  • FRl to FR4 refer to framework regions 1 to 4, respectively, and in which CDR1 to CDR3 refer to the complementarity determining regions I to 3, respectively, and in which: i) preferably one or more of the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the abat numbering are chosen from the Hallmark residues mentioned in Table B-2 below;
  • said amino acid sequence has at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 1 to 22, in which for the purposes of determining the degree of amino acid identity, the amino acid residues that form the CDR sequences (indicated with X in the sequences of SEQ ID NOs: 1 to 22) are disregarded.
  • the CDR sequences are generally as further defined herein.
  • the invention also relates to such Nanobodies that can bind to (as defined herein) and/or are directed against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof, to suitable fragments thereof, as well as to polypeptides that comprise or essentially consist of one or more of such Nanobodies and/or suitable fragments.
  • SEQ ID NOs: 623 to 693 (see Table A-l) give the amino acid sequences of a number of VHH sequences that have been raised against any of IL- 17A, IL-17F and/or IL-17A/F including combinations thereof.
  • Table A-l Preferred VHH sequences or Nanobodv sequences (also referred herein as a sequence with a particular name or SEP ID NO: X. wherein X is a number referring to the relevant amino acid sequence): Name Properties SEQ ID NO: X, Amino acid sequence
  • Anti-IL-17A AVYYCAAEIGYYSGGTYYSSEAHWGQGTQ
  • AMGWLRQAPGKEREFVAAISGSGDDTYYA Anti-IL-17A DSVKGRFTISKDNAGITMYLEMNSLKPEDTA IL-17F and IL- VYYCATRRGRYYVWDSNDYENWGQGTQV
  • AMGWLRQAPGKEREFVAAISGSGDDTYYA Anti-IL-17A DSVKGRFTISKDNAGITMYLQMNSLKPEDT IL-17F and IL- AVYYCATRRGLYYVWDSNDYENWGQGTQ
  • AMGWLRQAPGKEREFVAAVSGSGDDTYYA Anti-IL-17A DSVKGRFTISKDNAGITMYLQMNSLKPEDT IL-17F and IL- AVYYCATRRGLYYVWDSNDYENWGQGTQ
  • AMGWFRQAPGKEREFVAAISGSGEDTYYAD Anti-IL-17A SVKGRFTCSKDNAKDTMYLQMNSLKPEDT IL-17F and IL- AVYYCATRRGLYFITDSNDYENWGQGTQV
  • VFAMRWFRQAPG EREFVAGISWTGGTTY Anti-IL-17A, YADSVKGRFTMSADNAKNTVYLQMNSLKP IL-17F and IL- EDTAVYYCAVDVGGGSDRYLGQGTQVTVSE02 17A/F 692 S
  • the invention in some specific aspects provides:
  • IL- 17A, IL- 17F and/or IL-17A/F including combinations thereof and that have at least 80%, preferably at least 85%, such as 90% or 95% or more sequence identity with at least one of the amino acid sequences of SEQ ID NOs: 623 to 693 (see
  • amino acid sequences may further be such that they neutralize binding of the cognate ligand to any of IL- 17A, IL-17F and/or DL- 17A/F including combinations thereof; and/or compete with the cognate ligand for binding to any of IL- 17 A, IL- 17F and/or DL-17A/F including combinations thereof; and/or are directed against an interaction site (as defined herein) on any of IL-17A, IL-17F and/or IL-
  • amino acid sequences may further be such that they neutralize binding of the cognate ligand to any of IL- 17A, IL- 17F and/or IL-17A/F including combinations thereof; and/or compete with the cognate ligand for binding to any of IL- 17A, IL- 17F and/or IL- 17A/F including combinations thereof; and/or are directed against an interaction site (as defined herein) on any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof (such as the ligand binding site);
  • amino acid sequences may be as further described herein (and may for example be Nanobodies); as well as polypeptides of the invention that comprise one or more of such amino acid sequences (which may be as further described herein, and may for example be bispecific and/or biparatopic polypeptides as described herein), and nucleic acid sequences that encode such amino acid sequences and polypeptides.
  • amino acid sequences and polypeptides do not include any naturally occurring ligands.
  • the invention provides: - amino acid sequences (and in particular, ISV's) of the invention that are specific for any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof compared to IL-17B, IL-17C, IL- 17D, and/or IL- 17E;
  • amino acid sequences of the invention may be as further described herein (and may for example be Nanobodies); as well as polypeptides of the invention that comprise one or more of such amino acid sequences (which may be as further described herein, and may for example be bispecific and/or biparatopic polypeptides as described herein), and nucleic acid sequences that encode such amino acid sequences and polypeptides.
  • amino acid sequences and polypeptides do not include any naturally occurring ligands.
  • Nanobodies of the invention are Nanobodies which can bind (as further defined herein) to and/or are directed against to any of IL-17A, IL- 17F and/or IL-17A/F including combinations thereof and which:
  • i) have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 623 to 693 (see Table A-l), in which for the purposes of determining the degree of amino acid identity, the amino acid residues that form the CDR sequences are disregarded.
  • Table B- l lists the framework 1 sequences (SEQ ID NOs: 126 to 196), framework 2 sequences (SEQ ID NOs: 268 to 338) framework 3 sequences (SEQ ID NOs: 410 to 480) and framework 4 sequences (SEQ ID NOs: 552 to 622) of the Nanobodies of SEQ ID NOs: 623 to 693
  • ii) preferably one or more of the amino acid residues at positions 1 1 , 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the abat numbering are chosen from the Hallmark residues mentioned in Table B-2 below.
  • the CDR sequences are generally as further defined herein.
  • Nanobodies may be derived in any suitable manner and from any suitable source, and may for example be naturally occurring VHH sequences (i.e. from a suitable species of Camelid) or synthetic or semi-synthetic amino acid sequences, including but not limited to "humanized” (as defined herein) Nanobodies, “camelized” (as defined herein) immunoglobulin sequences (and in particular camelized heavy chain variable domain sequences), as well as Nanobodies that have been obtained by techniques such as affinity maturation (for example, starting from synthetic, random or naturally occurring
  • Nanobody comprises a VHH sequence
  • said Nanobody may be suitably humanized, as further described herein, so as to provide one or more further (partially or fully) humanized
  • Nanobodies of the invention when a Nanobody comprises a synthetic or semisynthetic sequence (such as a partially humanized sequence), said Nanobody may optionally be further suitably humanized, again as described herein, again so as to provide one or more further (partially or fully) humanized Nanobodies of the invention.
  • a synthetic or semisynthetic sequence such as a partially humanized sequence
  • said Nanobody may optionally be further suitably humanized, again as described herein, again so as to provide one or more further (partially or fully) humanized Nanobodies of the invention.
  • humanized Nanobodies may be amino acid sequences that are as generally defined for Nanobodies in the previous paragraphs, but in which at least one amino acid residue is present (and in particular, in at least one of the framework residues) that is and/or that corresponds to a humanizing substitution (as defined herein).
  • a humanizing substitution as defined herein.
  • Nanobody may be partially humanized or fully humanized.
  • Nanobodies which can bind (as further defined herein) to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof and which:
  • i) are a humanized variant of one of the amino acid sequences of SEQ ID NOs: 623 to 693 (see Table A-l ); and/or
  • ii) have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 623 to 693 (see Table A-l), in which for the purposes of determining the degree of amino acid identity, the amino acid residues that form the CDR sequences are disregarded;
  • the invention provides a number of stretches of amino acid residues (i.e. small peptides) that are particularly suited for binding to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
  • These stretches of amino acid residues may be present in, and/or may be incorporated into, an amino acid sequence of the invention, in particular in such a way that they form (part of) the antigen binding site of an amino acid sequence of the invention.
  • CDR sequences As these stretches of amino acid residues were first generated as CDR sequences of heavy chain antibodies or VHH sequences that were raised against any of IL- 17A, IL- 17F and/or IL- 17A/F including combinations thereof (or may be based on and/or derived from such CDR sequences, as further described herein), they will also generally be referred to herein as "CDR sequences" (i.e. as CDR1 sequences, CDR2 sequences and CDR3 sequences, respectively).
  • the invention in its broadest sense is not limited to a specific structural role or function that these stretches of amino acid residues may have in an amino acid sequence of the invention, as long as these stretches of amino acid residues allow the amino acid sequence of the invention to bind to any of IL-17A, IL- 17F and/or IL-17A/F including combinations thereof.
  • the invention in its broadest sense comprises any amino acid sequence that is capable of binding to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof and that comprises one or more CDR sequences as described herein, and in particular a suitable combination of two or more such CDR sequences, that are suitably linked to each other via one or more further amino acid sequences, such that the entire amino acid sequence forms a binding domain and/or binding unit that is capable of binding to any of IL-17A, EL-17F and/or IL-17A/F including combinations thereof.
  • the amino acid sequence (or ISV) of the invention may be an amino acid sequence that comprises at least one amino acid sequence that is chosen from the group consisting of the CDRI sequences, CDR2 sequences and CDR3 sequences that are described herein (or any suitable combination thereof).
  • an amino acid sequence of the invention may be an amino acid sequence that comprises at least one antigen binding site, wherein said antigen binding site comprises at least one amino acid sequence that is chosen from the group consisting of the CDRI sequences, CDR2 sequences and CDR3 sequences that are described herein (or any suitable combination thereof).
  • the amino acid sequence (or ISV) of the invention may be any amino acid sequence that comprises at least one stretch of amino acid residues, in which said stretch of amino acid residues has an amino acid sequence that corresponds to the sequence of at least one of the CDR sequences described herein.
  • Such an amino acid sequence may or may not comprise an immunoglobulin fold.
  • such an amino acid sequence may be a suitable fragment of an amino acid sequence
  • Such an amino acid sequence may be a suitable "protein scaffold” that comprises least one stretch of amino acid residues that corresponds to such a CDR sequence (i.e. as part of its antigen binding site).
  • suitable scaffolds for presenting amino acid sequences will be clear to the skilled person, and for example comprise, without limitation, to binding scaffolds based on or derived from immunoglobulins (i.e.
  • protein scaffolds derived from protein A domains such as AffibodiesTM
  • tendamistat fibronectin
  • lipocalin CTLA-4
  • T-cell receptors designed ankyrin repeats
  • avimers and PDZ domains binding moieties based on DNA or RNA including but not limited to DNA or RNA aptamers
  • any amino acid sequence (or ISV) of the invention that comprises one or more of these CDR sequences is preferably such that it can specifically bind (as defined herein) to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof, and more in particular such that it can bind to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof with an affinity (suitably measured and/or expressed as a D -value (actual or apparent), a K.A-value (actual or apparent), a l rate and/or a koff-rate, or alternatively as an IC 5 o value, as further described herein), that is as defined herein.
  • the amino acid sequences according to this aspect of the invention may be any amino acid sequence (or ISV) that comprises at least one antigen binding site, wherein said antigen binding site comprises at least two amino acid sequences that are chosen from the group consisting of the CDR1 sequences described herein, the CDR2 sequences described herein and the CDR3 sequences described herein, such that (i) when the first amino acid sequence is chosen from the CDR1 sequences described herein, the second amino acid sequence is chosen from the CDR2 sequences described herein or the CDR3 sequences described herein; (ii) when the first amino acid sequence is chosen from the CDR2 sequences described herein, the second amino acid sequence is chosen from the CDR1 sequences described herein or the CDR3 sequences described herein; or (iii) when the first amino acid sequence is chosen from the CDR3 sequences described herein, the second amino acid sequence is chosen from the CDR1 sequences described herein or the CDR3 sequences described herein.
  • the amino acid sequences of the invention may be amino acid sequences (or ISV's) that comprise at least one antigen binding site, wherein said antigen binding site comprises at least three amino acid sequences that are chosen from the group consisting of the CDR1 sequences described herein, the CDR2 sequences described herein and the CDR3 sequences described herein, such that the first amino acid sequence is chosen from the CDR1 sequences described herein, the second amino acid sequence is chosen from the CDR2 sequences described herein, and the third amino acid sequence is chosen from the CDR3 sequences described herein.
  • Preferred combinations of CDR1 , CDR2 and CDR3 sequences will become clear from the further description herein.
  • such an amino acid sequence is preferably an immunoglobulin sequence (as further described herein), but it may for example also be any other amino acid sequence that comprises a suitable scaffold for presenting said CDR sequences.
  • the invention relates to an amino acid sequence (and in particular, an ISV) directed against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof, that comprises one or more stretches of amino acid residues chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ;
  • amino acid sequence (or ISV) of the invention contains one or more amino acid sequences according to b) and/or c):
  • any amino acid substitution in such an amino acid sequence according to b) and/or c) is preferably, and compared to the corresponding amino acid sequence according to a), a conservative amino acid substitution, (as defined herein);
  • the amino acid sequence according to b) and/or c) preferably only contains amino acid substitutions, and no amino acid deletions or insertions, compared to the corresponding amino acid sequence according to a);
  • the amino acid sequence according to b) and/or c) may be an amino acid sequence that is derived from an amino acid sequence according to a) by means of affinity maturation using one or more techniques of affinity maturation known per se.
  • amino acid sequence of the invention contains one or more amino acid sequences according to e) and/or f):
  • any amino acid substitution in such an amino acid sequence according to e) and/or f) is preferably, and compared to the corresponding amino acid sequence according to d), a conservative amino acid substitution, (as defined herein);
  • the amino acid sequence according to e) and/or f) preferably only contains amino acid substitutions, and no amino acid deletions or insertions, compared to the corresponding amino acid sequence according to d);
  • the amino acid sequence according to e) and/or f) may be an amino acid sequence that is derived from an amino acid sequence according to d) by means of affinity maturation using one or more techniques of affinity maturation known per se.
  • an amino acid sequence of the invention contains one or more amino acid sequences according to h) and/or i):
  • any amino acid substitution in such an amino acid sequence according to h) and/or i) is preferably, and compared to the corresponding amino acid sequence according to g), a conservative amino acid substitution, (as defined herein);
  • amino acid sequence according to h) and/or i) preferably only contains amino acid substitutions, and no amino acid deletions or insertions, compared to the corresponding amino acid sequence according to g);
  • the amino acid sequence according to h) and or i) may be an amino acid sequence that is derived from an amino acid sequence according to g) by means of affinity maturation using one or more techniques of affinity maturation known per se.
  • amino acid sequence preferably comprises one or more stretches of amino acid residues chosen from the group consisting of:
  • At least one of said stretches of amino acid residues forms part of the antigen binding site for binding against any of IL-17A, IL-17F and/or IL-17A/F, including combinations thereof.
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • amino acid sequences of SEQ ID NOs: 339 to 409 d) the amino acid sequences of SEQ ID NOs: 339 to 409; e) amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ;
  • the amino acid sequence preferably comprises two or more stretches of amino acid residues chosen from the group consisting of:
  • the at least two stretches of amino acid residues again preferably form part of the antigen binding site for binding against any of IL-17 A, IL- 17F and/or IL-17A/F including combinations thereof.
  • the invention relates to an amino acid sequence (or ISV) directed against any of IL-17A, IL-17F and/or IL- 17A/F including combinations thereof, that comprises three or more stretches of amino acid residues, in which the first stretch of amino acid residues is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • the second stretch of amino acid residues is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551.
  • the first stretch of amino acid residues is chosen from the group consisting of the amino acid sequences of SEQ ID NOs: 197 to 267; the second stretch of amino acid residues is chosen from the group consisting of the amino acid sequences of SEQ ID NOs: 339 to 409; and the third stretch of amino acid residues is chosen from the group consisting of the amino acid sequences of SEQ ID NOs: 481 to 551.
  • the at least three stretches of amino acid residues forms part of the antigen binding site for binding against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
  • the CDR sequences have at least 70% amino acid identity, preferably at least 80% amino acid identity, more preferably at least 90% amino acid identity, such as 95% amino acid identity or more or even essentially 100% amino acid identity with the CDR sequences of at least one of the amino acid sequences of SEQ ID NOs: 623 to 693 (see Table A-l ).
  • This degree of amino acid identity can for example be determined by determining the degree of amino acid identity (in a manner described herein) between said amino acid sequence and one or more of the sequences of SEQ ID NOs: 623 to 693 (see Table A-l), in which the amino acid residues that form the framework regions are disregarded.
  • amino acid sequences of the invention can be as further described herein.
  • amino acid sequences are preferably such that they can specifically bind (as defined herein) to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof; and more in particular bind to any of IL-17A, IL-17F and/or IL- 17A/F including combinations thereof with an affinity (suitably measured and/or expressed as a o-vaJue (actual or apparent), a A - value (actual or apparent), a l rate and/or a karate, or alternatively as an IC 5 o value, as further described herein) that is as defined herein.
  • affinity suitably measured and/or expressed as a o-vaJue (actual or apparent), a A - value (actual or apparent), a l rate and/or a karate, or alternatively as an IC 5 o value, as further described herein
  • amino acid sequence (or ISV) of the invention essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR I to CDR3, respectively), the amino acid sequence of the invention is preferably such that:
  • CDR1 is chosen from the group consisting of:
  • amino acid sequences of SEQ ID NOs: 197 to 267 a) the amino acid sequences of SEQ ID NOs: 197 to 267; b) amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • CDR2 is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • CDR3 is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551.
  • amino acid sequence (or ISV) of the invention may be such that
  • CDRl is chosen from the group consisting of the amino acid sequences of SEQ ID NOs: 197 to 267; and/or CDR2 is chosen from the group consisting of the amino acid sequences of SEQ ID NOs: 339 to 409; and/or CDR3 is chosen from the group consisting of the amino acid sequences of SEQ ID NOs: 481 to 551.
  • amino acid sequence (or ISV) of the invention essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDRl to CDR3, respectively)
  • amino acid sequence of the invention is preferably such that:
  • - CDRl is chosen from the group consisting of:
  • amino acid sequences of SEQ ID NOs: 197 to 267 a) the amino acid sequences of SEQ ID NOs: 197 to 267; b) amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • CDR2 is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • CDR3 is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ; or any suitable fragment of such an amino acid sequence
  • such an amino acid sequence (or ISV) of the invention may be such that CDRl is chosen from the group consisting of the amino acid sequences of SEQ ID NOs: 197 to 267; and CDR2 is chosen from the group consisting of the amino acid sequences of SEQ ID NOs: 339 to 409; and CDR3 is chosen from the group consisting of the amino acid sequences of SEQ ID NOs: 481 to 551.
  • amino acid sequences are preferably such that they can specifically bind (as defined herein) to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof; and more in particular bind to any of IL- 17A, IL- 17F and/or IL- 17A/F including combinations thereof with an affinity (suitably measured and/or expressed as a KD- value (actual or apparent), a KA- value (actual or apparent), a ko n -rate and/or a kofr-rate, or alternatively as an IC50 value, as further described herein) that is as defined herein.
  • affinity suitably measured and/or expressed as a KD- value (actual or apparent), a KA- value (actual or apparent), a ko n -rate and/or a kofr-rate, or alternatively as an IC50 value, as further described herein
  • the invention relates to an amino acid sequence (or ISV) that essentially consists of 4 framework regions (FRl to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which the CDR sequences of said amino acid sequence have at least 70% amino acid identity, preferably at least 80% amino acid identity, more preferably at least 90% amino acid identity, such as 95% amino acid identity or more or even essentially 100% amino acid identity with the CDR sequences of at least one of the amino acid sequences of SEQ ID NOs: 623 to 693 (see Table A-l).
  • This degree of amino acid identity can for example be determined by determining the degree of amino acid identity (in a manner described herein) between said amino acid sequence and one or more of the sequences of SEQ ID NOs: 623 to 693 (see Table A-l ), in which the amino acid residues that form the framework regions are
  • amino acid sequences of the invention can be as further described herein.
  • the framework sequences may be any suitable framework sequences, and examples of suitable framework sequences will be clear to the skilled person, for example on the basis the standard handbooks and the further disclosure and prior art mentioned herein.
  • the framework sequences are preferably (a suitable combination of) immunoglobulin framework sequences or framework sequences that have ?een derived from immunoglobulin framework sequences (for example, by humanization or camelization).
  • the framework sequences may be framework sequences deri ed from a light chain variable domain (e.g. a VL-sequence) and/or from a heavy chain variable domain (e.g. a VH- sequence).
  • the framework sequences are either framework sequences that have been derived from a VHH sequence (in which said framework sequences may optionally have been partially or fully hu nanized) or are conventional VH sequences that have been camelized (as defined herein).
  • the framework sequences are preferably such that the amino acid sequence (or ISV) of the invention is a domain antibody (or an amino acid sequence that is suitable for use as a domain antibody); is a single domain antibody (or an amino acid sequence that is suitable for use as a single domain antibody); is a "dAb” (or an amino acid sequence that is suitable for use as a dAb); or is a Nanobody (including but not limited to V H H sequence).
  • suitable framework sequences will be clear to the skilled person, for example on the basis the standard handbooks and the further disclosure and prior art mentioned herein.
  • the framework sequences present in the amino acid sequences of the invention may contain one or more of Hallmark residues (as defined herein), such that the amino acid sequence of the invention is a Nanobody.
  • suitable fragments (or combinations of fragments) of any of the foregoing such as fragments that contain one or more CDR sequences, suitably flanked by and/or linked via one or more framework sequences (for example, in the same order as these CDR's and framework sequences may occur in the full-sized immunoglobulin sequence from which the fragment has been derived).
  • Such fragments may also again be such that they comprise or can form an immunoglobulin fold, or alternatively be such that they do not comprise or cannot form an immunoglobulin fold.
  • such a fragment comprises a single CDR sequence as described herein (and in particular a CDR3 sequence), that is flanked on each side by (part of) a framework sequence (and in particular, part of the framework sequence(s) that, in the immunoglobulin sequence from which the fragment is derived, are adjacent to said CDR sequence.
  • a CDR3 sequence may be preceded by (part of) a FR3 sequence and followed by (part of) a FR4 sequence).
  • Such a fragment may also contain a disulphide bridge, and in particular a di ;ulphide bridge that links the two framework regions that precede and follow the CDR sequence, respectively (for the purpose of forming such a disulphide bridge, cysteine residues tha naturally occur in said framework regions may be used, or alternatively cysteine residues may be synthetically added to or introduced into said framework regions).
  • a disulphide bridge and in particular a di ;ulphide bridge that links the two framework regions that precede and follow the CDR sequence, respectively
  • cysteine residues tha naturally occur in said framework regions may be used, or alternatively cysteine residues may be synthetically added to or introduced into said framework regions.
  • polypeptide of the invention that comprises or essentially consists of one or more amino acid sequences (or ISV's) of the invention (or suitable fragments thereof), and optionally further comprises one or more other groups, residues, moieties or binding units.
  • such further groups, residues, moieties, binding units or amino acid sequences may or may not provide further functionality to the amino acid sequence of the invention (and/or to the compound or construct in which it is present) and may or may not modify the properties of the amino acid sequence of the invention.
  • such further groups, residues, moieties or binding units may be one or more additional amino acid sequences, such that the compound or construct is a (fusion) protein or (fusion) polypeptide.
  • said one or more other groups, residues, moieties or binding units are immunoglobulin sequences.
  • said one or more other groups, residues, moieties or binding units are chosen from the group consisting of domain antibodies, amino acid sequences that are suitable for use as a domain antibody, single domain antibodies, amino acid sequences that are suitable for use as a single domain antibody, "dAb"'s, amino acid sequences that are suitable for use as a dAb, or Nanobodies.
  • such groups, residues, moieties or binding units may for example be chemical groups, residues, moieties, which may or may not by themselves be biologically and/or pharmacologically active.
  • such groups may be linked to the one or more amino acid sequences of the invention so as to provide a
  • derivatives of an amino acid sequence or polypeptide of the invention, as further described herein.
  • compounds or constructs that comprises or essentially consists of one or more derivatives as described herein, and optionally further comprises one or more other groups, residues, moieties or binding units, optionally linked via one or more linkers.
  • said one or more other groups, residues, moieties or binding units are amino acid sequences.
  • the one or more amino acid sequences of the invention and the one or more groups, residues, moieties or binding units may be linked directly to each other and/or via one or more suitable linkers or spacers.
  • the linkers may also be amino acid sequences, so that the resulting compound or construct is a fusion (protein) or fusion (polypeptide).
  • amino acid sequences (or ISV's) of the invention can be used as "building blocks" to form p ypeptides of the invention, i.e. by suitably combining them with each other, one or more with other amino acid sequences of the invention and/or with one or more other groups, residues, moieties or binding units, in order to form compounds or constructs as described herein (such as, without limitations, the biparatopic. bi/multivalent and bi/multispecific polypeptides of the invention described herein) which combine within one molecule one or more desired properties or biological functions.
  • the compounds or polypeptides of the invention can generally be prepared by a method which comprises at least one step of suitably linking the one or more amino acid sequences (or ISV's) of the invention to the one or more further groups, residues, moieties or binding units, optionally via the one or more suitable linkers, so as to provide the compound or polypeptide of the invention.
  • Polypeptides of the invention can also be prepared by a method which generally comprises at least the steps of providing a nucleic acid that encodes a polypeptide of the invention, expressing said nucleic acid in a suitable manner, and recovering the expressed polypeptide of the invention. Such methods can be performed in a manner known per se, which will be clear to the skilled person, for example on the basis of the methods and techniques further described herein.
  • a compound of the invention or a polypeptide of the invention may have an increased half-life, compared to the corresponding amino acid sequence of the invention.
  • Some preferred, but non-limiting examples of such compounds and polypeptides will become clear to the skilled person based on the further disclosure herein, and for example comprise amino acid sequences or polypeptides of the invention that have been chemically modified to increase the half-life thereof (for example, by means of pegylation); amino acid sequences of the invention that comprise at least one additional binding site for binding to a serum protein (such as serum albumin); or polypeptides of the invention that comprise at least one amino acid sequence of the invention that is linked to at least one moiety (and in particular at least one amino acid sequence) that increases the half- life of the amino acid sequence of the invention.
  • polypeptides of the invention that comprise such half-life extending moieties or amino acid sequences will become clear to the skilled person based on the further disclosure herein; and for example include, without limitation, polypeptides in which the one or more amino acid sequences of the invention are suitable linked to one or more serum proteins or fragments thereof (such as (human) serum albumin or suitable fragments thereof) or to one or more binding units that can bind to serum proteins (such as, for example, domain antibodies, amino acid sequences that are suitable for use as a domain antibody, single domain antibodies, amino acid sequences that are suitable for use as a single domain antibody, "dAb"'s, amino acid sequences that are suitable for use as a dAb, or Nanobodies that can bind to serum proteins such as serum albumin (such as human serum albumin), serum immunoglobulins such as IgG, or transferrine; reference is made to the further description and references mentioned herein); polypeptides in which an amino acid sequence of the invention is linked to an Fc portion (such as a human
  • a compound of the invention or a polypeptide of the invention may comprise one or more amino acid sequences of the invention (which may be as further described herein; and when two or more amino acid sequences of the invention are present, they may be the same or different) and one or more (usually only one, which may be a tandem repeat in case of a serum-albumin binding peptide) serum albumin binding peptides or serum albumin binding domains (and optionally one or more other groups, residues, moieties or binding units as futher described herein).
  • the "serum albumin binding peptide or binding domain” may be any suitable serum-albumin binding peptide or binding domain capable of increasing the half-life of the construct (compared to the same construct without the serum-albumin binding peptide or binding domain), and may in particular be serum albumin binding peptides as described in WO 2008/068280 by applicant (and in particular WO 2009/127691 and the non-prepublished US application 61/301,819, both by applicant), or a serum-albumin binding immunoglobulin single variable domain (such as a serum-albumin binding Nanobody; for example Alb-1 or a humanized version of Alb-1 such as Alb-8, for which reference is for example made to WO 06/122787).
  • Albl 1 can be used.
  • Albl 1 has the amino acid sequence SEQ ID NO 841 or SEQ ID NO 842.
  • the half-life of a construct or polypeptide of the invention can (and preferably is) suitably “tailored” for the intended (therapeutic and/or diagnostic) application and or to obtain the best balance between the desired therapeutic and/or pharmacological effect and possible undesired side-effects.
  • the compounds or polypeptides of the invention with increased half-life preferably have a half-life that is at least 1.5 times, preferably at least 2 times, such as at least 5 times, for example at least 10 times or more than 20 times, greater than the half-life of the corresponding amino acid sequence of the invention per se.
