WO2012145507A2 - Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies - Google Patents

Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies Download PDF

Info

Publication number
WO2012145507A2
WO2012145507A2 PCT/US2012/034244 US2012034244W WO2012145507A2 WO 2012145507 A2 WO2012145507 A2 WO 2012145507A2 US 2012034244 W US2012034244 W US 2012034244W WO 2012145507 A2 WO2012145507 A2 WO 2012145507A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
erbb3
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2012/034244
Other languages
English (en)
French (fr)
Other versions
WO2012145507A3 (en
Inventor
Jason BAUM
Bryan Johnson
Alexey Alexandrovich Lugovskoy
Lihui Xu
Neeraj Kohli
Jonathan Basil Fitzgerald
Sharlene Adams
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Merrimack Pharmaceuticals Inc
Original Assignee
Merrimack Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to KR1020137030562A priority Critical patent/KR101517320B1/ko
Priority to SI201230955A priority patent/SI2699602T1/sl
Priority to CN201280028639.XA priority patent/CN103703026B/zh
Priority to BR112013027021A priority patent/BR112013027021A2/pt
Priority to ES12773950.6T priority patent/ES2625818T3/es
Priority to MX2013012201A priority patent/MX336197B/es
Priority to JP2014506549A priority patent/JP5588086B2/ja
Priority to KR1020147031817A priority patent/KR20140138353A/ko
Priority to MX2016000234A priority patent/MX346486B/es
Priority to HRP20170713TT priority patent/HRP20170713T1/hr
Priority to EP12773950.6A priority patent/EP2699602B1/en
Priority to CA2833643A priority patent/CA2833643A1/en
Application filed by Merrimack Pharmaceuticals Inc filed Critical Merrimack Pharmaceuticals Inc
Priority to DK12773950.6T priority patent/DK2699602T3/en
Priority to AU2012245491A priority patent/AU2012245491C1/en
Publication of WO2012145507A2 publication Critical patent/WO2012145507A2/en
Priority to IL228957A priority patent/IL228957A0/en
Anticipated expiration legal-status Critical
Publication of WO2012145507A3 publication Critical patent/WO2012145507A3/en
Priority to AU2017216490A priority patent/AU2017216490A1/en
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2869—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against hormone receptors
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46—Hybrid immunoglobulins
    • C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/35—Valency
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • Tumor cells express receptors for growth factors and cytokines that stimulate proliferation of the cells. Antibodies to such receptors can be effective in blocking the stimulation of cell proliferation mediated by growth factors and cytokines and can thereby inhibit tumor cell proliferation and tumor growth.
  • Antibodies to such receptors can be effective in blocking the stimulation of cell proliferation mediated by growth factors and cytokines and can thereby inhibit tumor cell proliferation and tumor growth.
  • Commercially available therapeutic antibodies that target receptors on cancer cells include, for example, trastuzumab which targets the HER2 receptor (also known as ErbB2) for the treatment of breast cancer, and cetuximab which targets the epidermal growth factor receptor (EGFR, also known as HERl or ErbB l) for the treatment of colorectal cancer and head and neck cancer.
  • trastuzumab which targets the HER2 receptor (also known as ErbB2) for the treatment of breast cancer
  • cetuximab which targets the epidermal growth factor receptor (EGFR, also known as HERl or ErbB
  • Monoclonal antibodies have significantly advanced our ability to treat cancers, yet clinical studies have shown that many patients do not adequately respond to monospecific therapy. This is in part due to the multigenic nature of cancers, where cancer cells rely on multiple and often redundant pathways for proliferation.
  • Bi- or multi- specific antibodies capable of blocking multiple growth and survival pathways at once have a potential to better meet the challenge of blocking cancer growth, and indeed many of them are advancing in clinical development.
  • bispecific antibodies present significant design challenges, due to the greatly increased number of variables that need to be considered in their design and optimization, as well as to their structural differences from naturally occurring antibodies.
  • Monoclonal antibodies such as trastuzumab, cetuximab, bevacizumab and panitumumab have significantly improved patient outcomes in the clinic, and over two hundred therapeutic monoclonal antibodies are currently being tested in clinical development.
  • tumors driven by single oncogenes are not the norm, and treatment often results in activation of resistance mechanisms, which in turn also require targeted intervention.
  • IGF-1R restores sensitivity to trastuzumab.
  • Combination of targeted agents has been attempted in the clinic, but so far they have had limited clinical success and in combination can be prohibitively expensive.
  • the need to inhibit multiple targets either due to resistance or to tumors being driven by multiple growth factor pathways has led to increased interest in bispecific antibodies.
  • bispecific antibodies were typically designed in empirical fashion. Further, the pharmaceutical properties of these bispecific antibodies were almost invariably inferior to those of monoclonal antibodies. These factors present a major challenge to the development of bispecific anti-cancer therapies.
  • Significant added benefit from targeting multiple cancer survival pathways can be derived from increased work up front to identify and engineer a bispecific antibody with optimal characteristics. This requires an iterative approach consisting of computational simulation to identify optimal targeting strategies and design specifications, engineering of inhibitors that possess these characteristics, and experimental validation of the therapeutic hypothesis.
  • This engineering framework into two categories: selection of appropriate molecular format with robust pharmaceutical properties and computational simulation to identify the best targets and optimal therapeutic design characteristics, e.g., in an IgG-like bispecific antibody (Fig. 8).
  • One of the main advantages of antibodies is their ability to bind tightly to virtually any extracellular target. This property is driven by two features of antibody variable regions (VRs): the large flat surface of six complementarity determining regions (CDRs) and the fact that antibodies have two binding arms that can target two molecules simultaneously.
  • VRs antibody variable regions
  • CDRs complementarity determining regions
  • bispecific antibodies dual target binding results in tighter affinity because once one arm of the antibody is bound to an extracellular target, the second arm is restricted to a narrow region above the plasma membrane (about 100 angstroms), and is, therefore, concentrated near the cell surface. This results in a much faster secondary binding event that is not limited by diffusion. The acceleration of a secondary binding event is called.
  • antibodies may possess multiple effector functions mediated by their Fc domain: antibody-dependent cellular cytotoxicity (ADCC) and antibody-dependent cellular phagocytosis (ADCP) that in humans are determined by interactions with activating FcyRI, FcyRIIa/c, FcyRIIIa and inhibitory FcyRIIb receptors; complement-dependent cytotoxicity (CDC) that is triggered by antibody binding to the components of the complement system; and long half-life that is mediated via active recycling by the neonatal Fc receptor (FcRn). All of these functions can be tuned to optimize the effectiveness of an anticancer therapy and are may be retained to advantage in a bispecific protein.