  • the compounds or polypeptides of the invention with increased half-life may have a half-life that is increased with more than 1 hours, preferably more than 2 hours, more preferably more than 6 hours, such as more than 12 hours, or even more than 24, 48 or 72 hours, compared to the corresponding amino acid sequence of the invention per se.
  • such compounds or polypeptides of the invention have a serum half-life that is increased with more than 1 hours, preferably more than 2 hours, more preferably more than 6 hours, such as more than 12 hours, or even more than 24, 48 or 72 hours, compared to the corresponding amino acid sequence of the invention per se.
  • such compounds or polypeptides of the invention exhibit a serum half-life in human of at least about 12 hours, preferably at least 24 hours, more preferably at least 48 hours, even more preferably at least 72 hours or more.
  • compounds or polypeptides of the invention may have a half- life of at least 5 days (such as about 5 to 10 days), preferably at least 9 days (such as about 9 to 14 days), more preferably at least about 10 days (such as about 10 to 15 days), or at least about 1 1 days (such as about 1 1 to 16 days), more preferably at least about 12 days (such as about 12 to 18 days or more), or more than 14 days (such as about 14 to 19 days).
  • Figure 6 and SEQ ID NOs: 710 to 759 as well as " " "
  • albumin-binding Nanobody (Alb-8, which is also referred to herein as Alb 1 1 ) according to WO 06/122787 in order to provide increase half-life.
  • the polypeptides from Figure 8 and SEQ ID NOs: 826 to 837 are based on humanized and/or sequenced-optimized amino acid sequences of the invention as building blocks. Based on the further disclosure herein, the skilled person will be able to provide other compounds, constructs and/or polypeptides of the invention, based on the same or other building blocks described herein, and/or comprising another moiety, binding domain, binding unit or peptide for providing increased half-life.
  • the invention relates to a nucleic acid that encodes an amino acid sequence (or ISV) of the invention or a polypeptide of the invention (or a suitable fragment thereof).
  • a nucleic acid will also be referred to herein as a "nucleic acid of the invention” and may for example be in the form of a genetic construct, as further described herein.
  • the amino acid of the invention (or ISV) is considered a building block.
  • the invention relates to a host or host cell that expresses (or that under suitable circumstances is capable of expressing) an amino acid sequence of the invention and/or a polypeptide of the invention; and/or that contains a nucleic acid of the invention.
  • the invention further relates to a product or composition containing or comprising at least one amino acid sequence (or ISV) of the invention, at least one polypeptide of the invention (or a suitable fragment thereof) and/or at least one nucleic acid of the invention, and optionally one or more further components of such compositions known per se, i.e.
  • Such a product or composition may for example be a pharmaceutical composition (as described herein), a veterinary composition or a product or composition for diagnostic use (as also described herein).
  • the invention also relates to the use of an amino acid sequence (or ISV), Nanobody or polypeptide of the invention, or of a composition comprising the same, in (methods or compositions for) modulating any of IL- 17A, IL- 17F and/or IL- I 7A/F including
  • in vitro e.g. in an in vitro or cellular assay
  • in vivo e.g. in an a single cell or in a multicellular organism, and in particular in a mammal, and more in particular in a human being, such as in a human being that is at risk of or suffers from immune related diseases and disorders of the invention.
  • the invention also relates to methods for modulating IL- 17A, IL- 17F and/or IL-17A/F including combinations thereof, either in vitro (e.g. in an in vitro or cellular assay) or in vivo (e.g.
  • a method comprises at least the step of contacting IL-17A, IL-17F and/or 1L-17A/F including combinations thereof with at least one amino acid sequence (or ISV), Nanobody or polypeptide of the invention, or with a composition comprising the same, in a manner and in an amount suitable to modulate IL- 17A, IL-17F and/or IL-17A/F including combinations thereof, with at least one amino acid sequence (or ISV), Nanobody or polypeptide of the invention.
  • the invention also relates to the use of an one amino acid sequence (or ISV),
  • Nanobody or polypeptide of the invention in the preparation of a composition for modulating IL- 17A, IL-17F and/or IL-17A/F including combinations thereof, either in vitro (e.g. in an in vitro or cellular assay) or in vivo (e.g. in an a single cell or multicellular organism, and in particular in a mammal, and more in particular in a human being, such as in a human being that is at risk of or suffers from the immune related diseases and disorders of the invention).
  • a composition such as, without limitation, a pharmaceutical composition or preparation as further described herein
  • in vitro e.g. in an in vitro or cellular assay
  • in vivo e.g. in an a single cell or multicellular organism, and in particular in a mammal, and more in particular in a human being, such as in a human being that is at risk of or suffers from the immune related diseases and disorders of the invention.
  • modulati g or “to modulate” generally means either reducing or inhibiting the activity of, or alte natively increasing the activity of, IL- 17A, IL- 17F and/or IL-17A/F including combinations thereof, as measured using a suitable in vitro, cellular or in vivo assay (such as those mentioned herein).
  • modulating or “to modulate” may mean either reducin or inhibiting the activity of, or alternatively increasing the activity of IL-17A, IL- 17F an 1/or IL- 17A/F including
  • moduleating may also involve effecting a change (which may either be an increase or a descrease) in affinity, avidity, specificity and/or selectivity of any of 1L-17A, IL-17F and/or IL-17A/F including combinations thereof for one or more of its targets, ligands or substrates; and/or effecting a change (which may either be an increase or a decrease) in the sensitivity of IL-17A, IL-17F and/or IL-17A/F including combinations thereof for one or more conditions in the medium or surroundings in which 1L- 17A, IL- 17F and/or IL-17A/F including combinations thereof is present (such as pH, ion strength, the presence of co-factors, etc.), compared to the same conditions but without the presence of the amino acid sequence (or ISV), Nanobody or polypeptide of the invention.
  • this may again be determined in any suitable manner and/or using any suitable assay known per se, such as the as
  • Modulating may also mean effecting a change (i.e. an activity as an agonist or as an antagonist, respectively) with respect to one or more biological or physiological mechanisms, effects, responses, functions, pathways or activities in which IL- 17A, IL-17F and/or IL- 17A/F including combinations thereof (or in which its substrate(s), ligand(s) or pathway(s) are involved, such as its signalling pathway or metabolic pathway and their associated biological or physiological effects) is involved.
  • a change i.e. an activity as an agonist or as an antagonist, respectively
  • IL- 17A, IL-17F and/or IL- 17A/F including combinations thereof or in which its substrate(s), ligand(s) or pathway(s) are involved, such as its signalling pathway or metabolic pathway and their associated biological or physiological effects
  • an action as an agonist or an antagonist may be determined in any suitable manner and/or using any suitable (in vitro and usually cellular or in assay) assay known per se, such as the assays described herein
  • an action as an agonist or antagonist may be such that an intended biological or physiological activity is increased or decreased, respectively, by at least 1 %, preferably at least 5%, such as at least 10% or at least 25%, for example by at least 50%, at least 60%, at least 70%, at least 80%, or 90% or more, compared to the biological or physiological activity in the same assay under the same conditions but without the presence of the amino acid sequence (or ISV), Nanobody or polypeptide of the invention.
  • Modulating may for example involve reducing or inhibiting the binding of any of IL- 17 A, IL-17F and/or IL-17A/F including combinations thereof to one of its substrates or ligands and/or competing with a natural ligand, substrate for binding to any of IL-17A, IL- 17F and/or IL-17A/F including combinations thereof. Modulating may also involve activating any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof or the mechanism or pathway in which it is involved. Modulating may be reversible or irreversible, but for pharmaceutical and pharmacological purposes will usually be in a reversible manner.
  • the invention further relates to methods for preparing or generating the amino acid sequences (or ISV), polypeptides, nucleic acids, host cells, products and compositions described herein. Some preferred but non-limiting examples of such methods will become clear from the further description herein. Generally, these methods may comprise the steps of:
  • c) isolating the amino acid sequence(s) that can bind to and/or have affinity for any of IL- 17A, 1L-17F and/or IL-17A/F including combinations thereof.
  • the set, collection or library of amino acid sequences may be any suitable set, collection or library of amino acid sequences.
  • the set, collection or library of amino acid sequences may be a set, collection or library of immunoglobulin sequences (as described herein), such as a naive set, collection or library of immunoglobulin sequences; a synthetic or semi-synthetic set, collection or library of immunoglobulin sequences; and/or a set, collection or library of immunoglobulin sequences that have been subjected to affinity maturation.
  • the set, collection or library of amino acid sequences may be a set, collection or library of heavy chain variable domains (such as VH domains or VHH domains) or of light chain variable domains.
  • the set, collection or library of amino acid sequences may be a set, collection or library of domain antibodies or single domain antibodies or ISVs, or may be a set, collection or library of amino acid sequences that are capable of functioning as a domain antibody or single domain antibody or ISV.
  • the set, collection or library of amino acid sequences may be an immune set, collection or library of immunoglobulin sequences, for example derived fro ti a mammal that has been suitably immunized with any of IL-17A, IL- 17F and/or IL-17A/F including combinations thereof or with a suitable antigenic determinant based thereon or derived therefrom, such as an antigenic part, fragment, region, domain, loop or other epitope thereof.
  • said antigenic determinant may be an extracellular part, region, domain, loop or other extracellular epitope(s).
  • the set, collection or library of amino acid sequences may be displayed on a phage, phagemid, ribosome or suitable micro-organism (such as yeast), such as to facilitate screening.
  • suitable methods, techniques and host organisms for displaying and screening (a set, collection or library of) amino acid sequences will be clear to the person skilled in the art, for example on the basis of the further disclosure herein. Reference is also made to the review by Hoogenboom in Nature Biotechnology, 23, 9, 1 105-1 1 16 (2005).
  • the method for generating amino acid sequences comprises at least the steps of:
  • the collection or sample of cells may for example be a collection or sample of B-cells.
  • the sample of cells may be derived from a mammal that has been suitably immunized with any of IL-17A, IL-17F and or IL-17A/F including combinations thereof or with a suitable antigenic determinant based thereon or derived therefrom, such as an antigenic part, fragment, region, domain, loop or other epitope thereof.
  • said antigenic determinant may be an extracellular part, region, domain, loop or other extracellular epitope(s).
  • step b) is preferably performed using a flow cytometry technique such as FACS.
  • FACS flow cytometry technique
  • the method for generating an amino acid sequence directed against any of IL-17A, IL-17F and/or EL-17A/F including combinations thereof may comprise at least the steps of:
  • the set, collection or library of nu ;leic acid sequences encoding amino acid sequences may for example be a set, collectio ⁇ or library of nucleic acid sequences encoding a naive set, collection or library of immunoglobulin sequences; a set, collection or library of nucleic acid sequences encoding a synthetic or semi-synthetic set, collection or library of immunoglobulin sequences; and/o a set, collection or library of nucleic acid sequences encoding a set, collection or library of immunoglobulin sequences that have been subjected to affinity maturation.
  • the set, collection or library of nucleic acid sequences may encode a set, collection or library of heavy chain variable domains (such as VH domains or VHH domains) or of light chain variable domains.
  • the set, collection or library of nucleic acid sequences may encode a set, collection or library of domain antibodies or single domain antibodies, or a set, collection or library of amino acid sequences that are capable of functioning as a domain antibody or single domain antibody.
  • the set, collection or library of nucleic acid sequences may be an immune set, collection or library of nucleic acid sequences, for example derived from a mammal that has been suitably immunized with any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof or with a suitable antigenic determinant based thereon or derived therefrom, such as an antigenic part, fragment, region, domain, loop or other epitope thereof.
  • said antigenic determinant may be an extracellular part, region, domain, loop or other extracellular epitope(s).
  • the set, collection or library of nucleic acid sequences may for example encode an immune set, collection or library of heavy chain variable domains or of light chain variable domains.
  • the set, collection or library of nucleotide sequences may encode a set, collection or library of VHH sequences.
  • the set, collection or library of nucleotide sequences may be displayed on a phage, phagemid, ribosome or suitable micro-organism (such as yeast), such as to facilitate screening.
  • suitable methods, techniques and host organisms for displaying and screening (a set, collection or library of) nucleotide sequences encoding amino acid sequences will be clear to the person skilled in the art, for example on the basis of the further disclosure herein. Reference is also made to the review by Hoogenboom in Nature
  • the method for generating an amino acid sequence directed against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof may comprise at least the steps of:
  • Nanobody of the invention e.g. SEQ ID NO: 623 to 693 (Table A-l ), or a humanized Nanobody of the invention, or a polypeptide or construct of the invention;
  • the invention also relates to amino acid sequences that are obtained by the above methods, or alternatively by a method that comprises one of the above methods and in addition at least the steps of determining the nucleotide sequence or amino acid sequence of said immunoglobulin sequence; and of expressing or synthesizing said amino acid sequence in a manner known per se, such as by expression in a suitable host cell or host organism or by chemical synthesis.
  • one or more amino acid sequences of the invention may be suitably humanized (or alternatively camelized); and/or the amino acid sequence(s) thus obtained may be linked to each other or to one or more other suitable amino acid sequences (optionally via one or more suitable linkers) so as to provide a polypeptide of the invention.
  • nucleic acid sequence encoding an amino acid sequence of the invention may be suitably humanized (or alternatively camelized) and suitably expressed; and/or one or more nucleic acid sequences encoding an amino acid sequence of the invention may be linked to each other or to one or more nucleic acid sequences that encode other suitable amino acid sequences (optionally via nucleotide sequences that encode one or more suitable linkers), after which the nucleotide sequence thus obtained may be suitably expressed so as to provide a polypeptide of the invention.
  • the invention further relates to applications and uses of the amino acid sequences, compounds, constructs, polypeptides, nucleic acids, host cells, products and compositions described herein, as well as to methods for the prevention and/or treatment for diseases and disorders associated with any of 1L- 17A, IL-17F and/or IL-17A/F including combinations thereof.
  • the invention also relates to the amino acid sequences, compounds, constructs, polypeptides, nucleic acids, host cells, products and compositions described herein for use in therapy.
  • the invention also relates to the amino acid sequences, compounds, constructs, polypeptides, nucleic acids, host cells, products and compositions described herein for use in therapy of a disease or disorder that can be prevented or treated by administering, to a subject in need thereof, of (a pharmaceutically effective amount of) an amino acid sequence, compound, construct or polypeptide as described herein.
  • the invention relates to the amino acid sequences, compounds, constructs, polypeptides, nucleic acids, host cells, products and compositions described herein for use in therapy of immune related diseases and disorders of the invention.
  • Nanobodies generally offer certain advantages (outlined herein) compared to "dAb's” or similar (single) domain antibodies or immunoglobulin sequences, which advantages are also provided by the
  • immunoglobulin sequence Unless indicated otherwise, the terms "immunoglobulin sequence”, “sequence”,
  • nucleotide sequence and “nucleic acid” are as described in paragraph b) on page 46 of WO 08/020079.
  • Amino acid residues will be indicated according to the standard three-letter or one- letter amino acid code. Reference is made to Table A-2 on page 48 of the International application WO 08/020079 of Ablynx N.V. entitled "Amino acid sequences directed against IL-6R and polypeptides comprising the same for tbe treatment of diseases and disorders associated with 11-6 mediated signalling".
  • the percentage of "sequence identity" between a first nucleotide sequence and a second nucleotide sequence may be calculated or determined as described in paragraph e) on page 49 of WO 08/020079 (incorporated herein by reference), such as by dividing [the number of nucleotides in the first nucleotide sequence that are identical to the nucleotides at the corresponding positions in the second nucleotide sequence] by [the total number of nucleotides in the first nucleotide sequence] and multiplying by [100%], in which each deletion, insertion, substitution or addition of a nucleotide in the second nucleotide sequence - compared to the first nucleotide sequence - is considered as a difference at a single nucleotide (position); or using a suitable computer algorithm or technique, again as described in paragraph e) on pages 49 of WO 08/020079 (incorporated herein by reference).
  • amino acid identity For the purposes of comparing two or more amino acid sequences, the percentage of "sequence identity" between a first amino acid sequence and a second amino acid sequence (also referred to herein as “amino acid identity”) may be calculated or determined as described in paragraph f) on pages 49 and 50 of WO 08/020079
  • Any amino acid substitutions applied to the polypeptides described herein may also be based on the analysis of the frequencies of amino acid variations between homologous proteins of different species developed by Schulz et al., Principles of Protein Structure, Springer- Verlag, 1978, on the analyses of structure forming potentials developed by Chou and Fasman, Biochemistry 13: 21 1 , 1974 and Adv. Enzymol., 47: 45- 149, 1978, and on the analysis of hydrophobicity patterns in proteins developed by Eisenberg et al., Proc. Nad. Acad Sci. USA 81 : 140- 144, 1984; Kyte & Doolittle; J Molec. Biol.
  • Amino acid sequences and nucleic acid sequences are said to be "exactly the same” if they have 100% sequence identity (as defined herein) over their entire length.
  • amino acid difference refers to an insertion, deletion or substitution of a single amino acid residue on a position of the first sequence, compared to the second sequence; it being understood that two amino acid sequences can contain one, two or more such amino acid differences.
  • nucleotide sequence or amino acid sequence is said to "comprise” another nucleotide sequence or amino acid sequence, respectively, or to "essentially consist of another nucleotide sequence or amino acid sequence, this has the meaning given in paragraph i) on pages 51-52 of WO 08/020079.
  • domain and “binding domain” have the meanings given to it in paragraph k) on page 53 of WO 08/020079.
  • An epitope in the context of the present invention includes any peptide or peptide-derivative determinant capable of specific binding to an amino acid sequence of the invention.
  • An epitope may comprise any suitable number of amino acids, in any suitable position (with respect to the linear sequence of 1L17A and/or IL17F and/or IL17A/F), orientation (with respect to folded IL17A and/or IL17F and/or IL17A/F), or a fragment thereof, amino acid composition (and consequently, at least in part, charge).
  • an epitope may be composed of about 3- 10 amino acids, typically 3- 8 amino acids, in one or more contiguous or noncontiguous locations with respect to the primary sequence of IL17A and/or IL17F and or IL17A/F (for instance an epitope may consist essentially of 2, 3, 4, 5, 6, 7, or 8 amino acid residues distributed in 1, 2, 3, 4, or 5 noncontiguous locations in CD38).
  • an epitope may be considered to be defined by a region of about 5-40 contiguous amino acid residues (e.g., about 7-30 amino acid residues, about 5-20 amino acid residues, or about 3-15 amino acid residues) in IL17A and/or EL17F and/or IL17A/F (solely or in combination with a portion of an adjacent CD38 domain).
  • amino acid residues e.g., about 7-30 amino acid residues, about 5-20 amino acid residues, or about 3-15 amino acid residues
  • IL17A and/or EL17F and/or IL17A/F solely or in combination with a portion of an adjacent CD38 domain.
  • an epitope may be characterized on the basis of one or more of such critical residues, with the recognition that other residues may also make some lesser contribution to the epitope.
  • an epitope defined by a region of amino acids it may be that one or more amino acids in the region make only a minor contribution or even negligible contribution to antibody binding, such that the residue may be subject to substitution with an appropriate different residue without resulting in "a loss" of the epitope to at least some amino acid sequences of the invention specific for it.
  • an amino acid sequence such as a Nanobody, an antibody, a polypeptide of the invention, or generally an antigen binding protein or polypeptide or a fragment thereof
  • an amino acid sequence that can (specifically) bind to, that has affinity for and/or that has specificity for a specific antigenic determinant, epitope, antigen or protein (or for at least one part, fragment or epitope thereof) is said to be "against" or “directed against” said antigenic determinant, epitope, antigen or protein.
  • binding specifically has the meaning given to it in paragraph n) on pages 53-56 of WO 08/020079; and as mentioned therein refers to the number of different types of antigens or antigenic determinants to which a particular antigen-binding molecule or antigen-binding protein (such as a Nanobody or a polypeptide of the invention) molecule can bind.
  • binding properties in the context of the amino acid sequences of the present invention is sometimes referred to as "binding specifically" throughout the present document. Wherever the term “binding specifically” occurs in the present document it denotes binding properties of an amino acid sequence of the present invention which binding to a target exhibits such specifity as explained in this paragraph.
  • antigen-binding protein can be determined based on affinity and/or avidity, as described on pages 53-56 of WO 08/020079 (incorporated herein by reference), which also describes some preferred techniques for measuring binding between an antigen-binding molecule (such as a Nanobody or polypeptide of the invention) and the pertinent antigen.
  • antigen-binding proteins such as the amino acid sequences, Nanobodies and/or polypeptides of the invention
  • KD dissociation constant
  • a monovalent immunoglobulin sequence of the invention will bind to the desired antigen with an affinity less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM.
  • Specific binding of an antigen-binding protein to an antigen or antigenic determinant can be determined in any suitable manner known per se, including, for example, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known per se in the art; as well as the other techniques mentioned herein.
  • the dissociation constant may be the actual or apparent dissociation constant. Methods for determining the dissociation constant will be clear to the skilled person, and for example include the techniques mentioned on pages 53-56 of WO 08/020079.
  • the half-life of an amino acid sequence, compound or polypeptide of the invention can generally be defined as described in paragraph o) on page 57 of WO 08/020079 and as mentioned therein refers to the time taken for the serum concentration of the amino acid sequence, compound or polypeptide to be reduced by 50%, in vivo, for example due to degradation of the sequence or compound and/or clearance or sequestration of the sequence or compound by natural mechanisms.
  • the in vivo half-life of an amino acid sequence, compound or polypeptide of the invention can be determined in any manner known per se, such as by pharmacokinetic analysis. Suitable techniques will be clear to the person skilled in the art, and may for example generally be as described in paragraph o) on page 57 of WO 08/020079.
  • the half-life can be expressed using parameters such as the tl/2- alpha, tl/2-beta and the area under the curve (AUC).
  • AUC area under the curve
  • modulating or “to modulate” generally means either reducing or inhibiting the activity of, or alternatively increasing the activity of, a target or antigen, as measured using a suitable in vitro, cellular or in vivo assay.
  • modulating or “to modulate” may mean either reducing or inhibiting the activity of, or alternatively increasing a (relevant or intended) biological activity of, a target or antigen, as measured using a suitable in vitro, cellular or in vivo assay (which will usually depend on the target or antigen involved), by at least 1 %, preferably at least 5%, such as at least 10% or at least 25%, for example by at least 50%, at least 60%, at least 70%, at least 80%, or 90% or more, compared to activity of the target or antigen in the same assay under the same conditions but without the presence of the construct of the invention.
  • moduleating may also involve effecting a change (which may either be an increase or a decrease) in affinity, avidity, specificity and/or selectivity of a target or antigen for one or more of its ligands, binding partners, partners for association into a homomultimeric or heteromultimeric form, or substrates; and/or effecting a change (which may either be an increase or a decrease) in the sensitivity of the target or antigen for one or more conditions in the medium or surroundings in which the target or antigen is present (such as pH, ion strength, the presence of co-factors, etc.), compared to the same conditions but without the presence of the construct of the invention.
  • this may again be determined in any suitable manner and/or using any suitable assay known per se, depending on the target or antigen involved.
  • Modulating may also mean effecting a change (i.e. an activity as an agonist, as an antagonist or as a reverse agonist, respectively, depending on the target or antigen and the desired biological or physiological effect) with respect to one or more biological or physiological mechanisms, effects, responses, functions, pathways or activities in which the target or antigen (or in which its substrate(s), ligand(s) or pathway(s) are involved, such as its signalling pathway or metabolic pathway and their associated biological or physiological effects) is involved.
  • a change i.e. an activity as an agonist, as an antagonist or as a reverse agonist, respectively, depending on the target or antigen and the desired biological or physiological effect
  • a change i.e. an activity as an agonist, as an antagonist or as a reverse agonist, respectively, depending on the target or antigen and the desired biological or physiological effect
  • a change i.e. an activity as an agonist, as an antagonist or as a reverse agonist, respectively, depending on the target or antigen and the desired biological or physiological effect
  • an action as an agonist or antagonist may be such that an intended biological or physiological activity is increased or decreased, respectively, by at least 1 %, preferably at least 5%, such as at least 10% or at least 25%, for example by at least 50%, at least 60%, at least 70%, at least 80%, or 90% or more, compared to the biological or physiological activity in the same assay under the same conditions but without the presence of the construct of the invention.
  • Modulating may for example also involve allostenc modulation of the target or antigen; and/or reducing or inhibiting the binding of the target or antigen to one of its substrates or ligands and/or competing with a natural ligand, substrate for binding to the target or antigen. Modulating may also involve activating the target or antigen or the mechanism or pathway in which it is involved. Modulating may for example also involve effecting a change in respect of the folding or confirmation of the target or antigen, or in respect of the ability of the target or antigen to fold, to change its confirmation (for example, upon binding of a ligand), to associate with other (sub)units, or to disassociate.
  • Modulating may be reversible or irreversible, but for pharmaceutical and
  • interaction site on the target or antigen means a site, epitope, antigenic determinant, part, domain or stretch of amino acid residues on the target or antigen that is a site for binding to a ligand, receptor or other binding partner, a catalytic site, a cleavage site, a site for allosteric interaction, a site involved in multimerisation (such as homomerization or heterodimerization) of the target or antigen; or any other site, epitope, antigenic determinant, part, domain or stretch of amino acid residues on the target or antigen that is involved in a biological action or mechanism of the target or antigen.
  • an "interaction site” can be any site, epitope, antigenic determinant, part, domain or stretch of amino acid residues on the target or antigen to which an amino acid sequence or polypeptide of the invention can bind such that the target or antigen (and/or any pathway, interaction, signalling, biological mechanism or biological effect in which the target or antigen is involved) is modulated (as defined herein).
  • An amino acid sequence or polypeptide is said to be "specific for" a first target or antigen compared to a second target or antigen when is binds to the first antigen with an affinity (as described above, and suitably expressed as a KD value, KA value, off rate and/or on rate) that is at least 10 times, such as at least 100 times, and preferably at least 1000 times, and up to 10.000 times or more better than the affinity with which said amino acid sequence or polypeptide binds to the second target or polypeptide.
  • an affinity as described above, and suitably expressed as a KD value, KA value, off rate and/or on rate
  • the first antigen may bind to the target or antigen with a p value that is at least 10 times less, such as at least 100 times less, and preferably at least 1000 times less, such as 10.000 times less or even less than that, than the K D with which said amino acid sequence or polypeptide binds to the second target or polypeptide.
  • a p value that is at least 10 times less, such as at least 100 times less, and preferably at least 1000 times less, such as 10.000 times less or even less than that, than the K D with which said amino acid sequence or polypeptide binds to the second target or polypeptide.
  • an amino acid sequence or polypeptide is "specific for" a first target or antigen compared to a second target or antigen, it is directed against (as defined herein) said first target or antigen, but not directed against said second target or antigen.
  • cross-block cross-blocked' and cross-blocking
  • an amino acid sequence or other binding agents such as a Nanobody, polypeptide or compound or construct of the invention
  • the extend to which an amino acid sequence or other binding agents of the invention is able to interfere with the binding of another to the target, and therefore whether it can be said to cross-block according to the invention, can be determined using competition binding assays.
  • One particularly suitable quantitative cross-blocking assay uses a Biacore machine which can measure the extent of interactions using surface plasmon resonance technology.
  • Another suitable quantitative cross-blocking assay uses an ELISA-based approach to measure competition between amino acid sequences or other binding agents in terms of their binding to the target.
  • the Biacore machine (for example the Biacore 3000) is operated in line with the manufacturer's recommendations. Thus in one cross-blocking assay, the target protein is coupled to a
  • CM5 Biacore chip using standard amine coupling chemistry to generate a surface that is coated with the target. Typically 200- 800 resonance units of the target would be coupled to the chip (an amount that gives easily measurable levels of binding but that is readily saturable by the concentrations of test reagent being used).
  • Two test amino acid sequences (termed A* and B*) to be assessed for their ability to cross-block each other are mixed at a one to one molar ratio of binding sites in a suitable buffer to create the test mixture.
  • concentrations on a binding site basis the molecular weight of an amino acid sequence is assumed to be the total molecular weight of the amino acid sequence divided by the number of target binding sites on that amino acid sequence.