  • ADCC antibody-dependent cellular cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • CDC complement- dependent cytotoxicity
  • FcRn neonatal Fc receptor
  • variable fragment composed of the variable heavy (VH) and variable light (VL) domains of an IgG antibody
  • VH variable heavy
  • VL variable light
  • Fv variable fragment
  • VH variable heavy
  • VL variable light
  • scFv single chain construct
  • a majority of current bispecific formats feature one or several scFv modules attached to the N- or C-terminus of an IgG heavy chain or IgG light chain via a low complexity linker.
  • Another bispecific antibody format is dual variable domain immunoglobulin (DVD-Ig).
  • DVD-Ig consists of a first IgG heavy chain with a second VH domain linked to its N-terminus by a short linker, and a first IgG light chain with a second VL domain similarly linked to its N-terminus.
  • the second VH/VL domains form a pair with specificity for one antigen while the first VH/VL form a separate binding site with specificity for a different antigen.
  • Bivalent formats of IgG-like antibodies have one potential limitation; they can cross-link cell surface antigens, some of which are activated by dimerization, triggering undesirable signaling events in an uncontrolled manner.
  • MetMab a one armed anti-c-Met therapeutic antibody created by incorporating asymmetric "knobs and holes" into the Fc fragment, has been shown to be effective in models of pancreatic cancer and is being investigated in multiple clinical trials.
  • This "knobs and holes" format has been recently extended to incorporate an antibody fragment targeting EGFR, giving rise to a functionally monovalent bispecific protein targeting EGFR/ErbB l and c-Met/HGFR. Gunasekaran et al.
  • bispecific antibody design Another important component of a bispecific antibody design is the optimization of pharmaceutical properties.
  • a therapeutic protein To be clinically useful, a therapeutic protein must be stable, remain soluble over an extended period of time and possess a robust manufacturability profile.
  • Bispecific antibodies are typically less stable than monoclonal antibodies, and initially may not possess adequate pharmaceutical properties for development. They can be stabilized through molecular engineering, through downstream formulation activities, or, as most commonly practiced, through the combination of both approaches.
  • variable domains of heavy chains are reported to be glycosylated and over 5% of germline genes contain asparagine-glycine deamidation motifs.
  • Deamidation rates in antibodies can be reliably estimated using the method proposed by Robinson that suggests that structurally constrained loops do not form a succinimide intermediate efficiently and therefore are stable.
  • NXS and NXT canonical N-linked glycosylation motif
  • X is any aa but proline
  • O-linked sites which are liabilities in that they can also negatively impact pharmaceutical properties, are more difficult to recognize.
  • O-linked modifications of variable domains of antibody light chains have been reported, mostly in the proximity of GS rich sequence motifs.
  • Many approaches to improve the affinity and stability of a candidate protein at the discovery stage exist including structure- guided design, focused library screening and yeast display; therefore, we find it beneficial to remove such potential liabilities at risk in the early proof-of-concept proteins.
  • Computational simulation is a valuable tool for guiding drug development decisions, both in the laboratory and in the clinic.
  • Population pharmacokinetic modeling is a mature example of the use of models to optimize dose scheduling and clinical trial designs.
  • Advances in multiplex, high-throughput quantitative protein measurement technologies have enabled observation of the complex dynamics that occur in cellular signaling networks. These data permit the creation of network models which capture the mechanistic behaviors of biological systems that are relevant to diseases such as cancer. By simulating potential therapeutics through network modeling it is possible to design more effective therapeutics at an accelerated pace and more accurately predict design parameters.
  • polyvalent bispecific antibodies which antibodies are proteins comprising two pairs of polypeptide chains, each pair of said two pairs comprising a heavy chain joined to a light chain by at least one heavy-light chain bond; wherein (a) each pair comprises at least one anti-IGF-lR binding site and at least one anti-ErB3 binding site; and (b) each pair comprises a first binding site that comprises an N-terminal portion of the heavy chain of the PBA and an N-terminal portion of the light chain of the PBA, and a second binding site that is a C-terminal scFv that is entirely comprised by the heavy chain of the PBA, said C- terminal scFv containing a heavy chain VR joined to a light chain VR by an scFv linker; and the anti-IGF-lR binding site is linked to the anti-ErbB3 binding site through a heavy chain immunoglobulin (HC Ig) constant region (CR) comprised by the heavy chain of the PBA, and the two pairs
  • HC Ig heavy chain
  • the anti-IGF-lR binding site comprises a heavy chain variable (VH) domain comprising a set of three VH Complementarity Determining Regions (CDRs) comprising either (a) VHCDR1 (aa numbers 26-35), VHCDR2 (aa numbers 51-66), and VHCDR3 (aa numbers 99-1 1 1), of a heavy chain having an aa sequence comprising the aa sequence of (set forth in) a SEQ ID NO selected from the group consisting of SEQ ID NO: 1, SEQ ID NOs:8-31 and SEQ ID NOs:384-385; or (b) a set of three VH Complementarity Determining Regions (CDRs) comprising VHCDR1 comprising SEQ ID NO:302, VHCDR2 comprising SEQ ID NO:303 and VHCDR3 comprising SEQ ID NO:304, and a light chain variable (VL) domain comprising a set of three VLCDRs comprising either (c) VLCDR 1
  • VLCDR1 , VLCDR2 and VLCDR3 comprise variable aas, which independently represent any aa set forth at the corresponding position in Fig. 2, with the proviso that the PBA (i) does not comprise both the anti-IGF-lR SF module and the anti- ErbB3 C8 module; or (ii) comprises at least one CDR or FR that differs in one or more aas from a CDR or FR, respectively, of the SF or C8 module.
  • the anti-ErbB3 binding site comprises a VH domain comprising a set of three VH CDRs comprising either (e) VHCDR1 (aa numbers 26-35), VHCDR2 (aa numbers 51-66) and VHCDR3 (aa numbers 99- 1 11) of a heavy chain having an aa sequence comprising the aa sequence of a SEQ ID
  • VLCDR1 a set of three VH CDRs comprising VHCDR1 comprising SEQ ID NO:309, VHCDR2 comprising SEQ ID NO: 310 and VHCDR3 comprising SEQ ID NO: 31 1 , and a light chain variable (VL) domain comprising a set of three VLCDRs comprising either (g) VLCDR1 (aa numbers 23-33), VLCDR2 (aa numbers 49-55) and VLCDR3 (aa numbers 88-98), of a light chain having an aa sequence comprising the aa sequence of a SEQ ID NOselected from the group consisting of SEQ ID NOs:6-7 and SEQ ID NOs: 166-200; or (h) a light chain variable (VL) domain comprising a set of three VLCDRs comprising VLCDR1 comprising SEQ ID
  • VLCDR2 comprising SEQ ID NO:313 and VLCDR3 comprising SEQ ID NO:314 or SEQ ID NO:315, and each CDR further comprises an amino terminus and a carboxy terminus, wherein the CDRs of each set of CDRs are arranged in the antibody in a linear amino to carboxy order of CDR1, CDR2 and CDR3, or wherein the sequences of the VHCDR1, VHCDR2 and VHCDR3 comprise variable aas, which independently represent any aa set forth at the corresponding position in Fig. 3, and the sequences of the VLCDR1, VLCDR2 and VLCDR3 comprise variable aas, which independently represent any aa set forth at the corresponding position in Fig.
  • the PBA (i) does not comprise both the anti-IGF-lR module comprising a light chain comprising SEQ ID NO: 35 and a heavy chain comprising SEQ ID NO: 1 1 and the b) an anti-ErbB3 C8 module comprising a light chain comprising SEQ ID NO: 35 and the b) an anti-ErbB3 C8 module comprising a light chain comprising SEQ ID NO: 35 and a heavy chain comprising SEQ ID NO: 1 1 and the b) an anti-ErbB3 C8 module comprising a light chain comprising SEQ ID
  • the anti-IGF- 1R VLCDR3 comprises SEQ ID NO:308 or the anti-ErbB3 VLCDR3 comprises SEQ ID NO:315.
  • the two pairs of polypeptide chains are have essentially identical sequences. At least one of at least one bonds between the HC Ig CRs bonds is a disulfide bond and may be a disulfide bond or a van der Waals bond or at least one of said at least one heavy-light chain bonds is a disulfide bond and may be a disulfide bond or a van der Waals bond.
  • the anti-ErbB3 binding site is the C-terminal scFv and in certain embodiments, the anti-IGF-lR binding site is the C-terminal scFv.
  • the anti-IGF-lR binding site, the HC Ig CR and the anti-ErbB3 binding site of a PBA may comprise the heavy chain of that pair, which is comprised by a single, contiguous polypeptide chain.
  • a PBA may (i) inhibit growth of tumor cells in vitro at a concentration of 1 ⁇ or less, or 100 nM or less, or 10 nM or less, or 1 nM or less, or ii) inhibits either or both of heregulin and IGF1 induced signal transduction with an IC50 of ⁇ or less or InM or less or 100 pM or less, or a maximal percent inhibition of at least 70% or at least 80% or at least 90%, as indicated by inhibition of phosphorylation of either or both of pErbB3 and pIGF-l R. Growth inhibition may be measured with a CTG assay in DU145 cells in culture. Inhibition of signal transduction may be determined in BxPC-3 cells in culture following stimulation with IGF-1 at 80 ng/ml and heregulin at 20 ng/ml for 15 minutes.
  • each HC Ig CR of a PBA comprises a CH3 domain that mediates conjunction with the CH3 domain of the other pair.
  • Each HC Ig CR may also comprise a CH2 domain, a hinge, and a CHI domain.
  • the CHI domain of a PBA is linked at its C-terminus to the N-terminus of a hinge, which is linked at its C- terminus to the N-terminus of a CH2 domain, which is linked at its C-terminus to the N-terminus of a CH3 domain.
  • Each first binding site may comprise a first VH domain
  • each CHI domain of a PBA may be linked at its N-terminus to the C-terminus of the first VH domain.
  • Each CH3 domain of a PBA may be linked at its C-terminus to the N-terminus of the scFv.
  • Each CH3 domain of a PBA may be linked at its C terminus to the N-terminus of a connecting linker, which is linked at its C- terminus to the N-terminus of the scFv.
  • Each light chain may comprise a first VL domain that associates with the first VH domain to form the first binding site.
  • Each first VL domain may be linked at its C-terminus to the N-terminus of a CL domain.
  • Each first binding site may be an anti-IGF-lR binding site and each scFv may be an anti-ErbB3 scFv.
  • Each first binding site may be an anti-ErbB3 binding site and each scFv may be an anti-IGF-lR scFv.
  • the HC Ig CR of a PBA may be an IgG CR, e.g., an IgGl or IgG2 CR.
  • the anti-IGF-lR VHCDR1 , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 8 and the anti-IGF-lR VLCDRl, VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 32.
  • the anti-IGF-lR VHCDR1 , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:9 and the anti-IGF-lR VLCDRl, VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:33.
  • the anti-IGF-lR VHCDR1 , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 10 and the anti-IGF-lR VLCDRl , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:34.
  • the anti-IGF- 1 R VHCDR1 , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 11 and the anti-IGF- 1 R VLCDR 1 , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:35.
  • the anti-IGF- 1R VHCDR1 , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 8 and the anti-IGF- 1R VLCDRl , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 33.
  • the anti-IGF- 1 R VHCDR 1 , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 10 and the anti-IGF- 1 R VLCDR1 , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:32.
  • the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 134 and the anti-ErbB3 VLCDR1 , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 166.
  • the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 135 and the anti-ErbB3 VLCDR1 , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 167.
  • the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 135 and the anti-ErbB3 VLC
  • VHCDR 1 , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 136 and the anti-ErbB3 VLCDR1 , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 168.
  • the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 137 and the anti-ErbB3 VLCDR1 , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 169.
  • the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 138 and the anti-ErbB3 VLCDR1 , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 170.
  • the anti-ErbB3 VHCDRl, VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 139 and the anti- ErbB3 VLCDR1 , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 171.
  • the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 140 and the anti-ErbB3 VLCDR1, VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 172.
  • the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 140 and the anti-ErbB3 VLCDR1, VLCDR2 and
  • ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 141 and the anti-ErbB3 VLCDR1
  • VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ED NOs: 173.