  • the concentration of each amino acid sequence in the test mix should be high enough to readily saturate the binding sites for that amino acid sequence on the target molecules captured on the Biacore chip.
  • the amino acid sequences in the mixture are at the same molar concentration (on a binding basis) and that concentration would typically be between 1.00 and 1.5 micromolar (on a binding site basis).
  • Separate solutions containing A* alone and B* alone are also prepared. A* and B* in these solutions should be in the same buffer and at the same concentration as in the test mix.
  • the test mixture is passed over the target-coated Biacore chip and the total amount of binding recorded. The chip is then treated in such a way as to remove the bound amino acid sequences without damaging the chip-bound target.
  • a cross-blocking amino acid sequence or other binding agent according to the invention is one which will bind to the target in the above Biacore cross-blocking assay such that, during the assay and in the presence of a second amino acid sequence or other binding agent of the invention, the recorded binding is between 80% and 0.1 % (e.g. 80% to 4%) of the maximum theoretical binding, specifically between 75% and 0.1 % (e.g. 75% to 4%) of the maximum theoretical binding, and more specifically between 70% and 0.1 % (e.g. 70% to 4%) of maximum theoretical binding (as just defined above) of the two amino acid sequences or binding agents in combination.
  • the Biacore assay described above is a primary assay used to determine if amino acid sequences or other binding agents cross-block each other according to the invention. On rare occasions particular amino acid sequences or other binding agents may not bind to target coupled via amine chemistry to a CM5 Biacore chip (this usually occurs when the relevant binding site on target is masked or destroyed by the coupling to the chip). In such cases cross-blocking can be determined using a tagged version of the target, for example a N-terminal His-tagged version. In this particular format, an anti-His amino acid sequence would be coupled to the Biacore chip and then the His-tagged target would be passed over the surface of the chip and captured by the anti-His amino acid sequence.
  • the cross blocking analysis would be carried out essentially as described above, except that after each chip regeneration cycle, new His-tagged target would be loaded back onto the anti-His amino acid sequence coated surface.
  • C-terminal His-tagged target could alternatively be used.
  • various other tags and tag binding protein combinations that are known in the art could be used for such a cross-blocking analysis (e.g. HA tag with anti-HA antibodies; FLAG tag with anti-FLAG antibodies; biotin tag with streptavidin).
  • the general principal of the assay is to have an amino acid sequence or binding agent that is directed against the target coated onto the wells of an ELISA plate. An excess amount of a second, potentially cross-blocking, anti- target amino acid sequence is added in solution (i.e. not bound to the ELISA plate). A limited amount of the target is then added to the wells. The coated amino acid sequence and the amino acid sequence in solution compete for binding of the limited number of target molecules.
  • the plate is washed to remove excess target that has not been bound by the coated amino acid sequence and to also remove the second, solution phase amino acid sequence as well as any complexes formed between the second, solution phase amino acid sequence and target.
  • the amount of bound target is then measured using a reagent that is appropriate to detect the target.
  • An amino acid sequence in solution that is able to cross-block the coated amino acid sequence will be able to cause a decrease in the number of target molecules that the coated amino acid sequence can bind relative to the number of target molecules that the coated amino acid sequence can bind in the absence of the second, solution phase, amino acid sequence.
  • the first amino acid sequence e.g.
  • an Ab-X is chosen to be the immobilized amino acid sequence, it is coated onto the wells of the ELISA plate, after which the plates are blocked with a suitable blocking solution to minimize non-specific binding of reagents that are subsequently added.
  • An excess amount of the second amino acid sequence, i.e. Ab-Y is then added to the ELISA plate such that the moles of Ab-Y target binding sites per well are at least 10 fold higher than the moles of Ab-X target binding sites that were used, per well, during the coating of the ELISA plate.
  • Target is then added such that the moles of target added per well are at least 25-fold lower than the moles of Ab-X target binding sites that were used for coating each well.
  • the ELISA plate is washed and a reagent for detecting the target is added to measure the amount of target specifically bound by the coated anti[target amino acid sequence (in this case Ab-X).
  • the background signal for the assay is defined as the signal obtained in wells with the coated amino acid sequence (in this case Ab-X), second solution phase amino acid sequence (in this case Ab-Y), target buffer only (i.e. without target) and target detection reagents.
  • the positive control signal for the assay is defined as the signal obtained in wells with the coated amino acid sequence (in this case Ab-X), second solution phase amino acid sequence buffer only (i.e. without second solution phase amino acid sequence), target and target detection reagents.
  • the ELISA assay may be run in such a manner so as to have the positive control signal be at least 6 times the background signal.
  • the cross-blocking assay may to be run in two formats: 1 ) format 1 is where Ab-X is the amino acid sequence that is coated onto the ELISA plate and Ab-Y is the competitor amino acid sequence that is in solution and 2) format 2 is where Ab-Y is the amino acid sequence that is coated onto the ELISA plate and Ab-X is the competitor amino acid sequence that is in solution.
  • Ab-X and Ab- Y are defined as cross-blocking if, either in format 1 or in format 2, the solution phase anti-target amino acid sequence is able to cause a reduction of between 60% and 100%, specifically between 70% and 100%, and more specifically between 80% and 100%, of the target detection signal ⁇ i.e. the amount of target bound by the coated amino acid sequence) as compared to the target detection signal obtained in the absence of the solution phase and- target amino acid sequence (i.e. the positive control wells).
  • An amino acid sequence is said to be "cross-reactive" for two different antigens or antigenic determinants (such as serum albumin from two different species of mammal, such as human serum albumin and cyno serum albumin) if it is specific for (as defined herein) both these different antigens or antigenic determinants.
  • antigens or antigenic determinants such as serum albumin from two different species of mammal, such as human serum albumin and cyno serum albumin
  • association constant (KA) of the amino acid sequence with respect to the serum protein (such as serum albumin) at the pH value(s) that occur in a cell of an animal or human body is at least 5%, such as at least 10%, preferably at least 25%, more preferably at least 50%, even more preferably at least 60%, such as even more preferably at least 70%, such as at least 80% or 90% or more (or even more than 100%, such as more than 1 10%, more than 120% or even 130% or more, or even more than 150%, or even more than 200%) of the association constant (KA) of the amino acid sequence with respect to the same serum protein at the pH value(s) that occur outside said cell.
  • binding that is "essentially independent of the pH” is generally meant herein that the koff rate (measured by Biacore) of the amino acid sequence with respect to the serum protein (such as serum albumin) at the pH value(s) that occur in a cell of an animal or human body (as e.g. further described herein, e.g. pH around 5.5, e.g.
  • 5.3 to 5.7 is at least 5%, such as at least 10%, preferably at least 25%, more preferably at least 50%, even more preferably at least 60%, such as even more preferably at least 70%, such as at least 80% or 90% or more (or even more than 100%, such as more than 1 10%, more than 120% or even 130% or more, or even more than 150%, or even more than 200%) of the koff rate of the amino acid sequence with respect to the same serum protein at the pH value(s) that occur outside said cell, e.g. pH 7.2 to 7.4.
  • the pH value(s) that occur in a cell of an animal or human body is meant the pH value(s) that may occur inside a cell, and in particular inside a cell that is involved in the recycling of the serum protein.
  • the pH value(s) that occur in a cell of an animal or human body is meant the pH value(s) that may occur inside a (sub)cellular compartment or vesicle that is involved in recycling of the serum protein (e.g. as a result of pinocytosis, endocytosis, transcytosis, exocytosis and phagocytosis or a similar mechanism of uptake or internalization into said cell), such as an endosome, lysosome or pinosome.
  • the total number of amino acid residues in a Nanobody can be in the region of 110-120, is preferably 1 12-1 15, and is most preferably 1 13. It should however be noted that parts, fragments, analogs or derivatives (as further described herein) of a Nanobody are not particularly limited as to their length and/or size, as long as such parts, fragments, analogs or derivatives meet the further requirements outlined herein and are also preferably suitable for the purposes described herein;
  • Nanobody comprises the amino acid residues at positions 1-30
  • CDR1 of a Nanobody comprises the amino acid residues at positions 31 -35
  • FR2 of a Nanobody comprises the amino acids at positions 36-49
  • CDR2 of a Nanobody comprises the amino acid residues at positions 50-65
  • FR3 of a Nanobody comprises the amino acid residues at positions 66-94
  • CDR3 of a Nanobody comprises the amino acid residues at positions 95-102
  • FR4 of a Nanobody comprises the amino acid residues at positions 103-
  • variable domains present in naturally occurring heavy chain antibodies will also be referred to as "VH domains", in order to distinguish them from the heavy chain variable domains that are present in conventional 4-chain antibodies (which will be referred to hereinbelow as "V / domains”) and from the light chain variable domains that are present in conventional 4-chain antibodies (which will be referred to hereinbelow as "V , domains").
  • VHH domains have a number of unique structural characteristics and functional properties which make isolated V H H domains (as well as Nanobodies based thereon, which share these structural characteristics and functional properties with the naturally occurring V H H domains) and proteins containing the same highly advantageous for use as functional antigen-binding domains or proteins.
  • VHH domains which have been "designed" by nature to functionally bind to an antigen without the presence of, and without any interaction with, a light chain variable domain
  • Nanobodies can function as a single, relatively small, functional antigen-binding structural unit, domain or protein.
  • VHH domains from the V H and V L domains of conventional 4-chain antibodies, which by themselves are generally not suited for practical application as single antigen-binding proteins or domains, but need to be combined in some form or another to provide a functional antigen-binding unit (as in for example conventional antibody fragments such as Fab fragments; in ScFv's fragments, which consist of a VH domain covalently linked to a V L domain).
  • a functional antigen-binding unit as in for example conventional antibody fragments such as Fab fragments; in ScFv's fragments, which consist of a VH domain covalently linked to a V L domain.
  • V H H domains and Nanobodies as single antigen-binding proteins or as antigen-binding domains (i.e. as part of a larger protein or polypeptide) offers a number of significant advantages over the use of conventional VH and VL domains, scFv's or conventional antibody fragments (such as Fab- or F(ab') 2 -fragments), including the advantages that are listed on pages 60 and 61 of WO 08/020079.
  • the invention provides Nanobodies against any of IL-17A, IL-17F and/or BL-17A/F including combinations thereof, and in particular
  • Nanobodies against any of IL-17A, IL-17F and/or EL-17A/F including combinations thereof from a warm-blooded animal and more in particular Nanobodies against any of IL-17A, IL- 17F and/or IL-17A/F including combinations thereof from a mammal, and especially
  • the invention provides Nanobodies against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof, and proteins and/or polypeptides comprising the same, that have improved therapeutic and/or pharmacological properties and/or other advantageous properties (such as, for example, improved ease of preparation and/or reduced costs of goods), compared to conventional antibodies against any of IL- 17A, IL-17F and/or IL- 17A/F including combinations thereof or fragments thereof, compared to constructs that could be based on such conventional antibodies or antibody fragments (such as Fab' fragments, F(ab') 2 fragments, ScFv constructs, "diabodies” and other multispecific constructs (see for example the review by Holliger and Hudson, Nat Biotechnol.
  • any of 1L-17A, 1L-17F and/or IL-17A/F including combinations thereof, either in a monovalent format, in a multivalent format (for example in a bivalent format) and/or in a multispecific format (for example one of the multispecific formats described hereinbelow);
  • immunogenicity either in a monovalent format, in a multivalent format (for example in a bivalent format) and/or in a multispecific format (for example one of the multispecific formats described hereinbelow);
  • IL-17A, IL-17F and/or IL- 17A/F including combinations thereof, either in a monovalent format, in a multivalent format (for example in a bivalent format) and/or in a multispecific format (for example one of the multispecific formats described hereinbelow);
  • IL-17A decreased or where desired increased cross-reactivity with any of IL-17A, IL- 17F and/or IL-17A/F including combinations thereof from different species;
  • one or more other improved properties desirable for pharmaceutical use including prophylactic use and/or therapeutic use
  • diagnostic use including but not limited to use for imaging purposes
  • a monovalent format in a multivalent format (for example in a bivalent format) and/or in a multispecific format (for example one of the multispecific formats described hereinbelow).
  • a multivalent format for example in a bivalent format
  • a multispecific format for example one of the multispecific formats described hereinbelow.
  • Nanobodies of the invention are preferably in essentially isolated form (as defined herein), or form part of a protein or polypeptide of the invention (as defined herein), which may comprise or essentially consist of one or more Nanobodies of the invention and which may optionally further comprise one or more further amino acid sequences (all optionally linked via one or more suitable linkers).
  • the one or more amino acid sequences (or ISV's) of the invention may be used as a binding unit in such a protein or polypeptide, which may optionally contain one or more further amino acid sequences (or ISV's) that can serve as a binding unit (i.e. against one or more other targets than any of IL- 17 A, IL-17F and/or IL-17A/F including combinations thereof), so as to provide a
  • Such a protein or polypeptide may comprise or essentially consist of one or more Nanobodies (or ISV's) of the invention and optionally one or more (other) Nanobodies (ISV's), i.e. directed against other targets than any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof, all optionally linked via one or more suitable linkers, so as to provide a monovalent, multivalent or multispecific Nanobody construct, respectively, as further described herein.
  • Such proteins or polypeptides may also be in essentially isolated form (as defined herein).
  • a Nanobody (or ISV) of the invention the binding site for binding against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof is preferably formed by the CDR sequences.
  • a Nanobody (or ISV) of the invention may also, and in addition to the at least one binding site for binding against any of IL- 17A, IL-17F and/or IL-17A/F including combinations thereof, contain one or more further binding sites for binding against other antigens, proteins or targets.
  • a Nanobody (or ISV) of the invention when a Nanobody (or ISV) of the invention (or a polypeptide of the invention comprising the same) is intended for administration to a subject (for example for therapeutic and/or diagnostic purposes as described herein), it is preferably directed against any of human LL-17A, EL-17F and/or IL-17A/F including combinations thereof; whereas for veterinary purposes, it is preferably directed against any of IL-17A, IL-17F and/or EL-17A/F including combinations thereof from the species to be treated.
  • a Nanobody (or ISV) of the invention may or may not be cross-reactive (i.e.
  • IL-17A, IL-17F and/or IL-17A/F including combinations thereof from two or more species of mammal, such as against any of human IL-17A, IL-17F and/or EL- 17A/F including combinations thereof and any of EL- 17 A, IL-17F and/or EL-17A/F including combinations thereof from at least one of the species of mammal mentioned herein).
  • the Nanobodies (or ISV's) of the invention may generally be directed against any antigenic determinant, epitope, part, domain, subunit or confirmation (where applicable) of any of IL-17A, IL-17F and/or EL-17A/F including combinations thereof.
  • the Nanobodies (or ISV's) of the invention are directed against the epitopes of the invention such as described herein.
  • the amino acid sequence and structure of a Nanobody can be considered - without however being limited thereto - to be comprised of four framework regions or "FR's" (or sometimes also referred to as “FW's"), which are referred to in the art and herein as “Framework region 1" or “FR1”; as “Framework region 2" or “FR2”; as “Framework region 3" or “FR3”; and as “Framework region 4" or “FR4", respectively; which framework regions are interrupted by three complementary determining regions or "CDR's", which are referred to in the art as “Complementarity Determining Region l “or “CDR1 "; as “Complementarity Determining Region 2" or “CDR2”; and as “Complementarity Determining Region 3” or “CDR3”, respectively.
  • the CDR sequences present in) the Nanobodies (or ISV's) of the invention are such that:
  • the Nanobodies can bind to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof with a dissociation constant (Kp) of 10 "5 to 10 "12 moles/liter or less, and preferably 10 "7 to 10 "12 moles/liter or less and more preferably 10 "8 to 10 " ' 2 moles/liter (i.e. with an association constant (K A ) of 10 5 to 10 12 liter/ moles or more, and preferably 10 7 to 10 12 liter/moles or more and more preferably 10 8 to 10 12 liter/moles);
  • Kp dissociation constant
  • K A association constant
  • the Nanobodies can bind to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof with a ko n -rate of between 10 2 M ⁇ 's " ' to about 10 7 M “ 's " ', preferably between 10 3 M “ 's ⁇ ' and 10 7 M “ 's " ', more preferably between 10 4 M 's " 1 and
  • the Nanobodies can bind to any of IL-17A, IL-17F and/or IL- 17A/F including combinations thereof with a koff rate between 1 s "1 (t
  • /2 0.69 s) and 10 "6 s " 1 (providing a near irreversible complex with a tm of multiple days), preferably between
  • 10 "2 s- 1 and 10 "6 s more preferably between 10 "3 s “1 and 10 "6 s “1 , such as between 10 "4 s "1 and 10 '6 s 1 .
  • the CDR sequences present in) the Nanobodies (or ISV's) of the invention are such that: a monovalent Nanobody (or ISV) of the invention (or a polypeptide that contains only one Nanobody (or ISV) of the invention) is preferably such that it will bind to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof with an affinity less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM.
  • the affinity of the Nanobody (or ISV) of the invention against any of IL-17A, IL-17F and/or IL- 17A/F including combinations thereof can be determined in a manner known per se, for example using the general techniques for measuring K - KA, koff or k on mentioned herein, as well as some of the specific assays described herein.
  • Nanobodies (or ISV's) of the invention and of polypeptides comprising the same) to any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof will become clear from the further description and examples herein.
  • the invention relates to a Nanobody (or ISV) (as defined herein) against any of EL-17A, IL-17F and/or EL-17A/F including combinations thereof, which consists of 4 framework regions (FR1 to FR4 respectively) and 3
  • CDR1 to CDR3 complementarity determining regions
  • CDR1 is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • - CDR2 is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • CDR3 is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ; or any suitable fragment of such an amino acid sequence.
  • the invention relates to a Nanobody (or ISV) (as defined herein) against any of IL-17A, IL-17F and/or IL-17A/F including combinations thereof, which consists of 4 framework regions (FR1 to FR4 respectively) and 3 complementarity determining regions (CDRl to CDR3 respectively), in which:
  • CDRl is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
  • CDR2 is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
  • CDR3 is chosen from the group consisting of:
  • amino acid sequences that have at least 80% amino acid identity with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ;
  • amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NOs: 481 to 551 ;
  • any amino acid substitution in such a CDR according to b) and/or c) is preferably, and compared to the corresponding CDR according to a), a conservative amino acid substitution (as defined herein);
  • the CDR according to b) and/or c) preferably only contains amino acid substitutions, and no amino acid deletions or insertions, compared to the corresponding CDR according to a);
  • the CDR according to b) and/or c) may be a CDR that is derived from a CDR according to a) by means of affinity maturation using one or more techniques of affinity maturation known per se.
  • Nanobody (or ISV) of the invention contains one or more CDR2 sequences according to e) and/or f):
  • any amino acid substitution in such a CDR according to e) and/or f) is preferably, and compared to the corresponding CDR according to d), a conservative amino acid substitution (as defined herein);
  • the CDR according to e) and/or f) preferably only contains amino acid substitutions, and no amino acid deletions or insertions, compared to the corresponding CDR according to d);
  • the CDR according to e) and/or f) may be a CDR that is derived from a CDR according to d) by means of affinity maturation using one or more techniques of affinity maturation known per se.
  • Nanobody (or ISV) of the invention contains one or more CDR3 sequences according to h) and/or i):
  • any amino acid substitution in such a CDR according to h) and/or i) is preferably, and compared to the corresponding CDR according to g), a conservative amino acid substitution (as defined herein);
  • the CDR according to h) and/or i) preferably only contains amino acid substitutions, and no amino acid deletions or insertions, compared to the corresponding CDR according to g);
  • the CDR according to h) and/or i) may be a CDR that is derived from a CDR according to g) by means of affinity maturation using one or more techniques of affinity maturation known per se.
  • Nanobody (or ISV) of the invention that comprises one or more CDR1 sequences, CDR2 sequences and/or CDR3 sequences according to b), c), e), f)» h) or i), respectively.
  • Nanobodies (or ISV's) of the invention Nanobodies (or ISV's) comprising one or more of the CDR's explicitly listed above are particularly preferred; Nanobodies (or ISV's) comprising two or more of the CDR's explicitly listed above are more particularly preferred; and Nanobodies (or ISV's) comprising three of the CDR's explicitly listed above are most particularly preferred.
  • CDR sequences are particularly preferred, but non-limiting combinations of CDR sequences, as well as preferred combinations of CDR sequences and framework sequences, are mentioned in Table B-1 below, which lists the CDR sequences and framework sequences that are present in a number of preferred (but non-limiting) Nanobodies (or ISV's) of the invention.
  • Table B-1 lists the CDR sequences and framework sequences that are present in a number of preferred (but non-limiting) Nanobodies (or ISV's) of the invention.
  • a combination of CDR 1 , CDR2 and CDR3 sequences that occur in the same clone i.e. CDR1 , CDR2 and CDR3 sequences that are mentioned on the same line in Table B-1
  • CDR1 , CDR2 and CDR3 sequences that are mentioned on the same line in Table B-1
  • will usually be preferred although the invention in its broadest sense is not limited thereto, and also comprises other suitable combinations of the CDR sequences mentioned in Table B-1 ).
  • CDR sequences and framework sequences that occur in the same clone i.e. CDR sequences and framework sequences that are mentioned on the same line, e.g. same row, in Table B-1
  • CDR sequences and framework sequences that are mentioned on the same line, e.g. same row, in Table B-1 will usually be preferred (although the invention in its broadest sense is not limited thereto, and also comprises other suitable combinations of the CDR sequences and framework sequences mentioned in Table B-1 , e.g. from different rows, as well as combinations of such CDR sequences and other suitable framework sequences, e.g. as further described herein).
  • each CDR can be replaced by a CDR chosen from the group consisting of amino acid sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity (as defined herein) with the mentioned CDR's; in which:
  • any amino acid substitution in such a CDR is preferably, and compared to the
  • any such CDR sequence preferably only contains amino acid substitutions, and no amino acid deletions or insertions, compared to the corresponding CDR sequence mentioned in Table B- 1 ;
  • any such CDR sequence is a CDR that is derived by means of a technique for affinity maturation known per se, and in particular starting from the corresponding CDR sequence mentioned in Table B-1.
  • Table B-1 Preferred combinations of CDR sequences, preferred comDinaaons of framework sequences, and preferred combinations of framework and CDR sequences.
  • At least one of the CDR1, CDR2 and CDR3 sequences present is suitably chosen from the group consisting of the CDR1 , CDR2 and CDR3 sequences, respectively, listed in Table B- l ; or from the group of CDR1, CDR2 and CDR3 sequences, respectively, that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% "sequence identity" (as defined herein) with at least one of the CDR1 , CDR2 and CDR3 sequences, respectively, listed in Table B- 1 ; and/or from the group consisting of the CDR 1 , CDR2 and CDR3 sequences, respectively, that have 3, 2 or only 1 "amino acid difference(s)" (as defined herein) with at least one of the CDR1 , CDR2 and CDR3 sequences, respectively, listed in Table B-l .
  • a CDR1 sequence is chosen from suitable CDR1 sequences (i.e. as defined herein)
  • a CDR2 sequence is chosen from suitable CDR2 sequences (i.e. as defined herein)
  • a CDR3 sequence is chosen from suitable CDR3 sequences (i.e. as defined herein), respectively.
  • the CDR sequences are preferably chosen such that the Nanobodies (or ISV's) of the invention bind to any of IL-17A, IL-17F and/or IL- 17A/F including combinations thereof with an affinity (suitably measured and/or expressed as a Kp-value (actual or apparent), a K A -value (actual or apparent), a ko n -rate and/or a koff-rate, or alternatively as an IC 5 o value, as further described herein) that is as defined herein.
  • an affinity suitably measured and/or expressed as a Kp-value (actual or apparent), a K A -value (actual or apparent), a ko n -rate and/or a koff-rate, or alternatively as an IC 5 o value, as further described herein
  • At least the CDR3 sequence present is suitably chosen from the group consisting of the CDR3 sequences listed in Table B-l or from the group of CDR3 sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the CDR3 sequences listed in Table B-l ; and/or from the group consisting of the CDR3 sequences that have 3, 2 or only 1 amino acid difference(s) with at least one of the CDR3 sequences listed in Table B-l .
  • At least two of the CDR1, CDR2 and CDR3 sequences present are suitably chosen from the group consisting of the CDR1 , CDR2 and CDR3 sequences, respectively, listed in Table B-l or from the group consisting of CDR1, CDR2 and CDR3 sequences, respectively, that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the CDRl, CDR2 and CDR3 sequences, respectively, listed in Table B-1 ; and/or from the group consisting of the CDRl, CDR2 and CDR3 sequences, respectively, that have 3, 2 or only 1 "amino acid difference(s)" with at least one of the CDRl, CDR2 and CDR3 sequences, respectively, listed in Table B-1.
  • At least the CDR3 sequence present is suitably chosen from the group consisting of the CDR3 sequences listed in Table B-1 or from the group of CDR3 sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the CDR3 sequences listed in Table B-1 , respectively; and at least one of the CDRl and CDR2 sequences present is suitably chosen from the group consisting of the CDR l and CDR2 sequences, respectively, listed in Table B-1 or from the group of CDRl and CDR2 sequences, respectively, that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the CDRl and CDR2 sequences, respectively, listed in Table B-1 ; and/or from the group consisting of the CDRl and CDR2 sequences, respectively, that have 3, 2 or only
  • all three CDRl , CDR2 and CDR3 sequences present are suitably chosen from the group consisting of the CDRl , CDR2 and CDR3 sequences, respectively, listed in Table B- 1 or from the group of CDRl , CDR2 and CDR3 sequences, respectively, that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the CDRl , CDR2 and CDR3 sequences, respectively, listed in Table B-1 ; and/or from the group consisting of the CDRl, CDR2 and CDR3 sequences, respectively, that have 3, 2 or only 1 amino acid difference(s) with at least one of the CDRl , CDR2 and CDR3 sequences, respectively, listed in Table B-1.
  • At least one of the CDRl , CDR2 and CDR3 sequences present is suitably chosen from the group consisting of the CDR l, CDR2 and CDR3 sequences, respectively, listed in Table B-1.
  • At least one or preferably both of the other two CDR sequences present are suitably chosen from CDR sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the corresponding CDR sequences, respectively, listed in Table B-l ; and/or from the group consisting of the CDR sequences that have 3, 2 or only 1 amino acid difference(s) with at least one of the corresponding sequences, respectively, listed in Table B-l .
  • At least the CDR3 sequence present is suitably chosen from the group consisting of the CDR3 listed in Table B- 1.
  • at least one and preferably both of the CDRl and CDR2 sequences present are suitably chosen from the groups of CDRl and CDR2 sequences, respectively, that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with the CDRl and CDR2 sequences, respectively, listed in Table B-l ; and/or from the group consisting of the CDRl and CDR2 sequences, respectively, that have 3, 2 or only 1 amino acid difference(s) with at least one of the CDRl and CDR2 sequences, respectively, listed in Table B-l .
  • the CDRl, CDR2 and CDR3 sequences present are suitably chosen from the group consisting of the CDRl, CDR2 and CDR3 sequences, respectively, listed in Table B-l .
  • the remaining CDR sequence present is suitably chosen from the group of CDR sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the corresponding CDR sequences listed in Table B-l ; and/or from the group consisting of CDR sequences that have 3, 2 or only 1 amino acid difference(s) with at least one of the corresponding sequences listed in Table B-l .
  • the CDR3 sequence is suitably chosen from the group consisting of the CDR3 sequences listed in Table B-l, and either the CDRl sequence or the CDR2 sequence is suitably chosen from the group consisting of the CDRl and CDR2 sequences, respectively, listed in Table B-l .
  • the remaining CDR sequence present is suitably chosen from the group of CDR sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the corresponding CDR sequences listed in Table B-1 ; and/or from the group consisting of CDR sequences that have 3, 2 or only 1 amino acid difference(s) with the corresponding CDR sequences listed in Table B-1.
  • each of the Nanobodies (or ISV's) of the invention each of the
  • CDRl, CDR2 and CDR3 sequences present are suitably chosen from the group consisting of the CDRl , CDR2 and CDR3 sequences, respectively, listed in Table B-1.
  • a CDR in a Nanobody (or ISV) of the invention is a CDR sequence mentioned in Table B-1 or is suitably chosen from the group of CDR sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with a CDR sequence listed in Table B-1; and/or from the group consisting of CDR sequences that have 3, 2 or only 1 amino acid difference(s) with a CDR sequence listed in Table B-1 , that at least one and preferably both of the other CDR's are suitably chosen from the CDR sequences that belong to the same combination in Table B-1 (i.e.
  • a Nanobody (or ISV) of the invention can for example comprise a CDRl sequence that has more than 80 % sequence identity with one of the CDRl sequences mentioned in Table B-1 , a CDR2 sequence that has 3, 2 or 1 amino acid difference with one of the CDR2 sequences mentioned in Table B-1 (but belonging to a different combination, e.g. from at least one different row), and a CDR3 sequence.
  • Nanobodies (or ISV's) of the invention may for example comprise: ( 1 ) a CDRl sequence that has more than 80 % sequence identity with one of the CDRl sequences mentioned in Table B-1; a CDR2 sequence that has 3, 2 or 1 amino acid difference with one of the CDR2 sequences mentioned in Table B-1 (but belonging to a different combination, e.g.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Transplantation (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/EP2012/058313 2011-05-05 2012-05-04 Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same Ceased WO2012156219A1 (en)