  • the anti- ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ED NO: 142 and the anti-ErbB3 VLCDR1 ,
  • VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ED NO: 174.
  • the anti- ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ED NO: 143 and the anti- ErbB3 VLCDR1, VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ED NO: 175.
  • the anti- ErbB3 VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ED NO: 136 and the anti-ErbB3 VLCDRl, VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 169.
  • the anti-IGF-lR VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 8 and the anti-IGF-lR VLCDRl , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:32; and (a) the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 134 and the anti-ErbB3 VLCDRl , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 166; or (b) the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 135 and the anti-Er
  • the anti-IGF-lR VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:9 and the anti-IGF-lR VLCDRl, VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:33; and (a) the anti-ErbB3 VHCDRl, VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 134 and the anti-ErbB3 VLCDRl, VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 166; or (b) the anti-ErbB3 VHCDRl, VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 135 and the anti-ErbB3 V
  • the anti-IGF- 1 R VHCDR 1 , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 10 and the anti-IGF- 1R VLCDRl, VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:34; and (a) the anti-ErbB3 VHCDRl, VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 134 and the anti-ErbB3 VLCDRl , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 166; or (b) the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 135 and the anti-ErbB
  • the anti-IGF-lR VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ED NO: 11 and the anti-IGF-l R VLCDRl , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 35; and (a) the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 134 and the anti-ErbB3 VLCDRl , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 166; or (b) the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 135 and the anti-
  • the anti-IGF-lR VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:8 and the anti-IGF-lR VLCDRl , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:33; and (a) the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 134 and the anti-ErbB3 VLCDRl , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 166; or (b) the anti-ErbB3 VHCDRl , VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 135 and the anti-Er
  • the anti-IGF-lR VHCDRl , VHCDR2, VHCDR3 of a PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 10 and the anti-IGF-lR VLCDRl, VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO:32; and (a) the anti-ErbB3 VHCDRl, VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 134 and the anti-ErbB3 VLCDRl , VLCDR2 and VLCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 166; or (b) the anti-ErbB3 VHCDRl, VHCDR2, VHCDR3 of the PBA comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 135 and the anti-ErbB3
  • each anti-IGF-lR binding site of a PBA comprises a VH domain comprising the sequence of SEQ ID NO: 1 , wherein the sequence comprises variable aas, which independently represent any aa set forth at the corresponding position in Fig. 1 and/or each anti-IGF-lR binding site of a PBA comprises a VL domain comprising the sequence of SEQ ID NO:2 (or 3), wherein the sequence comprises variable aas, which independently represent any aa set forth at the corresponding position in Fig. 2.
  • each anti-ErbB3 binding site of a PBA comprises a VH domain comprising the sequence of SEQ ID NO:4 (or 5), wherein the sequence comprises variable aas, which independently represent any aa set forth at the corresponding position in Fig. 3 and/or each anti-ErbB3 binding site of a PBA comprises a VL domain comprising the sequence of SEQ ID NO:6 (or 7), wherein the sequence comprises variable aas, which independently represent any aa set forth at the corresponding position in Fig. 4.
  • each anti-IGF-lR binding site of a PBA comprises a VH domain comprising the sequence of SEQ ED NO: 1 and a VL domain comprising the sequence of SEQ ID NO:2 (or 3) and each anti-ErbB3 binding site of the PBA comprises a VH domain comprising the sequence of SEQ ID NO:4 (or 5) and a VL domain comprising the sequence of SEQ ID NO:6 (or 7).
  • each anti-IGF-lR binding site of a PBA comprises a VH domain comprising the aa sequence of SEQ ID NO: 1, wherein XI is not T, X2 is not V, X6 is not R, X8 is not D or X10 is not I, or a VL domain comprising the aa sequence of SEQ ID NO: 3 or each anti-ErbB3 binding site of a PBA comprises a VH domain comprising the aa sequence of SEQ ID NO:5 or a VL domain comprising the sequence of SEQ ID NO:7.
  • each anti-IGF-lR binding site of a PBA comprises a VH domain comprising the aa sequence of SEQ ED NO: 1 , wherein XI is not T, X2 is not V, X6 is not R, X8 is not D or X10 is not I, a VL domain comprising the sequence of SEQ ID NO:3; and each anti-ErbB3 binding site of the PBA comprises a VH domain comprising the aa sequence of SEQ ED NO:5 and a VL domain comprising the sequence of SEQ ED NO:7.
  • each anti-IGF-lR binding site of a PBA comprises a VH domain comprising an aa sequence selected from the group consisting of SEQ ED NOs: 8-31 and/or a VL domain comprising an aa sequence selected from the group consisting of SEQ ED NOs: 32-133 and/or each anti-ErbB3 binding site comprises a VH aa sequence selected from the group consisting of SEQ ID NOs: 134-165; and/or a VL aa sequence selected from the group consisting of SEQ ID NOs: 166-200.
  • each first VH domain comprises an aa sequence selected from the group comprising SEQ ID NOs: 8-31
  • each first VL domain comprises an aa sequence selected from the group consisting of SEQ ID NOs: 32-133
  • each second VH domain comprises an aa sequence selected from the group consisting of SEQ ID NOs: 134-165 and each second VL domain comprises an aa sequence selected from the group comprising SEQ ID NOs: 166-200
  • each first VH domain comprises an aa sequence selected from the group comprising SEQ ID NOs: 134-165
  • each first VL domain comprises an aa sequence selected from the group consisting of SEQ ID NOs: 166-200
  • each second VH domain comprises an aa sequence selected from the group comprising SEQ ID NOs: 8-31 and each second VL domain consisting of an aa sequence selected from the group comprising SEQ ID NOs: 32-133.
  • each anti-IGF-lR VH domain of a PBA comprises the aa sequence of SEQ ID NO:8 and each anti-IGF-lR VL domain of the PBA comprises the aa sequence of SEQ ID NO:32.
  • each anti-IGF-lR VH domain of a PBA comprises the aa sequence of SEQ ID NO:9 and each anti-IGF-lR VL domain of the PBA comprises the aa sequence of SEQ ID NO:33.
  • each anti-IGF-lR VH domain of a PBA comprises the aa sequence of SEQ ID NO: 10 and each anti-IGF-lR VL domain of the PBA comprises the aa sequence of SEQ ID NO: 34.