Priority Applications (25)

Application Number Priority Date Filing Date Title
UAA201314154A UA117218C2 (uk) 2011-05-05 2012-04-05 Поліпептид, спрямований проти il-17a, il-17f та/або il17-a/f
HRP20180380TT HRP20180380T1 (hr) 2011-05-05 2012-05-04 Sekvence aminokiseline usmjerene protiv il-17a, il-17f i/ili il17-a/f i polipeptidi koji ih sadrže
DK12726593.2T DK2705058T3 (en) 2011-05-05 2012-05-04 AMINO ACID SEQUENCES AGAINST IL-17A, IL-17F AND / OR IL17-A / F AND POLYPEPTIDES INCLUDING THESE
JP2014508842A JP6628965B2 (ja) 2011-05-05 2012-05-04 Il−17a、il−17fおよび/またはil17−a/fに対するアミノ酸配列および前記アミノ酸配列を含むポリペプチド
US14/115,549 US10017568B2 (en) 2011-05-05 2012-05-04 Polypeptides that bind to IL-17A, IL-17F and/or IL17-A/F and method of treatment using same
EA201391632A EA035973B9 (en) 2011-05-05 2012-05-04 Amino acid sequences directed against il-17a, il-17f and/or il-17a/f and polypeptides comprising the same
CN201280033175.1A CN103717618B (zh) 2011-05-05 2012-05-04 抗il-17a,il-17f和/或il17-a/f的氨基酸序列以及包含其的多肽
EP22169137.1A EP4105231A1 (en) 2011-05-05 2012-05-04 Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
AU2012257942A AU2012257942B8 (en) 2011-05-05 2012-05-04 Amino acid sequences directed against IL-17A, IL-17F and/or IL17-A/F and polypeptides comprising the same
MX2013012844A MX2013012844A (es) 2011-05-05 2012-05-04 Secuencias de aminoacidos dirigidas contra il-17a, il-17f y/o il-17a/f y polipeptidos que comprenden las mismas.
SG2013079371A SG194632A1 (en) 2011-05-05 2012-05-04 Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
ES12726593.2T ES2662371T3 (es) 2011-05-05 2012-05-04 Secuencias de aminoácidos dirigidas contra IL-17A, IL-17F y/o IL-17A/F y polipéptidos que comprenden las mismas
BR112013028407-2A BR112013028407B1 (pt) 2011-05-05 2012-05-04 Polipeptídeos compreendendo um domínio variável único da imunoglobulina (isv) de ligação a il-17a, il-17f e/ou il17-a/f seus usos e composição farmacêutica compreendendo os mesmos
KR1020137032085A KR102083230B1 (ko) 2011-05-05 2012-05-04 Il-17a, il-17f 및/또는 il-17a/f를 겨냥하는 아미노산 서열 및 이를 포함하는 폴리펩타이드
LTEP12726593.2T LT2705058T (lt) 2011-05-05 2012-05-04 Aminorūgščių sekos, nukreiptos prieš il-17a, il-17f ir (arba) il17-a/f ir (arba) ir jas apimantys peptidai
CA2834907A CA2834907C (en) 2011-05-05 2012-05-04 Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
EP18150770.8A EP3363815A1 (en) 2011-05-05 2012-05-04 Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
PH1/2013/502234A PH12013502234A1 (en) 2011-05-05 2012-05-04 Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
SI201231255T SI2705058T1 (en) 2011-05-05 2012-05-04 The amino acid sequences directed against IL-17A, IL-17F and / or IL-17A / F, and polypeptides comprising these sequences
EP12726593.2A EP2705058B1 (en) 2011-05-05 2012-05-04 Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
NZ616761A NZ616761A (en) 2011-05-05 2012-05-04 Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
IL228813A IL228813B (en) 2011-05-05 2013-10-10 A polypeptide containing a first and second immunoglobulin each containing a single variable site and its use in the treatment of diseases
US16/002,135 US10829552B2 (en) 2011-05-05 2018-06-07 Polypeptides that bind to IL-17A, IL-17F and/or IL17-A/F and methods of treatment using same
US17/036,602 US11773159B2 (en) 2011-05-05 2020-09-29 Polypeptides that bind to IL-17A, IL-17F and/or IL17-A/F and methods of treatment using same
US17/679,675 US20220195031A1 (en) 2011-05-05 2022-02-24 Amino acid sequences directed against il-17a, il-17f and/or il-17a/f and polypeptides comprising the same

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201161482802P 2011-05-05 2011-05-05
US61/482,802 2011-05-05

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/115,549 A-371-Of-International US10017568B2 (en) 2011-05-05 2012-05-04 Polypeptides that bind to IL-17A, IL-17F and/or IL17-A/F and method of treatment using same
US16/002,135 Division US10829552B2 (en) 2011-05-05 2018-06-07 Polypeptides that bind to IL-17A, IL-17F and/or IL17-A/F and methods of treatment using same

Publications (2)

Publication Number Publication Date
WO2012156219A1 true WO2012156219A1 (en) 2012-11-22
WO2012156219A9 WO2012156219A9 (en) 2013-04-18

Family

ID=46245559

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2012/058313 Ceased WO2012156219A1 (en) 2011-05-05 2012-05-04 Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same

Country Status (25)

Country Link
US (4) US10017568B2 (cg-RX-API-DMAC7.html)
EP (3) EP2705058B1 (cg-RX-API-DMAC7.html)
JP (5) JP6628965B2 (cg-RX-API-DMAC7.html)
KR (1) KR102083230B1 (cg-RX-API-DMAC7.html)
CN (2) CN103717618B (cg-RX-API-DMAC7.html)
AU (1) AU2012257942B8 (cg-RX-API-DMAC7.html)
BR (1) BR112013028407B1 (cg-RX-API-DMAC7.html)
CA (1) CA2834907C (cg-RX-API-DMAC7.html)
CL (1) CL2013003090A1 (cg-RX-API-DMAC7.html)
DK (1) DK2705058T3 (cg-RX-API-DMAC7.html)
EA (1) EA035973B9 (cg-RX-API-DMAC7.html)
ES (1) ES2662371T3 (cg-RX-API-DMAC7.html)
HR (1) HRP20180380T1 (cg-RX-API-DMAC7.html)
HU (1) HUE037225T2 (cg-RX-API-DMAC7.html)
IL (1) IL228813B (cg-RX-API-DMAC7.html)
LT (1) LT2705058T (cg-RX-API-DMAC7.html)
MX (1) MX2013012844A (cg-RX-API-DMAC7.html)
MY (1) MY167231A (cg-RX-API-DMAC7.html)
NZ (1) NZ616761A (cg-RX-API-DMAC7.html)
PH (1) PH12013502234A1 (cg-RX-API-DMAC7.html)
PT (1) PT2705058T (cg-RX-API-DMAC7.html)
SG (2) SG10201606409TA (cg-RX-API-DMAC7.html)
SI (1) SI2705058T1 (cg-RX-API-DMAC7.html)
UA (1) UA117218C2 (cg-RX-API-DMAC7.html)
WO (1) WO2012156219A1 (cg-RX-API-DMAC7.html)

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014076321A1 (en) * 2012-11-19 2014-05-22 Pieris Ag Novel specific-binding polypeptides and uses thereof
WO2014202745A1 (fr) * 2013-06-21 2014-12-24 Institut National De La Recherche Agronomique Anticorps monocaténaire à chaîne lourde de camélidé dirigé contre la chromatine et utilisations
WO2015191783A2 (en) 2014-06-10 2015-12-17 Abbvie Inc. Biomarkers for inflammatory disease and methods of using same
WO2015177175A3 (en) * 2014-05-22 2016-02-18 Pieris Ag Novel specific-binding polypeptides and uses thereof
WO2016113557A1 (en) * 2015-01-12 2016-07-21 Crescendo Biologics Limited Il-17a binding proteins
WO2016118733A1 (en) 2015-01-21 2016-07-28 Inhibrx Biopharma LLC Non-immunogenic single domain antibodies
WO2017072183A1 (en) * 2015-10-27 2017-05-04 Ucb Biopharma Sprl Methods of treatment using anti-il-17a/f antibodies
WO2017102830A1 (en) * 2015-12-18 2017-06-22 Ucb Biopharma Sprl Multi-specific antibody molecules having specificity for tnf-alpha, il-17a and il-17f
WO2018011555A1 (en) * 2016-07-11 2018-01-18 Crescendo Biologics Limited Composition for treatment of disorders
WO2018148585A1 (en) 2017-02-10 2018-08-16 Genentech, Inc. Anti-tryptase antibodies, compositions thereof, and uses thereof
EP3199550A4 (en) * 2014-09-26 2018-09-26 Closed Joint Stock Company "Biocad" High affinity and aggregatively stable antibodies on the basis of variable domains vl and a derivative vhh
CN109641953A (zh) * 2016-04-29 2019-04-16 Biocad股份有限公司 针对il-17a、il-17f和其他促炎性分子的三特异性抗体
WO2022012636A1 (en) * 2020-07-15 2022-01-20 Biocytogen Pharmaceuticals (Beijing) Co., Ltd. Genetically modified non-human animal with human or chimeric il17a and/or il17f
WO2022040506A3 (en) * 2020-08-21 2022-04-07 Yale University Nanobody compositions and methods of use of the same
JP7325928B2 (ja) 2014-05-16 2023-08-15 アブリンクス エン.ヴェー. 改善された免疫グロブリン可変ドメイン
CN117866903A (zh) * 2024-03-12 2024-04-12 北京贝来药业有限公司 单域抗体修饰的干细胞及其在疾病治疗中用途
WO2024133935A1 (en) 2022-12-23 2024-06-27 Ablynx Nv Protein-based conjugation carriers
EP4393948A1 (en) * 2022-12-28 2024-07-03 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Therapeutic vhh antibodies cross-neutralizing the il-17a and il-17f homodimers as well as the il-17af heterodimer
WO2024170756A1 (en) 2023-02-17 2024-08-22 Ablynx N.V. Polypeptides binding to the neonatal fc receptor
USRE50682E1 (en) 2014-05-16 2025-12-02 Ablynx Nv Immunoglobulin variable domains