  • each anti-IGF-lR VH domain of a PBA comprises the aa sequence of SEQ ID NO: 1 1 and each anti- IGF-1R VL domain of the PBA comprises the aa sequence of SEQ ID NO:35.
  • each anti-IGF-lR VH domain of a PBA comprises the aa sequence of SEQ ID NO: 8 and each anti-IGF-lR VL domain of the PBA comprises the aa sequence of SEQ ID NO:33.
  • each anti-IGF-lR VH domain of a PBA comprises the aa sequence of SEQ ID NO: 10 and each anti-IGF-lR VL domain of the PBA comprises the aa sequence of SEQ ID NO:32.
  • each anti-ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 134 and each anti-Ert>B3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 166.
  • each anti-ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 135 and the and- ErbB3 VL domain of the PBA comprise the aa sequence of SEQ ID NO: 167.
  • each anti-ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 136 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 168.
  • each anti-ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 137 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 169.
  • each anti-ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 138 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 170.
  • each anti-ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 139 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 171.
  • each anti-ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 140 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 172.
  • each anti-ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 141 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 173.
  • each anti- ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 142 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 174.
  • each anti- ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 143 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 175.
  • each anti- ErbB3 VH domain of a PBA comprises the aa sequence of SEQ ID NO: 136 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NOs: 169.
  • each anti-IGF-lR VH domain of a PBA comprises the aa sequence of SEQ ID NO: 8 and each anti-IGF-lR VL domain of the PBA comprises the aa sequence of SEQ ID NO:32; and (a) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 134 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 166; or (b) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 135 and the anti- ErbB3 VL domain of the PBA comprise the aa sequence of SEQ ID NO: 167; or (c) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 136 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 168; or (d) each anti-Erb
  • each anti-IGF-lR VH domain of a PBA comprises the aa sequence of SEQ ID NO:9 and each anti-IGF-lR VL domain of the PBA comprises the aa sequence of SEQ ID NO:33; and (a) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 134 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 166; or (b) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 135 and the anti- ErbB3 VL domain of the PBA comprise the aa sequence of SEQ ID NO: 167; or (c) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 136 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 168; or (d) each anti-Erb
  • each anti-IGF-lR VH domain comprises the aa sequence of
  • each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 134 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 166; or (b) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 135 and the anti- ErbB3 VL domain of the PBA comprise the aa sequence of SEQ ID NO: 167; or (c) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 136 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 168; or (d) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 137 and each anti- ErrbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 137 and each anti- ErrbB3 V
  • each anti-IGF-lR VH domain of a PBA comprises the aa sequence of SEQ ID NO: 11 and each anti-IGF-lR VL domain of the PBA comprises the aa sequence of SEQ ID NO:35; and (a) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 134 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 166; or (b) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 135 and the anti- ErbB3 VL domain of the PBA comprise the aa sequence of SEQ ID NO: 167; or (c) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 136 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 168; or (d) each anti-Erb
  • each anti-IGF-lR VH domain of the PBA comprises the aa sequence of SEQ ID NO: 8 and each anti-IGF-lR VL domain of the PBA comprises the aa sequence of SEQ ID NO:33; and (a) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 134 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 166; or (b) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 135 and the anti- ErbB3 VL domain of the PBA comprise the aa sequence of SEQ ID NO: 167; or (c) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 136 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 168; or (d) each anti-ErbB
  • each anti-IGF-lR VH domain of a PBA comprises the aa sequence of SEQ ID NO: 10 and each anti-IGF-lR VL domain of the PBA comprises the aa sequence of SEQ ID NO:32; and (a) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 134 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 166; or (b) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 135 and the anti- ErbB3 VL domain of the PBA comprise the aa sequence of SEQ ID NO: 167; or (c) each anti-ErbB3 VH domain of the PBA comprises the aa sequence of SEQ ID NO: 136 and each anti-ErbB3 VL domain of the PBA comprises the aa sequence of SEQ ID NO: 168; or (d) each anti-Erb
  • each heavy chain of a PBA comprises an aa sequence selected from the group consisting of SF-G1 -P1 (SEQ ID NO:212); SF-G1 -M 1.3 (SEQ ID NO:212); SF-G1 -M 1.3 (SEQ ID NO:212).
  • each heavy chain of a PBA comprises an aa sequence differing in at least one aa addition, deletion or substitution from an aa sequence selected from the group consisting of SF-G1-P1 (SEQ ID NO:212); SF-G1 -M1.3 (SEQ ID NO:214); SF-G1 - M27 (SEQ ID NO:216); SF-G1-P6 (SEQ ID NO:218); SF-G1-B69 (SEQ ID NO:220); P4-G1 - C8 (SEQ ID NO:222); P4-G1-P1 (SEQ ID NO:224); P4-G1-M1.3 (SEQ ID NO:226); P4-G1- M27 (SEQ ED NO:228); P4-G1-P6 (SEQ ID NO:230); P4-G1-B69 (SEQ ID NO:232); M78-G1 - C8 (SEQ ID NO:234); M78-G
  • each light chain of the PBA comprises an aa sequence differing in at least one aa addition, deletion or substitution from an aa sequence selected from the group consisting of PI lambda light chain (SEQ ED NO:25
  • each heavy chain of a PBA, bound to the other heavy chain of the PBA by at least one bond comprises an aa sequence that is at least 90% identical to one of the following aa sequences or differs from one of the following aa sequences in 1-30 aa substitutions, deletions and/or additions: SF-G1-P1 (SEQ ED NO:212); SF-G1-M1.3 (SEQ ED NO:214); SF-G1-M27 (SEQ ED NO:216); SF-G1-P6 (SEQ ED NO:218); SF-G1-B69 (SEQ ED NO:220); P4-G1-C8 (SEQ ID NO:222); P4-G1-P1 (SEQ ED NO:224); P4-G1 -M1.3 (SEQ ED NO:226); P4-G1-M27 (SEQ ED NO:228); P4-G1 -P6 (SEQ ED NO:
  • each heavy chain of a PBA comprises an aa sequence that is at least 95% identical to one of the following aa sequence or differs from one of the following aa sequences in 1-10 aa substitutions, deletions and/or additions: SF-G1-P1 (SEQ ID NO:212); SF-G1-M1.3 (SEQ ID NO:214); SF-G1-M27 (SEQ ID NO:216); SF-G1-P6 (SEQ ID NO:218); SF-G1-B69 (SEQ ID NO:220); P4-G1-C8 (SEQ ID NO:222); P4-G1-P1 (SEQ ID NO:224); P4- G1-M1.3 (SEQ ID NO:226); P4-G1-M27 (SEQ ID NO:228); P4-G1 -P6 (SEQ ID NO:230); P4- G1-B69 (SEQ ID NO:232); M78-G1
  • Exemplary PBA include the following: (a) an SF-G1-P1 PBA comprising: two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO:212; and two light chains, each comprising a light chain sequence of SEQ ED NO:202; (b) An SF-G1-M1.3 PBA comprising: two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO:214; and two light chains, each comprising a light chain aa sequence of SEQ ID NO:202; (c) an SF- G1-M27 PBA comprising: two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO:216; and two light chains, each comprising a light chain aa sequence of SEQ ID NO:202; (d) an SF-G1 -P6 PBA comprising: two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO:218; and two light chains, each comprising a light chain a
  • 1R monoclonal antibody comprises a first sequence comprising in amino to carboxy order a VLCDR1 sequence, a VLCDR2 sequence and a VLCDR3 sequence of SF kappa light chain as indicated by dotted underlining in Fig. 5A, SEQ ID NO:202, antibody further comprising a second sequence comprising in amino to carboxy order a VHCDR1 sequence, a VHCDR2 sequence and a VHCDR3 sequence of SF heavy chain as indicated by the first three dotted underlined sequences respectively in Fig. 5 A, SEQ ID NO:210, wherein the first sequence and the second sequence are non-overlapping.
  • an anti- IGF-1R monoclonal antibody comprises in amino to carboxy order a VLCDR1 sequence, a VLCDR2 sequence and a VLCDR3 sequence of P4 kappa light chain as indicated by dotted underlining in Fig. 5A, SEQ ID NO: 204, antibody further comprising in amino to carboxy order a VHCDR1 sequence, a VHCDR2 sequence and a VHCDR3 sequence of P4 heavy chain as indicated by the first three dotted underlined sequences respectively in Fig. 5A, SEQ ID NO:222.
  • an anti- IGF-1R monoclonal antibody comprises in amino to carboxy order a VLCDR1 sequence, a VLCDR2 sequence and a VLCDR3 sequence of M78 kappa light chain as indicated by dotted underlining in Fig. 5 A, SEQ ID NO: 206, antibody further comprising in amino to carboxy order a VHCDR1 sequence, a VHCDR2 sequence and a VHCDR3 sequence of M78 heavy chain as indicated by the first three dotted underlined sequences respectively in Fig. 5A, SEQ ID NO:234.
  • an anti- IGF-IR monoclonal antibody comprising in amino to carboxy order a VLCDRl sequence, a VLCDR2 sequence and a VLCDR3 sequence of M57 kappa light chain as indicated by dotted underlining in Fig. 5A, SEQ ID NO:208, antibody further comprising in amino to carboxy order a VHCDR1 sequence, a VHCDR2 sequence and a VHCDR3 sequence of M57 heavy chain as indicated by the first three dotted underlined sequences respectively in Fig. 5A, SEQ ID NO:246.
  • an anti-IGF-l R antibody comprises a VH domain comprising a set of three VH CDRs comprising VHCDR1, VHCDR2, VHCDR3, and/or a VL domain comprising a set of three VL CDRs comprising VLCDRl , VLCDR2 and VLCDR3, CDRs comprising the sequences of SEQ ID NOs: 302, 303, 304, 305, 306, and 307, respectively, and each CDR further comprising an amino terminus and a carboxy terminus, wherein the CDRs of each set of CDRs are arranged in the antibody in a linear amino to carboxy order of CDR1 , CDR2, and CDR3, wherein the CDRs comprise variable aas, which independently represent any aa set forth at the corresponding position in Fig.
  • the antibody does not comprise the SF module.
  • the VHCDR1, VHCDR2, VHCDR3, VLCDRl , VLCDR2 and VLCDR3 of an anti-IGF-lR antibody comprise the sequences of SEQ ID NOs: 302, 303, 304, 305, 306, and 308, respectively.
  • the VHCDR1 , VHCDR2 and VHCDR3 domains of an anti-IGF-lR antibody comprise the corresponding aa sequences of any one of SEQ ID NOs: 8-10 and 12-31 , and the VLCDRl , VLCDR2 and
  • VLCDR3 domains of the anti-IGF-lR antibody comprise the corresponding aa sequences of any one of SEQ ID NOs: 32-34 and 36-133.
  • the VHCDR1 , VHCDR2, VHCDR3 of an anti-IGF-lR antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO:8 and the VLCDRl
  • VLCDR2 and VLCDR3 of the anti-IGF-lR antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO:32
  • the VHCDR1 , VHCDR2, VHCDR3 of the anti-IGF-lR antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO:9 and the VLCDRl
  • VLCDR2 and VLCDR3 of the anti-IGF-lR antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 33; or
  • VHCDR1, VHCDR2, VHCDR3 of the anti-IGF- 1R antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 8 and the VLCDRl
  • VLCDR2 and VLCDR3 of the anti-IGF-lR antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO:33
  • the VHCDR1 , VHCDR2, VHCDR3 of the anti-IGF-lR antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 10 and the VLCDR1, VLCDR2 and VLCDR3 of the anti-IGF-lR antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO:32.
  • the VH domain of an anti-IGF-lR antibody comprises the aa sequence of SEQ ID NO: 1 , which sequence comprises variable aas, which independently represent any aa set forth at the corresponding position in Fig. 1 ;
  • the VL domain of the anti-IGF- 1R antibody comprises the aa sequence of SEQ ID NO:2 (or 3), which sequence comprises variable aas, which independently represent any aa set forth at the corresponding position in Fig. 2;
  • the VH domain of the anti-IGF-lR antibody comprises the aa sequence of SEQ E) NO: 1 and the VL domain of the anti-IGF-lR antibody comprises the aa sequence of SEQ ID NO:2 or 3.
  • the VH domain of an anti-IGF-lR antibody comprises an aa sequence selected from the group consisting of SEQ ID NOs: 8-10 and 12-31 and the VL domain comprises an aa sequence selected from the group consisting of SEQ ID NOs: 32-34 and 36-133.