Families Citing this family (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2571901B1 (en) 2010-05-20 2019-01-02 Ablynx N.V. Biological materials related to her3
UA117218C2 (uk) 2011-05-05 2018-07-10 Мерк Патент Гмбх Поліпептид, спрямований проти il-17a, il-17f та/або il17-a/f
UA117608C2 (uk) 2014-02-21 2018-08-27 Дженентек, Інк. Спосіб лікування еозинофільного захворювання у пацієнта шляхом застосування біспецифічного анти-il-13/il-17 антитіла
AR103173A1 (es) 2014-12-22 2017-04-19 Novarits Ag Productos farmacéuticos y composiciones líquidas estables de anticuerpos il-17
JP2018506275A (ja) 2015-01-28 2018-03-08 ジェネンテック, インコーポレイテッド 多発性硬化症の遺伝子発現マーカー及び治療
CN108359011B (zh) * 2017-07-21 2019-06-25 华博生物医药技术(上海)有限公司 靶向于白介素17a的抗体、其制备方法和应用
CN107857818A (zh) * 2017-08-07 2018-03-30 上海科新生物技术股份有限公司 一种针对IL‑17和TNF‑α的双特异性融合蛋白
CN111699003B (zh) * 2017-12-19 2024-05-03 瑟罗泽恩奥普瑞汀公司 抗lrp5/6抗体和使用方法
WO2019154420A1 (zh) * 2018-02-12 2019-08-15 上海原能细胞医学技术有限公司 Il17抗体及其应用
CN110003329B (zh) * 2019-04-12 2022-09-27 深圳普瑞金生物药业股份有限公司 多肽、il17a/f单域抗体、核苷酸序列及试剂盒
CN117642423A (zh) * 2021-09-13 2024-03-01 深圳华普药物研发有限公司 一种il17抗体及其制备方法和应用
CN114380906B (zh) * 2022-03-25 2022-06-14 南京融捷康生物科技有限公司 一种抗il-17a的单域抗体及其用途
WO2023186174A1 (en) * 2022-04-01 2023-10-05 Zai Lab (Shanghai) Co., Ltd. Topical formulation comprising an il-17a binding molecule and uses thereof
IL316438A (en) 2022-04-22 2024-12-01 Moonlake Immunotherapeutics Ag Methods for achieving safe and sustained control of IL-17-dependent conditions in subjects responding to treatment with anti-IL-17A/F nanobodies
CN115093483B (zh) * 2022-06-17 2025-06-03 国药中生生物技术研究院有限公司 Il-17ra融合蛋白、药物组合物、注射剂及其应用
KR20260005198A (ko) * 2023-04-18 2026-01-09 문레이크 이뮤노테라퓨틱스 아게 Il-17 의존성 질환의 바이오마커 기반 치료 및 진단 방법
CN116769027B (zh) * 2023-06-09 2023-12-01 康元医疗科技(大连)有限公司 一种抗il-17纳米抗体、多肽及其应用
AU2024334289A1 (en) 2023-08-25 2026-04-09 Proteologix Us Inc. Anti-il-13 multispecific antibody constructs and uses thereof
CN120399065B (zh) * 2023-12-21 2025-10-14 北京贝来药业有限公司 抗il-17a纳米抗体、药物组合物、方法及用途
CN117843776B (zh) * 2023-12-21 2024-08-30 北京贝来药业有限公司 抗体分子、核酸、制药用途及炎性疾病治疗方法
CN120349412B (zh) * 2023-12-21 2025-10-24 北京贝来生物科技有限公司 新型抗il-17a单域抗体、制备及其应用
CN117820481B (zh) * 2023-12-29 2025-02-14 北京贝来药业有限公司 新型抗体分子及其制药用途
CN117843801B (zh) * 2023-12-29 2024-08-02 北京贝来药业有限公司 以白介素家族成员为靶点的新型抗体以及下游产品
CN117843805B (zh) * 2023-12-29 2024-09-06 北京贝来药业有限公司 抗体分子、核酸分子、药物组合物以及应用
CN117843804B (zh) * 2023-12-29 2024-08-20 北京贝来药业有限公司 单域抗体串联分子及其序列、产品、制备和应用
CN118206654B (zh) * 2024-03-05 2024-09-20 北京贝来药业有限公司 用于疾病治疗的新型抗体及其产品和应用
CN117866904B (zh) * 2024-03-12 2024-06-07 北京贝来药业有限公司 基于单域抗体基因修饰的干细胞对于多种的疾病的制药用途
CN117860786B (zh) * 2024-03-12 2024-06-04 北京贝来药业有限公司 基因修饰间充质干细胞在多种疾病中的制药用途和诊断用途
CN117866905B (zh) * 2024-03-12 2024-06-04 北京贝来药业有限公司 基于纳米抗体基因修饰的干细胞及其制备方法和产品

Citations (76)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0368684A1 (en) 1988-11-11 1990-05-16 Medical Research Council Cloning immunoglobulin variable domain sequences.
WO1991001743A1 (en) 1989-08-01 1991-02-21 Cemu Bioteknik Ab Stabilized protein or peptide conjugates
EP0542810A1 (en) 1990-08-02 1993-05-26 B.R. Centre Limited Methods for the production of proteins with a desired function
WO1994002610A1 (en) 1992-07-17 1994-02-03 Dana-Farber Cancer Institute Method of intracellular binding of target molecules
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
WO1994029457A2 (en) 1993-06-09 1994-12-22 Unilever N.V. Process for producing fusion proteins comprising scfv fragments by a transformed mould
EP0640130A1 (en) 1992-05-08 1995-03-01 Creative Biomolecules, Inc. Chimeric multivalent protein analogues and methods of use thereof
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
WO1995022618A1 (en) 1994-02-22 1995-08-24 Dana-Farber Cancer Institute Nucleic acid delivery system, method of synthesis and uses thereof
WO1996034103A1 (en) 1995-04-25 1996-10-31 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
WO1998022141A2 (en) 1996-11-19 1998-05-28 Sangstat Medical Corporation Enhanced effects for hapten conjugated therapeutics
WO1999023221A2 (en) 1997-10-27 1999-05-14 Unilever Plc Multivalent antigen-binding proteins
WO1999037681A2 (en) 1998-01-26 1999-07-29 Unilever Plc Method for producing antibody fragments
WO1999042077A2 (en) 1998-02-19 1999-08-26 Xcyte Therapies, Inc. Compositions and methods for regulating lymphocyte activation
WO2000027435A1 (en) 1998-11-10 2000-05-18 Celltech Therapeutics Limited Antibody-serum protein hybrids
WO2000043507A1 (en) 1999-01-19 2000-07-27 Unilever Plc Method for producing antibody fragments
WO2001045746A2 (en) 1999-12-24 2001-06-28 Genentech, Inc. Methods and compositions for prolonging elimination half-times of bioactive compounds
US6304489B1 (en) 1993-08-27 2001-10-16 Hiroshi Iwahashi Non-volatile semiconductor memory device and data programming method
WO2001077137A1 (en) 2000-04-12 2001-10-18 Human Genome Sciences, Inc. Albumin fusion proteins
WO2001090190A2 (en) 2000-05-26 2001-11-29 National Research Council Of Canada Single-domain antigen-binding antibody fragments derived from llama antibodies
WO2002057445A1 (en) 2000-05-26 2002-07-25 National Research Council Of Canada Single-domain brain-targeting antibody fragments derived from llama antibodies
WO2002056910A1 (en) 2001-01-17 2002-07-25 Trubion Pharmaceuticals, Inc. Binding domain-immunoglobulin fusion proteins
WO2002076489A1 (en) 2001-03-09 2002-10-03 Dyax Corp. Serum albumin binding moieties
WO2002085945A2 (en) 2001-04-24 2002-10-31 Erasmus Universiteit Rotterdam Vhh single heavy chain antibody and a method for its preparation in a mammal
US20020177188A1 (en) 1998-05-15 2002-11-28 Genentech, Inc. IL-17 homologous polypeptides and therapeutic uses thereof
WO2003002609A2 (en) 2001-06-28 2003-01-09 Domantis Limited Dual-specific ligand and its use
WO2003014960A2 (en) 2001-08-03 2003-02-20 Medical Research Council Method of identifying a consensus sequence for intracellular antibodies
WO2003025020A1 (en) 2001-09-13 2003-03-27 Institute For Antibodies Co., Ltd. Method of constructing camel antibody library
WO2003035694A2 (en) 2001-10-24 2003-05-01 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof
WO2003050531A2 (en) 2001-12-11 2003-06-19 Algonomics N.V. Method for displaying loops from immunoglobulin domains in different contexts
WO2003054016A2 (en) 2001-12-21 2003-07-03 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Method for cloning of variable domain sequences
WO2003055527A2 (en) 2002-01-03 2003-07-10 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Immunoconjugates useful for treatment of tumours
WO2004003019A2 (en) 2002-06-28 2004-01-08 Domantis Limited Immunoglobin single variant antigen-binding domains and dual-specific constructs
WO2004041867A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders
WO2004041865A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Stabilized single domain antibodies
US6741957B1 (en) 2000-07-21 2004-05-25 Daimlerchrysler Corporation Analytical tire model for vehicle durability and ride comfort analysis
WO2004049794A2 (en) 2002-12-03 2004-06-17 The Babraham Institute Single chain antibodies produced in a transgenic mouse
WO2004051268A1 (en) 2002-12-03 2004-06-17 Celltech R & D Limited Assay for identifying antibody producing cells
WO2004058820A2 (en) 2002-12-27 2004-07-15 Domantis Limited Single-domain-effector group and its uses
WO2004060965A2 (en) 2002-12-31 2004-07-22 Nektar Therapeutics Al, Corporation Hydrolytically stable maleimide-terminated polymers
WO2004081026A2 (en) 2003-06-30 2004-09-23 Domantis Limited Polypeptides
WO2004106377A1 (en) 2003-05-30 2004-12-09 Celltech R & D Limited Methods for producing antibodies
US6849992B2 (en) 2001-12-03 2005-02-01 Samsung Sdi Co., Ltd. Plasma display device having efficient heat conductivity
WO2005010044A2 (en) 2003-07-08 2005-02-03 Genentech, Inc. Il-17 a/f heterologous polypeptides and therapeutic uses thereof
WO2005017148A1 (en) 2003-07-26 2005-02-24 Trubion Pharmaceuticals, Inc. Binding constructs and methods for use thereof
WO2005019824A1 (en) 2003-08-20 2005-03-03 Celltech R & D Limited Methods for obtaining antibodies
WO2005018629A1 (en) 2003-08-12 2005-03-03 Yarbrough William M Treatment for acne vulgaris and method of use
WO2006003388A2 (en) 2004-06-30 2006-01-12 Domantis Limited Compositions and methods for treating inflammatory disorders
WO2006007260A2 (en) 2004-06-21 2006-01-19 Masco Corporation Of Indiana Fluid filter assembly for a dispensing faucet
WO2006008548A2 (en) 2004-07-22 2006-01-26 Erasmus University Medical Centre Rotterdam Binding molecules
WO2006012282A1 (en) 2004-06-25 2006-02-02 The Procter & Gamble Company Flexible laminate having an integrated pressure release valve
WO2006012278A2 (en) 2004-06-25 2006-02-02 Ambis Edward J Jr Custom mouthguard
US7004940B2 (en) 2002-10-10 2006-02-28 Ethicon, Inc. Devices for performing thermal ablation having movable ultrasound transducers
WO2006030220A1 (en) 2004-09-17 2006-03-23 Domantis Limited Compositions monovalent for cd40l binding and methods of use
WO2006040154A2 (en) 2004-10-14 2006-04-20 Dublin City University Prokaryotic two hybrid system
WO2006040153A2 (en) 2004-10-13 2006-04-20 Ablynx N.V. Single domain camelide anti -amyloid beta antibodies and polypeptides comprising the same for the treatment and diagnosis of degenarative neural diseases such as alzheimer's disease
WO2006054059A1 (en) * 2004-11-19 2006-05-26 Ucb Pharma S.A. Neutralising antibody molecules having specificity for human il-17
WO2006079372A1 (en) 2005-01-31 2006-08-03 Ablynx N.V. Method for generating variable domain sequences of heavy chain antibodies
WO2006122825A2 (en) 2005-05-20 2006-11-23 Ablynx Nv Single domain vhh antibodies against von willebrand factor
WO2006122787A1 (en) 2005-05-18 2006-11-23 Ablynx Nv Serum albumin binding proteins
WO2007112940A2 (en) 2006-03-31 2007-10-11 Ablynx N.V. Albumin-derived amino acid sequence, use thereof for increasing the half-life of therapeutic proteins and of other therapeutic compounds and entities, and constructs comprising the same
WO2007118670A1 (en) 2006-04-14 2007-10-25 Ablynx N.V. Dp-78-like nanobodies
WO2008000279A1 (en) 2006-06-26 2008-01-03 Aida Centre, S.L. Blister package integrating rfid based tags
WO2008020079A1 (en) 2006-08-18 2008-02-21 Ablynx N.V. Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling
WO2008028977A2 (en) 2006-09-08 2008-03-13 Ablynx N.V. Serum albumin binding proteins with long half-lives
WO2008043822A2 (en) 2006-10-11 2008-04-17 Ablynx N. V. Amino acid sequences that bind to a desired molecule in a conditional manner
WO2008043821A1 (en) 2006-10-11 2008-04-17 Ablynx N. V. Amino acid sequences that bind to serum proteins in a manner that is essentially independent of the ph, compounds comprising the same, and use thereof
WO2008047134A2 (en) * 2006-10-18 2008-04-24 Ucb Pharma S.A. Antibody molecules which bind il-17a and il-17f
WO2008068280A1 (en) 2006-12-05 2008-06-12 Ablynx N.V. Peptides capable of binding to serum proteins
WO2009068627A2 (en) 2007-11-27 2009-06-04 Ablynx N.V. Amino acid sequences directed against heterodimeric cytokines and/or their receptors and polypeptides comprising the same
WO2009095235A1 (en) 2008-01-29 2009-08-06 Ablynx N.V. Methods to stabilize proteins and polypeptides
WO2009127691A1 (en) 2008-04-17 2009-10-22 Ablynx N.V. Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same
WO2009136286A2 (en) * 2008-05-05 2009-11-12 Novimmune Sa Anti-il-17a/il-17f cross-reactive antibodies and methods of use thereof
WO2009138519A1 (en) 2008-05-16 2009-11-19 Ablynx Nv AMINO ACID SEQUENCES DIRECTED AGAINST CXCR4 AND OTHER GPCRs AND COMPOUNDS COMPRISING THE SAME
WO2010025400A2 (en) * 2008-08-29 2010-03-04 Genentech, Inc. Cross-reactive and bispecific anti-el 17a/f antibodies
WO2010125187A2 (en) 2009-04-30 2010-11-04 Ablynx Nv Method for the production of domain antibodies