  • the VH domain of an anti-IGF-lR antibody comprises an aa sequence that is at least 90% identical to, or which differs in 1-30 aa aa substitutions, additions or deletions from, an aa sequence of any of SEQ ID NOs: 8-10 and 12-31
  • the VL domain of the anti-IGF-lR antibody comprises an aa sequence that is at least 90% identical to, or which differs in 1-30 aa aa substitutions, additions or deletions from, an aa sequence of an aa sequence of any of SEQ ID NOs: 32-34 and 36-133.
  • the VH domain of an anti-IGF-lR antibody comprises an aa sequence that is at least 95% identical to, or which differs in 1-10 aa aa substitutions, additions or deletions from, an aa sequence of any of SEQ ID NOs: 8-10 and 12-31
  • the VL domain comprises an aa sequence that is at least 95% identical to, or which differs in 1-10 aa aa substitutions, additions or deletions from, an aa sequence of an aa sequence of any of SEQ ID NOs: 32-34 and 36-133.
  • An anti-IGF-lR antibody may be an IgGl antibody, e.g., an isolated and/or a monoclonal IgGl antibody.
  • an anti-IGF-lR antibody is a protein comprising two pairs of polypeptide chains, each pair comprising a heavy chain and a light chain; wherein (a) each heavy chain comprises an aa sequence of SEQ ID NOs: 359, 360 or 361 ; and/or (b) each light chain comprises an aa sequence of SEQ ID NOs: 204, 206 or 208.
  • an anti- IGF-1R antibody is a protein comprising two pairs of polypeptide chains, each pair comprising a heavy chain and a light chain; wherein (a) each heavy chain comprises an aa sequence that is at least 90% identical to, or which differs in 1-30 aa aa substitutions, additions or deletions from, an aa sequence of any of SEQ ID NOs:359, 360 or 361 , and/or (b) each light chain comprises an aa sequence that is at least 90% identical to, or which differs in 1-30 aa aa substitutions, additions or deletions from, an aa sequence of an aa sequence of any of SEQ ID NOs: 204, 206 or 208.
  • each heavy chain of an anti-IGF-lR antibody comprises an aa sequence that is at least 95% identical to, or which differs in 1-10 aa aa substitutions, additions or deletions from, an aa sequence of any of SEQ ID NOs:359, 360 or 361
  • each light chain comprises an aa sequence that is at least 95% identical to, or which differs in 1- 10 aa aa substitutions, additions or deletions from, an aa sequence of an aa sequence of any of SEQ ID NOs: 204, 206 or 208.
  • Exemplary antibodies include (a) an anti-IGF-Rl monoclonal IgGl antibody P4 comprising two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO:359 and two light chains, each comprising a light chain aa sequence of SEQ ID NO:204; (b) an anti- IGF-R1 monoclonal IgGl antibody M78 comprising two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO:360 and two light chains, each comprising a light chain aa sequence of SEQ ID NO: 206; (c) an anti-IGF-Rl monoclonal IgGl antibody M57 comprising two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO: 361 and two light chains, each comprising a light chain aa sequence of SEQ ID NO:208; (d) an anti-IGF-Rl monoclonal IgGl antibody M57/M78 comprising two heavy chains, each comprising a heavy
  • Anti-IGF-lR antibodies may comprise one or more additional binding sites, e.g., an anti- ErbB3 binding site.
  • an anti-ErbB3 monoclonal antibodies e.g., monoclonal anti-ErbB3 antibodies.
  • an anti-ErbB3 comprises in amino to carboxy order a
  • an anti-ErbB3 monoclonal antibody comprises in amino to carboxy order a VLCDRl sequence, a VLCDR2 sequence and a VLCDR3 sequence of M27 lambda light chain as indicated by dotted underlining in Fig.
  • an anti- ErbB3 monoclonal antibody comprises in amino to carboxy order a VLCDRl sequence, a VLCDR2 sequence and a VLCDR3 sequence of M7 lambda light chain as indicated by dotted underlining in Fig.
  • an anti-ErbB3 monoclonal antibody comprises in amino to carboxy order a VLCDRl sequence, a VLCDR2 sequence and a VLCDR3 sequence of B72 lambda light chain as indicated by dotted underlining in Fig.
  • an anti-ErbB3 monoclonal antibody comprises in amino to carboxy order a VLCDRl sequence, a VLCDR2 sequence and a VLCDR3 sequence of B60 lambda light chain as indicated by dotted underlining in Fig.
  • SEQ ID NO:266 antibody further comprising in amino to carboxy order a VHCDR1 sequence, a VHCDR2 sequence and a VHCDR3 sequence of B60 heavy chain as indicated by the first three dotted underlined sequences respectively in Fig. 5B, SEQ ID NO:292.
  • an isolated anti-ErbB3 antibody binding specifically to human ErbB3 comprises a VH domain comprising a set of three VH CDRs comprising VHCDR1 , VHCDR2, VHCDR3, and/or a VL domain comprising a set of three VL CDRs comprising VLCDRl , VLCDR2 and VLCDR3, CDRs comprising the sequences of SEQ ID NOs: 309, 310, 31 1 , 312, 313, and 314, respectively, and each CDR further comprises an amino terminus and a carboxy terminus, wherein the CDRs of each set of CDRs are arranged in the antibody in a linear amino to carboxy order of CDR1 , CDR2, and CDR3, wherein the CDRs comprise variable aas, which independently represent any aa set forth at the corresponding position in Fig.
  • VHCDR1 , VHCDR2, VHCDR3, VLCDRl, VLCDR2 and VLCDR3 of an anti-ErbB3 antibody comprise the sequences of SEQ ID NOs: 309, 310, 31 1 , 312, 313, and 315, respectively.
  • the VHCDR1 , VHCDR2 and VHCDR3 domains of an anti-ErbB3 antibody comprise the corresponding aa sequences of any one of SEQ ID NOs: 134-142 and 144-165
  • the VLCDRl , VLCDR2 and VLCDR3 domains of the antibody comprise the corresponding aa sequences of any one of SEQ ID NOs: 166-174 and 176-200.
  • the VHCDR1 , VHCDR2, VHCDR3 of an anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 134 and the VLCDR l , VLCDR2 and VLCDR3 of the anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 166.
  • the VHCDR1, VHCDR2, VHCDR3 of an anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 135 and the VLCDRl
  • VLCDR2 and VLCDR3 of the anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 167.
  • the VHCDRl , VHCDR2, VHCDR3 of an anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 136 and the VLCDR1, VLCDR2 and VLCDR3 of the anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 168.