Family Cites Families (48)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL162181A (en) 1988-12-28 2006-04-10 Pdl Biopharma Inc A method of producing humanized immunoglubulin, and polynucleotides encoding the same
US6562333B1 (en) 1993-06-14 2003-05-13 Schering Corporation Purified mammalian CTLA-8 antigens and related reagents
US6274711B1 (en) 1993-06-14 2001-08-14 Inserm, Institut National De La Sante Et De La Recherche Medicale Purified mammalian CTLA-8 antigens and related reagents
US6074849A (en) 1995-07-19 2000-06-13 Genetics Institute, Inc. Polynucleotides encoding human CTLA-8 related proteins
US6902735B1 (en) 1995-07-19 2005-06-07 Genetics Institute, Llc Antibodies to human IL-17F and other CTLA-8-related proteins
DE69634726T2 (de) 1995-07-19 2006-05-04 Genetics Institute, LLC, Cambridge Menschliche ctla-8 und verwendung von ctla-8 ähnlichen proteinen
US6486303B1 (en) 1998-04-14 2002-11-26 University Of Medicine & Dentistry Of New Jersey Method for making hormone heterodimers
AU6277799A (en) 1998-10-02 2000-04-26 Eli Lilly And Company Il-17 homolog nucleic acids, polypeptides, vectors, host cells, methods and usesthereof
EP1053751A1 (en) 1999-05-17 2000-11-22 Institut National De La Sante Et De La Recherche Medicale (Inserm) Compositions and methods for treating cell proliferation disorders
ES2380812T3 (es) 1999-12-23 2012-05-18 Genentech, Inc. Polipéptidos homólogos a IL-17 y usos terapéuticos de los mismos
AU2002242142A1 (en) 2001-02-09 2002-08-28 Johns Hopkins University A cytokine related structurally to il-17
US20070160576A1 (en) 2001-06-05 2007-07-12 Genentech, Inc. IL-17A/F heterologous polypeptides and therapeutic uses thereof
US20080241166A1 (en) 2002-06-28 2008-10-02 Domantis Limited Ligands that bind a receptor
JP2006517789A (ja) 2003-01-10 2006-08-03 アブリンクス エン.ヴェー. 治療用ポリペプチド、その相同物、その断片、および血小板媒介凝集の調節での使用
US7235641B2 (en) * 2003-12-22 2007-06-26 Micromet Ag Bispecific antibodies
CN100396019C (zh) 2004-07-31 2008-06-18 华为技术有限公司 移动终端数据源模拟方法
GB0417487D0 (en) 2004-08-05 2004-09-08 Novartis Ag Organic compound
FR2879605B1 (fr) * 2004-12-16 2008-10-17 Centre Nat Rech Scient Cnrse Production de formats d'anticorps et applications immunologiques de ces formats
MY142617A (en) 2004-12-23 2010-12-15 Domantis Ltd Dual specific ligands with increased serum half-life
GT200600065A (es) 2005-02-14 2006-10-02 Anticuerpos para interleucina-17f y otros antagonistas de la señalizacion de il-17f y sus usos
WO2007042289A2 (en) 2005-10-11 2007-04-19 Ablynx N.V. Nanobodies™ and polypeptides against egfr and igf-ir
US20090252681A1 (en) 2005-10-11 2009-10-08 Ablynx N.V. Nanobodies and Polypeptides Against EGFR and IGF-IR
AR056857A1 (es) 2005-12-30 2007-10-24 U3 Pharma Ag Anticuerpos dirigidos hacia her-3 (receptor del factor de crecimiento epidérmico humano-3) y sus usos
US7790862B2 (en) 2006-06-13 2010-09-07 Zymogenetics, Inc. IL-17 and IL-23 antagonists and methods of using the same
TW200815469A (en) 2006-06-23 2008-04-01 Astrazeneca Ab Compounds
GB0612928D0 (en) 2006-06-29 2006-08-09 Ucb Sa Biological products
US7767206B2 (en) 2006-10-02 2010-08-03 Amgen Inc. Neutralizing determinants of IL-17 Receptor A and antibodies that bind thereto
KR101598229B1 (ko) 2007-02-16 2016-02-26 메리맥 파마슈티컬즈, 인크. Erbb3에 대한 항체 및 이의 용도
US7790676B2 (en) 2007-03-28 2010-09-07 Zymogenetics, Inc. Soluble IL-17RA/RC fusion proteins
JP2010532764A (ja) 2007-07-06 2010-10-14 トゥルビオン・ファーマシューティカルズ・インコーポレーテッド C末端に配置された特異的結合性ドメインを有する結合性ペプチド
WO2009082624A2 (en) 2007-12-10 2009-07-02 Zymogenetics, Inc. Antagonists of il-17a, il-17f, and il-23 and methods of using the same
NZ591484A (en) 2008-09-29 2012-09-28 Roche Glycart Ag Antibodies against human il 17 and uses thereof
TWI541021B (zh) 2009-03-05 2016-07-11 艾伯維有限公司 Il-17結合蛋白
CN102458437B (zh) 2009-05-05 2015-06-10 诺维莫尼公司 抗il-17f抗体及其使用方法
WO2010142551A2 (en) * 2009-06-12 2010-12-16 Ablynx N.V. Single variable domain (vhh) antibodies to cytokines of the il-17 receptor family
EP2493506B1 (en) 2009-10-30 2019-04-10 Janssen Biotech, Inc. Il-17a antagonists
PH12012501364A1 (en) 2010-01-15 2012-10-22 Amgen K A Inc Antibody formulation and therapeutic regimens
US8965476B2 (en) * 2010-04-16 2015-02-24 Sanofi-Aventis Deutschland Gmbh Tissue penetration device
CN103154031A (zh) 2010-10-08 2013-06-12 诺华有限公司 利用il-17拮抗剂治疗牛皮癣的方法
BR112013011176A2 (pt) 2010-11-05 2020-09-01 Novartis Ag métodos de tratamento de artrite reumatoide usando antagonistas de il-17
ME02734B (me) 2011-01-14 2017-10-20 Ucb Biopharma Sprl Antitelo koje vezuje il-17a i il-17f
TWI439451B (zh) 2011-03-24 2014-06-01 Hoffmann La Roche 雜環胺衍生物
UA117218C2 (uk) 2011-05-05 2018-07-10 Мерк Патент Гмбх Поліпептид, спрямований проти il-17a, il-17f та/або il17-a/f
RU2014121043A (ru) 2011-10-24 2015-12-10 Эббви Инк. Биспецифические иммуносвязывающие средства, направленные против tnf и il-17
WO2013150043A1 (en) 2012-04-05 2013-10-10 F. Hoffmann-La Roche Ag Bispecific antibodies against human tweak and human il17 and uses thereof
AR090626A1 (es) 2012-04-20 2014-11-26 Lilly Co Eli Anticuerpos anti-baff-anti-il-17 biespecificos
LT2953969T (lt) 2013-02-08 2019-12-10 Novartis Ag Anti-il-17a antikūnai ir jų panaudojimas autoimuninių ir uždegiminių ligų gydymui
CL2015001213A1 (es) 2015-05-07 2015-07-10 Pontificia Universidad Católica De Chile Método ex vivo para predecir respuesta a un tratamiento inmunomodulador en pacientes con enfermedad inflamatoria, el cual comprende la cuantificación de las razones entre las concentraciones de citoquinas seleccionadas de ifn-gamma/il-17f, il17f/il-10, il-17f/ifn-gamma e il-10/il17f; y kit para llevar a cabo el método.

Patent Citations (79)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0368684B1 (en) 1988-11-11 1994-03-09 Medical Research Council Cloning immunoglobulin variable domain sequences.
EP0368684A1 (en) 1988-11-11 1990-05-16 Medical Research Council Cloning immunoglobulin variable domain sequences.
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
WO1991001743A1 (en) 1989-08-01 1991-02-21 Cemu Bioteknik Ab Stabilized protein or peptide conjugates
EP0542810A1 (en) 1990-08-02 1993-05-26 B.R. Centre Limited Methods for the production of proteins with a desired function
EP0640130A1 (en) 1992-05-08 1995-03-01 Creative Biomolecules, Inc. Chimeric multivalent protein analogues and methods of use thereof
WO1994002610A1 (en) 1992-07-17 1994-02-03 Dana-Farber Cancer Institute Method of intracellular binding of target molecules
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
WO1994029457A2 (en) 1993-06-09 1994-12-22 Unilever N.V. Process for producing fusion proteins comprising scfv fragments by a transformed mould
US6304489B1 (en) 1993-08-27 2001-10-16 Hiroshi Iwahashi Non-volatile semiconductor memory device and data programming method
WO1995022618A1 (en) 1994-02-22 1995-08-24 Dana-Farber Cancer Institute Nucleic acid delivery system, method of synthesis and uses thereof
WO1996034103A1 (en) 1995-04-25 1996-10-31 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
WO1998022141A2 (en) 1996-11-19 1998-05-28 Sangstat Medical Corporation Enhanced effects for hapten conjugated therapeutics
WO1999023221A2 (en) 1997-10-27 1999-05-14 Unilever Plc Multivalent antigen-binding proteins
WO1999037681A2 (en) 1998-01-26 1999-07-29 Unilever Plc Method for producing antibody fragments
WO1999042077A2 (en) 1998-02-19 1999-08-26 Xcyte Therapies, Inc. Compositions and methods for regulating lymphocyte activation
US20020177188A1 (en) 1998-05-15 2002-11-28 Genentech, Inc. IL-17 homologous polypeptides and therapeutic uses thereof
WO2000027435A1 (en) 1998-11-10 2000-05-18 Celltech Therapeutics Limited Antibody-serum protein hybrids
WO2000043507A1 (en) 1999-01-19 2000-07-27 Unilever Plc Method for producing antibody fragments
WO2001045746A2 (en) 1999-12-24 2001-06-28 Genentech, Inc. Methods and compositions for prolonging elimination half-times of bioactive compounds
WO2001077137A1 (en) 2000-04-12 2001-10-18 Human Genome Sciences, Inc. Albumin fusion proteins
WO2001090190A2 (en) 2000-05-26 2001-11-29 National Research Council Of Canada Single-domain antigen-binding antibody fragments derived from llama antibodies
WO2002057445A1 (en) 2000-05-26 2002-07-25 National Research Council Of Canada Single-domain brain-targeting antibody fragments derived from llama antibodies
US6741957B1 (en) 2000-07-21 2004-05-25 Daimlerchrysler Corporation Analytical tire model for vehicle durability and ride comfort analysis
WO2002056910A1 (en) 2001-01-17 2002-07-25 Trubion Pharmaceuticals, Inc. Binding domain-immunoglobulin fusion proteins
WO2002076489A1 (en) 2001-03-09 2002-10-03 Dyax Corp. Serum albumin binding moieties
WO2002085945A2 (en) 2001-04-24 2002-10-31 Erasmus Universiteit Rotterdam Vhh single heavy chain antibody and a method for its preparation in a mammal
WO2003002609A2 (en) 2001-06-28 2003-01-09 Domantis Limited Dual-specific ligand and its use
WO2003014960A2 (en) 2001-08-03 2003-02-20 Medical Research Council Method of identifying a consensus sequence for intracellular antibodies
WO2003025020A1 (en) 2001-09-13 2003-03-27 Institute For Antibodies Co., Ltd. Method of constructing camel antibody library
WO2003035694A2 (en) 2001-10-24 2003-05-01 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Functional heavy chain antibodies, fragments thereof, library thereof and methods of production thereof
US6849992B2 (en) 2001-12-03 2005-02-01 Samsung Sdi Co., Ltd. Plasma display device having efficient heat conductivity
WO2003050531A2 (en) 2001-12-11 2003-06-19 Algonomics N.V. Method for displaying loops from immunoglobulin domains in different contexts
WO2003054016A2 (en) 2001-12-21 2003-07-03 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Method for cloning of variable domain sequences
WO2003055527A2 (en) 2002-01-03 2003-07-10 Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw Immunoconjugates useful for treatment of tumours
WO2004003019A2 (en) 2002-06-28 2004-01-08 Domantis Limited Immunoglobin single variant antigen-binding domains and dual-specific constructs
US7004940B2 (en) 2002-10-10 2006-02-28 Ethicon, Inc. Devices for performing thermal ablation having movable ultrasound transducers
WO2004041863A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Single domain antibodies directed against interferon- gamma and uses therefor
WO2004041867A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders
WO2004041865A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Stabilized single domain antibodies
WO2004041862A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
WO2004049794A2 (en) 2002-12-03 2004-06-17 The Babraham Institute Single chain antibodies produced in a transgenic mouse
WO2004051268A1 (en) 2002-12-03 2004-06-17 Celltech R & D Limited Assay for identifying antibody producing cells
WO2004058820A2 (en) 2002-12-27 2004-07-15 Domantis Limited Single-domain-effector group and its uses
WO2004060965A2 (en) 2002-12-31 2004-07-22 Nektar Therapeutics Al, Corporation Hydrolytically stable maleimide-terminated polymers
WO2004106377A1 (en) 2003-05-30 2004-12-09 Celltech R & D Limited Methods for producing antibodies
WO2004081026A2 (en) 2003-06-30 2004-09-23 Domantis Limited Polypeptides
WO2005010044A2 (en) 2003-07-08 2005-02-03 Genentech, Inc. Il-17 a/f heterologous polypeptides and therapeutic uses thereof
WO2005017148A1 (en) 2003-07-26 2005-02-24 Trubion Pharmaceuticals, Inc. Binding constructs and methods for use thereof
WO2005018629A1 (en) 2003-08-12 2005-03-03 Yarbrough William M Treatment for acne vulgaris and method of use
WO2005019824A1 (en) 2003-08-20 2005-03-03 Celltech R & D Limited Methods for obtaining antibodies
WO2006007260A2 (en) 2004-06-21 2006-01-19 Masco Corporation Of Indiana Fluid filter assembly for a dispensing faucet
WO2006012282A1 (en) 2004-06-25 2006-02-02 The Procter & Gamble Company Flexible laminate having an integrated pressure release valve
WO2006012278A2 (en) 2004-06-25 2006-02-02 Ambis Edward J Jr Custom mouthguard
WO2006003388A2 (en) 2004-06-30 2006-01-12 Domantis Limited Compositions and methods for treating inflammatory disorders
WO2006008548A2 (en) 2004-07-22 2006-01-26 Erasmus University Medical Centre Rotterdam Binding molecules
WO2006030220A1 (en) 2004-09-17 2006-03-23 Domantis Limited Compositions monovalent for cd40l binding and methods of use
WO2006040153A2 (en) 2004-10-13 2006-04-20 Ablynx N.V. Single domain camelide anti -amyloid beta antibodies and polypeptides comprising the same for the treatment and diagnosis of degenarative neural diseases such as alzheimer's disease
WO2006040154A2 (en) 2004-10-14 2006-04-20 Dublin City University Prokaryotic two hybrid system
WO2006054059A1 (en) * 2004-11-19 2006-05-26 Ucb Pharma S.A. Neutralising antibody molecules having specificity for human il-17
WO2006079372A1 (en) 2005-01-31 2006-08-03 Ablynx N.V. Method for generating variable domain sequences of heavy chain antibodies
WO2006122787A1 (en) 2005-05-18 2006-11-23 Ablynx Nv Serum albumin binding proteins
WO2006122825A2 (en) 2005-05-20 2006-11-23 Ablynx Nv Single domain vhh antibodies against von willebrand factor
WO2007112940A2 (en) 2006-03-31 2007-10-11 Ablynx N.V. Albumin-derived amino acid sequence, use thereof for increasing the half-life of therapeutic proteins and of other therapeutic compounds and entities, and constructs comprising the same
WO2007118670A1 (en) 2006-04-14 2007-10-25 Ablynx N.V. Dp-78-like nanobodies
WO2008000279A1 (en) 2006-06-26 2008-01-03 Aida Centre, S.L. Blister package integrating rfid based tags
WO2008020079A1 (en) 2006-08-18 2008-02-21 Ablynx N.V. Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling
WO2008028977A2 (en) 2006-09-08 2008-03-13 Ablynx N.V. Serum albumin binding proteins with long half-lives
WO2008043822A2 (en) 2006-10-11 2008-04-17 Ablynx N. V. Amino acid sequences that bind to a desired molecule in a conditional manner
WO2008043821A1 (en) 2006-10-11 2008-04-17 Ablynx N. V. Amino acid sequences that bind to serum proteins in a manner that is essentially independent of the ph, compounds comprising the same, and use thereof
WO2008047134A2 (en) * 2006-10-18 2008-04-24 Ucb Pharma S.A. Antibody molecules which bind il-17a and il-17f
WO2008068280A1 (en) 2006-12-05 2008-06-12 Ablynx N.V. Peptides capable of binding to serum proteins
WO2009068627A2 (en) 2007-11-27 2009-06-04 Ablynx N.V. Amino acid sequences directed against heterodimeric cytokines and/or their receptors and polypeptides comprising the same
WO2009095235A1 (en) 2008-01-29 2009-08-06 Ablynx N.V. Methods to stabilize proteins and polypeptides
WO2009127691A1 (en) 2008-04-17 2009-10-22 Ablynx N.V. Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same
WO2009136286A2 (en) * 2008-05-05 2009-11-12 Novimmune Sa Anti-il-17a/il-17f cross-reactive antibodies and methods of use thereof
WO2009138519A1 (en) 2008-05-16 2009-11-19 Ablynx Nv AMINO ACID SEQUENCES DIRECTED AGAINST CXCR4 AND OTHER GPCRs AND COMPOUNDS COMPRISING THE SAME
WO2010025400A2 (en) * 2008-08-29 2010-03-04 Genentech, Inc. Cross-reactive and bispecific anti-el 17a/f antibodies
WO2010125187A2 (en) 2009-04-30 2010-11-04 Ablynx Nv Method for the production of domain antibodies

Non-Patent Citations (87)

* Cited by examiner, † Cited by third party
Title
"Remington, the Science and Practice of Pharmacy, 21 th Edition,", 2005, LIPPINCOTT WILLIAMS AND WILKINS
"Remington's Pharmaceutical Sciences, 16the ed.,", 1980, MACK PUBLISHING CO.
"Remington's Pharmaceutical Sciences, 18 Ih Ed.,", 1990, MACK PUBLISHING COMPANY
"Sequence of proteins of immunological interest", NIH
ADV. ENZYMOL., vol. 47, 1978, pages 45 - 149
AGGARWAL ET AL., J. BIOL. CHEM., vol. 278, no. 3, 2003, pages 1910 - 4
AGGARWAL, S.; GURNEY, A. L., J LEUKOC BIOL, vol. 71, no. 1, 2002, pages 1 - 8
AGGARWAL; GURNEY, J. LEUKOC BIOL, vol. 71, no. 1, 2002, pages 1 - 8
ALBANESI, C. ET AL., J INVEST DERMATOL, vol. 115, no. 1, 2000, pages 81 - 7
ARBABI GHAHROUDI M ET AL: "Selection and identification of single domain antibody fragments from camel heavy-chain antibodies", FEBS LETTERS, ELSEVIER, AMSTERDAM, NL, vol. 414, no. 3, 15 September 1997 (1997-09-15), pages 521 - 526, XP004261105, ISSN: 0014-5793, DOI: 10.1016/S0014-5793(97)01062-4 *
BARTHELEMY ET AL., J BIOL CHEM., vol. 283, no. 6, 8 February 2008 (2008-02-08), pages 3639 - 54
BINZ ET AL., NAT BIOTECHNOL, vol. 23, 2005, pages 1247
BINZ ET AL., NAT. BIOTECH, vol. 23, 2005, pages 1257
BRIAN K. KAY; JILL WINTER; JOHN MCCAFFERTY: "Phage Display of Peptides and Proteins: A Laboratory Manual", 28 October 1996, ACADEMIC PRESS
CAI, X. Y. ET AL., IMMUNOL. LETT, vol. 62, no. 1, 1998, pages 51 - 8
CAO; SURESH, JOURNAL OF DRUG TARGETTING, vol. 8, no. 4, 2000, pages 257
CATTANEO, A.; BIOCCA, S.: "Intracellular Antibodies: Development and Applications", 1997, LANDES AND SPRINGER-VERLAG
CHABAUD ET AL., ARTHRITIS RHEUM., vol. 42, 1999, pages 963 - 970
CHABAUD, M. ET AL., J. IMMUNOL., vol. 161, no. 1, 1998, pages 409 - 14
CHAPMAN, NAT. BIOTECHNOL., vol. 54, 2002, pages 531 - 545
CHOU; FASMAN, BIOCHEMISTRY, vol. 13, 1974, pages 211
CONRATH ET AL., J. BIOL. CHEM., vol. 276, no. 10, 2001, pages 7346 - 7350
DECANNIERE ET AL., STRUCTURE, vol. 7, no. 4, 1999, pages 361
DESMYTER ET AL., NATURE STRUCTURAL BIOLOGY, vol. 3, no. 9, 1996, pages 803
DUROCHER Y ET AL., NUCLEIC ACIDS RES., vol. 30, 2002, pages E9
EISENBERG ET AL., PROC. NAD. ACAD SCI. USA, vol. 81, 1984, pages 140 - 144
ELY ET AL., NATURE IMMUNOLOGY, vol. 10, 2009, pages 1245 - 1251
FOSSIEZ, F. ET AL., J. EXP. MED., vol. 183, no. 6, 1996, pages 2593 - 2603
GAFFEN, NATURE REVIEW IMMUNOLOGY, vol. 9, 2009, pages 556 - 567
GOLDMAN ET AL., ANN. REV. BIOPHYS. CHEM., vol. 15, 1986, pages 321 - 353
GONZALES ET AL., TUMOUR BIOL., vol. 26, no. 1, 2005, pages 31 - 43
HALABY ET AL., PROTEIN ENG., vol. 12, 1999, pages 563 - 71
HARMSEN ET AL., VACCINE, vol. 23, no. 41, 2005, pages 4926 - 42
HARRIS; CHESS, NAT. REV. DRUG. DISCOV., 2003, pages 2
HELM ET AL., J BIOL CHEM, vol. 271, 1996, pages 7494
HOLLIGER; HUDSON, NAT BIOTECHNOL., vol. 23, no. 9, September 2005 (2005-09-01), pages 1126 - 36
HOLLIGER; HUDSON, NATURE BIOTECHNOLOGY, vol. 23, no. 9, 2005, pages 1126 - 1136
HOLT ET AL., TRENDS BIOTECHNOL., vol. 21, no. 11, 2003, pages 484 - 490
HOLT L J ET AL: "Domain antibodies: proteins for therapy", TRENDS IN BIOTECHNOLOGY, ELSEVIER PUBLICATIONS, CAMBRIDGE, GB, vol. 21, no. 11, 1 November 2003 (2003-11-01), pages 484 - 490, XP004467495, ISSN: 0167-7799, DOI: 10.1016/J.TIBTECH.2003.08.007 *
HOMEY, B. ET AL., J. IMMUNOL., vol. 164, no. 12, 2000, pages 6621 - 32
HOOGENBOOM ET AL., NAT BIOTECHNOL, vol. 23, 2005, pages 1105
HOOGENBOOM, NATURE BIOTECHNOLOGY, vol. 23, no. 9, 2005, pages 1105 - 1116
HYMOWITZ, S. G. ET AL., EMBO J, vol. 20, no. 19, 2001, pages 5332 - 41
IRVING ET AL., J. IMMUNOL. METHODS, vol. 248, no. 1-2, 2001, pages 31 - 45
JANSSENS ET AL., PROC. NATL. ACAD. SCI .USA, vol. 103, no. 41, 10 October 2006 (2006-10-10), pages 15130 - 5
JOVANOVIC, D. V. ET AL., J. IMMUNOL., vol. 160, no. 7, 1998, pages 3513 - 21
JOVANOVICETAL., J. IMMUNOL., vol. 160, 1998, pages 3513
KAWAGUCHI ET AL., J. ALLERGY CLIN. IMMUNOL., vol. 114, 2004, pages 1265
KECK; HUSTON, BIOPHYSICAL JOURNAL, vol. 71, October 1996 (1996-10-01), pages 2002 - 2011
KENNEDY, J. ET AL., J. INTERFERON CYTOKINE RES., vol. 16, no. 8, 1996, pages 611 - 7
KENNETH, A ET AL.: "Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists"
KOLLS, JK ET AL., IMMUNITY, vol. 21, 2004, pages 467
KONTERMANN & DIIBEL: "Antibody Engineering", vol. 2, 2010, SPRINGER VERLAG
KONTERMANN, METHODS, vol. 34, 2004, pages 163 - 170
KOTAKE ET AL., J. CLIN. INVEST., vol. 103, 1999, pages 1345 - 1352
KURASAWA, K. ET AL., ARTHRITIS RHEU, vol. 43, no. LI, 2000, pages 2455 - 63
KYTE; DOOLITTLE, J MOLEC. BIOL., vol. 157, 1981, pages 105 - 132
LAAN, M. ET AL., J. IMMUNOL., vol. 162, no. 4, 1999, pages 2347 - 52
LEVIN; WEISS, MOL. BIOSYST., vol. 2, no. 1, 2006, pages 49 - 57
LIEBY ET AL., BLOOD, vol. 97, no. 12, 2001, pages 3820
LIEBY ET AL., BLOOD, vol. 97, no. 12, pages 3820
LINDEN, A. ET AL., EUR RESPIR J, vol. 15, no. 5, 2000, pages 973 - 7
LUNDBLAD; BRADSHAW, BIOTECHNOL. APPL. BIOCHEM., vol. 26, 1997, pages 143 - 151
M GIBALDI; D PERRON: "Pharmacokinetics, 2nd Rev. edition", 1982, MARCEL DEKKER
MARTIN, E.W.,: "Remington's Pharmaceutical Sciences, ed. 4", MACK PUBLISHING CO.
MATUSEVICIUS ET AL., MULT. SCLER., vol. 5, 1999, pages 101 - 104
MUYLDERMANS, REVIEWS IN MOLECULAR BIOTECHNOLOGY, vol. 74, 2001, pages 277 - 302
PETERS ET AL.: "Pharmacokinete analysis: A Practical Approach", 1996
PRESTA, ADV. DRUG DELIV. REV., vol. 58, no. 5-6, 2006, pages 640 - 56
RIECHMANN; MUYLDERMANS, J. IMMUNOL. METHODS, vol. 240, no. 1-2, 23 June 2000 (2000-06-23), pages 185 - 195
S. DUBEL,: "Handbook of Therapeutic Antibodies", 2007, WILEY, pages: 252 - 255
SCHMITZ ET AL., PLACENTA, vol. 21, no. A, 2000, pages 106 - 12
SHALOM-BAREK ET AL., J. BIOL. CHEM., vol. 273, 1998, pages 27467
SPINELLI ET AL., NATURAL STRUCTURAL BIOLOGY, vol. 3, 1996, pages 752 - 757
STARNES ET AL., J IMMUNOL, vol. 167, no. 8, 2001, pages 4137 - 40
TEUNISSEN, M. B. ET AL., J INVEST DERMATOL, vol. 1 11, no. 4, 1998, pages 645 - 9
ULRICH ET AL., COMB CHEM HIGH THROUGHPUT SCREEN, vol. 9, no. 8, 2006, pages 619 - 32
VAN BEZOOIJEN ET AL., J. BONE MINER. RES., vol. 14, 1999, pages 1513 - 1521
VERONESE; HARRIS, ADV. DRUG DELIV. REV., vol. 54, 2003, pages 453 - 456
VINCKE CÉCILE ET AL: "General strategy to humanize a camelid single-domain antibody and identification of a universal humanized nanobody scaffold", JOURNAL OF BIOLOGICAL CHEMISTRY, THE AMERICAN SOCIETY OF BIOLOGICAL CHEMISTS, INC, US, vol. 284, no. 5, 30 January 2009 (2009-01-30), pages 3273 - 3284, XP009124408, ISSN: 0021-9258, [retrieved on 20081114], DOI: 10.1074/JBC.M806889200 *
WARD ET AL., NATURE, vol. 341, no. 6242, 12 October 1989 (1989-10-12), pages 544 - 6
WRIGHT ET AL., J. BIOL. CHEM., vol. 282, 2007, pages 13447
YANG ET AL., PROTEIN ENGINEERING, vol. 16, no. 10, 2003, pages 761 - 770
YAO ET AL., CYTOKINE, vol. 9, no. 11, 1997, pages 794 - 800
YAO ET AL., IMMUNITY, vol. 3, 1995, pages 811
YAO, Z. ET AL., IMMUNITY, vol. 3, no. 6, 1995, pages 811 - 821
YAO, Z. ET AL., J. IMMUNOL., vol. 122, no. 12, 1995, pages 5483 - 5486

Cited By (47)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014076321A1 (en) * 2012-11-19 2014-05-22 Pieris Ag Novel specific-binding polypeptides and uses thereof
US10526384B2 (en) 2012-11-19 2020-01-07 Pieris Pharmaceuticals Gmbh Interleukin-17A-specific and interleukin-23-specific binding polypeptides and uses thereof
EP3441400B1 (en) * 2012-11-19 2022-07-20 Pieris Pharmaceuticals GmbH Novel specific-binding polypeptides and uses thereof
WO2014202745A1 (fr) * 2013-06-21 2014-12-24 Institut National De La Recherche Agronomique Anticorps monocaténaire à chaîne lourde de camélidé dirigé contre la chromatine et utilisations
FR3007411A1 (fr) * 2013-06-21 2014-12-26 Agronomique Inst Nat Rech Anticorps monocatenaire a chaine lourde de camelide dirige contre la chromatine et utilisations
USRE50682E1 (en) 2014-05-16 2025-12-02 Ablynx Nv Immunoglobulin variable domains
JP7325928B2 (ja) 2014-05-16 2023-08-15 アブリンクス エン.ヴェー. 改善された免疫グロブリン可変ドメイン
US12180268B2 (en) 2014-05-16 2024-12-31 Ablynx N.V. Immunoglobulin variable domains
US11345728B2 (en) 2014-05-22 2022-05-31 Pieris Pharmaceuticals Gmbh Specific-binding polypeptides and uses thereof
RU2723034C2 (ru) * 2014-05-22 2020-06-08 ПИЕРИС ФАРМАСЬЮТИКАЛС ГмбХ Новые полипептиды со специфическим связыванием и пути их применения
WO2015177175A3 (en) * 2014-05-22 2016-02-18 Pieris Ag Novel specific-binding polypeptides and uses thereof
EP3789397A1 (en) * 2014-05-22 2021-03-10 Pieris Pharmaceuticals GmbH Novel specific-binding polypeptides and uses thereof
US10774119B2 (en) 2014-05-22 2020-09-15 Pieris Pharmaceuticals Gmbh Specific-binding polypeptides and uses thereof
WO2015191783A2 (en) 2014-06-10 2015-12-17 Abbvie Inc. Biomarkers for inflammatory disease and methods of using same
IL244762B1 (en) * 2014-09-26 2024-07-01 Biocad Cjsc Aggregation-resistant high-affinity anti-IL-17A antibodies based on VL variable regions and VHH derivatives, pharmaceutical preparations containing them and uses thereof
US11447574B2 (en) 2014-09-26 2022-09-20 Joint Stock Company “Biocad” Method for treatment of an IL-17A-mediated disease through antibody administration specific to human IL-17A
EP3199550A4 (en) * 2014-09-26 2018-09-26 Closed Joint Stock Company "Biocad" High affinity and aggregatively stable antibodies on the basis of variable domains vl and a derivative vhh
AU2015322141B2 (en) * 2014-09-26 2018-12-20 Closed Joint Stock Company "Biocad" High affinity and aggregatively stable antibodies on the basis of variable domains Vl and a derivative VHH
IL244762B2 (en) * 2014-09-26 2024-11-01 Biocad Cjsc HIGH-AFFINITY AND AGGREGATION-RESISTANT IL-17A ANTIBODIES BASED ON VARIABLE DOMAINS VL AND VHH-DERIVATIVES, pharmaceutical compositions comprising thereof and uses of same
US10442869B2 (en) 2014-09-26 2019-10-15 Closed Joint Stock Company “Biocad” Anti-IL-17A Antibodies
US11667705B2 (en) 2015-01-12 2023-06-06 Crescendo Biologics Limited IL-17A binding proteins
US10654924B2 (en) 2015-01-12 2020-05-19 Crescendo Biologics Limited IL-17A binding proteins
WO2016113557A1 (en) * 2015-01-12 2016-07-21 Crescendo Biologics Limited Il-17a binding proteins
EP4556491A3 (en) * 2015-01-12 2026-03-18 Crescendo Biologics Limited Therapeutic molecules
WO2016118733A1 (en) 2015-01-21 2016-07-28 Inhibrx Biopharma LLC Non-immunogenic single domain antibodies
US11492396B2 (en) 2015-10-27 2022-11-08 UCB Biopharma SRL Methods of treatment using anti-IL-17A/F antibodies
WO2017072183A1 (en) * 2015-10-27 2017-05-04 Ucb Biopharma Sprl Methods of treatment using anti-il-17a/f antibodies
JP2021119168A (ja) * 2015-10-27 2021-08-12 ユーシービー バイオファルマ エスアールエル 抗il−17a/f抗体を用いた治療方法
JP2018535961A (ja) * 2015-10-27 2018-12-06 ユーシービー バイオファルマ エスピーアールエル 抗il−17a/f抗体を用いた治療方法
EP3368570A1 (en) * 2015-10-27 2018-09-05 UCB Biopharma SPRL Methods of treatment using anti-il-17a/f antibodies
WO2017102830A1 (en) * 2015-12-18 2017-06-22 Ucb Biopharma Sprl Multi-specific antibody molecules having specificity for tnf-alpha, il-17a and il-17f
CN109641953A (zh) * 2016-04-29 2019-04-16 Biocad股份有限公司 针对il-17a、il-17f和其他促炎性分子的三特异性抗体
CN109641953B (zh) * 2016-04-29 2023-02-17 Biocad股份有限公司 针对il-17a、il-17f和其他促炎性分子的三特异性抗体
US11453717B2 (en) 2016-04-29 2022-09-27 Joint Stock Company “Biocad” Trispecific antibodies against IL-17A, IL-17F and other pro-inflammatory molecule
EP3450456A4 (en) * 2016-04-29 2020-01-01 Closed Joint Stock Company "Biocad" TRISPECIFIC ANTIBODIES AGAINST IL-17A, IL-17F AND ANOTHER PROINFLAMMATORY MOLECULE
WO2018011555A1 (en) * 2016-07-11 2018-01-18 Crescendo Biologics Limited Composition for treatment of disorders
US12134643B2 (en) 2016-07-11 2024-11-05 Crescendo Biologics Limited Compositions for treatment of disorders
US10947308B2 (en) 2016-07-11 2021-03-16 Crescendo Biologics Limited Composition for treatment of disorders
WO2018148585A1 (en) 2017-02-10 2018-08-16 Genentech, Inc. Anti-tryptase antibodies, compositions thereof, and uses thereof
WO2022012636A1 (en) * 2020-07-15 2022-01-20 Biocytogen Pharmaceuticals (Beijing) Co., Ltd. Genetically modified non-human animal with human or chimeric il17a and/or il17f
WO2022040506A3 (en) * 2020-08-21 2022-04-07 Yale University Nanobody compositions and methods of use of the same
WO2024133935A1 (en) 2022-12-23 2024-06-27 Ablynx Nv Protein-based conjugation carriers
EP4393948A1 (en) * 2022-12-28 2024-07-03 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Therapeutic vhh antibodies cross-neutralizing the il-17a and il-17f homodimers as well as the il-17af heterodimer
WO2024141567A1 (en) 2022-12-28 2024-07-04 The Max-Planck-Gesellschaft Zur Förderung Der Wissenschaften E.V. Therapeutic variable domain of heavy chain (vhh) antibodies cross-neutralizing interleukin 17 (il-17) isoforms
WO2024170756A1 (en) 2023-02-17 2024-08-22 Ablynx N.V. Polypeptides binding to the neonatal fc receptor
CN117866903B (zh) * 2024-03-12 2024-06-04 北京贝来药业有限公司 单域抗体修饰的干细胞及其在疾病治疗中用途
CN117866903A (zh) * 2024-03-12 2024-04-12 北京贝来药业有限公司 单域抗体修饰的干细胞及其在疾病治疗中用途

Also Published As

Publication number Publication date
SI2705058T1 (en) 2018-04-30
US20140314743A1 (en) 2014-10-23
US20210130452A1 (en) 2021-05-06
SG10201606409TA (en) 2016-09-29
EP2705058B1 (en) 2018-01-10
CA2834907A1 (en) 2012-11-22
CA2834907C (en) 2023-03-07
EA035973B1 (ru) 2020-09-08
EP4105231A1 (en) 2022-12-21
DK2705058T3 (en) 2018-03-05
CN103717618B (zh) 2016-12-07
WO2012156219A9 (en) 2013-04-18
JP2020193195A (ja) 2020-12-03
JP6628965B2 (ja) 2020-01-15
JP7093380B2 (ja) 2022-06-29
HUE037225T2 (hu) 2018-08-28
KR20140132661A (ko) 2014-11-18
JP2022137058A (ja) 2022-09-21
JP2018154628A (ja) 2018-10-04
EP3363815A1 (en) 2018-08-22
SG194632A1 (en) 2013-12-30
KR102083230B1 (ko) 2020-03-02
MY167231A (en) 2018-08-14
AU2012257942B2 (en) 2015-08-20
PT2705058T (pt) 2018-03-20
US10829552B2 (en) 2020-11-10
NZ616761A (en) 2016-01-29
AU2012257942A8 (en) 2015-09-10
LT2705058T (lt) 2018-04-10
EA035973B9 (en) 2021-03-30
EP2705058A1 (en) 2014-03-12
ES2662371T3 (es) 2018-04-06
US20220195031A1 (en) 2022-06-23
BR112013028407A2 (pt) 2016-11-29
US11773159B2 (en) 2023-10-03
CN107098971B (zh) 2020-07-10
PH12013502234A1 (en) 2014-01-06
US10017568B2 (en) 2018-07-10
US20190100584A1 (en) 2019-04-04
JP6768027B2 (ja) 2020-10-14
JP2024122989A (ja) 2024-09-10
IL228813A0 (en) 2013-12-31
MX2013012844A (es) 2013-11-20
UA117218C2 (uk) 2018-07-10
JP2014516945A (ja) 2014-07-17
CL2013003090A1 (es) 2014-10-10
AU2012257942B8 (en) 2015-09-17
EA201391632A1 (ru) 2014-07-30
BR112013028407B1 (pt) 2021-11-23
AU2012257942A1 (en) 2013-05-02
IL228813B (en) 2018-07-31
AU2012257942A2 (en) 2014-06-05
CN107098971A (zh) 2017-08-29
CN103717618A (zh) 2014-04-09
HRP20180380T1 (hr) 2018-04-06

Similar Documents

Publication Publication Date Title
US11773159B2 (en) Polypeptides that bind to IL-17A, IL-17F and/or IL17-A/F and methods of treatment using same
US20100092460A1 (en) Amino acid sequences directed against chemokines and polypeptides comprising the same for the treatment of chemokine-related diseases and disorders
JP2011516520A (ja) Notch経路に指向性を有するアミノ酸配列及びその使用
JP2011504740A (ja) ヘテロ二量体サイトカイン及び/又はこれらの受容体に指向性を有するアミノ酸配列、並びにこれを含むポリペプチド
JP2010500876A (ja) Il−6媒介性シグナル伝達に関連する疾患及び障害の治療のための、il−6rに指向性を有するアミノ酸配列及びこれを含むポリペプチド
JP2009529339A (ja) Il−6を標的とするアミノ酸配列およびそれを含みil−6介在シグナル伝達に関連する疾患および疾病を治療するポリペプチド
WO2010142551A2 (en) Single variable domain (vhh) antibodies to cytokines of the il-17 receptor family
WO2010040736A2 (en) Amino acid sequences directed against il18 and/or the il-18 receptor and polypeptides comprising the same for the treatment of diseases and/or disorders associated with il-18 mediated signaling
HK40085290A (en) Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
HK1260072A1 (en) Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
WO2010037818A1 (en) Amino acid sequences directed against il-15 and/or the il-15 receptor and polypeptides comprising the same for the treatment of diseases and disorders associated with il-15 mediated signalling
HK1194088A (en) Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same
HK1194088B (en) Amino acid sequences directed against il-17a, il-17f and/or il17-a/f and polypeptides comprising the same

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12726593

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2012257942

Country of ref document: AU

Date of ref document: 20120504

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2013003090

Country of ref document: CL

ENP Entry into the national phase

Ref document number: 2834907

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2013/012844

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2014508842

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2012726593

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20137032085

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201391632

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: A201314154

Country of ref document: UA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013028407

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 14115549

Country of ref document: US

ENP Entry into the national phase

Ref document number: 112013028407

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20131104