  • the VHCDRl , VHCDR2, VHCDR3 of an anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 137 and the VLCDR1 , VLCDR2 and VLCDR3 of the anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 169.
  • the VHCDRl , VHCDR2, VHCDR3 of an anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 138 and the VLCDR1 , VLCDR2 and VLCDR3 of the anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 170.
  • the VHCDRl , VHCDR2, VHCDR3 of the anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 139 and the VLCDR1 , VLCDR2 and VLCDR3 of the anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 171.
  • the VHCDRl , VHCDR2, VHCDR3 of an anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ED NO: 140 and the VLCDR1 , VLCDR2 and VLCDR3 of the antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 172.
  • the VHCDRl, VHCDR2, VHCDR3 of an anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 141 and the VLCDR1 , VLCDR2 and VLCDR3 of the anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NOs: 173.
  • the VHCDRl , VHCDR2, VHCDR3 of an anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 142 and the VLCDR1 , VLCDR2 and VLCDR3 of the anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 174.
  • the VHCDRl , VHCDR2, VHCDR3 of an anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 136 and the VLCDR1 , VLCDR2 and VLCDR3 of the anti-ErbB3 antibody comprise the aa sequence of the corresponding CDRs of SEQ ID NO: 169.
  • the VH domain of an anti-ErbB3 antibody comprises the aa sequence of SEQ ID NO:4 (or 5), which sequence comprises variable aas, which independently represent any aa set forth at the corresponding position in Fig. 3 and/or the VL domain of the anti-ErbB3 antibody comprises the aa sequence of SEQ ID NO:6 (or 7), which sequence comprises variable aas, which independently represent any aa set forth at the corresponding position in Fig. 4.
  • the the VH domain of an anti-ErbB3 antibody comprises an aa sequence selected from the group consisting of SEQ ID NOs: 134-142 and 144- 165 and/or the VL domain of the anti-ErbB3 antibody comprises an aa sequence selected from the group consisting of SEQ ID NOs: 166-174 and 176-200.
  • the VH domain of an anti-ErbB3 antibody comprises an aa sequence that is at least 90% identical to, or which differs in 1 -30 aa aa substitutions, additions or deletions from, an aa sequence of any of SEQ ID NOs: 134-142 and 144-165
  • the VL domain of the anti-ErbB3 antibody comprises an aa sequence that is at least 90% identical to, or which differs in 1-30 aa aa substitutions, additions or deletions from, an aa sequence of an aa sequence of any of SEQ ID NOs: 166-174 and 176-200.
  • the VH domain of an anti-ErbB3 antibody comprises an aa sequence that is at least 95% identical to, or which differs in 1-10 aa aa substitutions, additions or deletions from, an aa sequence of any of SEQ ID NOs: 134-142 and 144-165
  • the VL domain comprises an aa sequence that is at least 95% identical to, or which differs in 1-10 aa aa substitutions, additions or deletions from, an aa sequence of an aa sequence of any of SEQ ID NOs: 166-174 and 176-200.
  • An anti-ErbB3 antibody may be an IgGl antibody, e.g., an isolated monoclonal IgGl antibody.
  • an anti-ErbB3 antibody is a protein comprising two pairs of polypeptide chains, each pair comprising a heavy chain and a light chain; wherein (a) each heavy chain comprises an aa sequence of SEQ ID NOs: 362, 363, 364, 365 or 366; and/or (b) each light chain comprises an aa sequence of SEQ ID NOs: 258, 260, 262, 264 or 266.
  • an anti-ErbB3 antibody is a protein comprising two pairs of polypeptide chains, each pair comprising a heavy chain and a light chain; wherein (a) each heavy chain comprises an aa sequence that is at least 90% identical to, or which differs in 1-30 aa aa substitutions, additions or deletions from, an aa sequence of any of SEQ ID NOs: 362, 363, 364, 365 or 366, and/or .(b) each light chain comprises an aa sequence that is at least 90% identical to, or which differs in 1-30 aa aa substitutions, additions or deletions from, an aa sequence of an aa sequence of any of SEQ ID NOs: 258, 260, 262, 264 or 266.
  • an anti-ErbB3 antibody is a protein comprising two pairs of polypeptide chains, each pair comprising a heavy chain and a light chain; wherein (a) each heavy chain comprises an aa sequence that is at least 95% identical to, or which differs in 1-10 aa aa substitutions, additions or deletions from, an aa sequence of any of SEQ ID NOs: 362, 363, 364, 365 or 366, and (b) each light chain comprises an aa sequence that is at least 95% identical to, or which differs in 1-10 aa a substitutions, additions or deletions from, an aa sequence of an aa sequence of any of SEQ ID NOs: 258, 260, 262, 264 or 266.
  • An anti-ErbB3 antibody may comprise one or more other binding sites, e.g., an anti- IGF-1R binding site.
  • Exemplary anti-ErbB3 antibodies include: (a) an anti-ErbB3 monoclonal IgGl antibody PI comprising two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO:362 and two light chains, each comprising a light chain aa sequence of SEQ ID NO:258; (b) an anti- ErbB3 monoclonal IgGl antibody M27 comprising two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO: 363 and two light chains, each comprising a light chain aa sequence of SEQ ID NO:260; (c) an anti-ErbB3 monoclonal IgGl antibody M7 comprising two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO: 364 and two light chains, each comprising a light chain aa sequence of SEQ ID NO:262; (d) an anti-ErbB3 monoclonal IgGl antibody B72 comprising two heavy chains, each comprising
  • monoclonal IgGl antibody M27/M7 comprising two heavy chains, each comprising a heavy chain aa sequence of SEQ ID NO:363 and two light chains, each comprising a light chain aa sequence of SEQ ID NO : 262.
  • scFvs which may be monoclonal scFvs.
  • exemplary scFvs include (a) anti-IGF-Rl scFv antibody P4 comprising an aa sequence of SEQ ED NO:367; (b) anti-IGF-Rl scFv antibody M57 comprising an aa sequence of SEQ ED NO:368; (c) anti-IGF-Rl scFv antibody M78 comprising an aa sequence of SEQ ED NO:369; (d) anti-ErbB3 scFv antibody C8 comprising an aa sequence of SEQ ED NO:370; (e) anti-ErbB3 scFv antibody PI comprising an aa sequence of SEQ ED NO:371; (f) anti-ErbB3 scFv antibody M1.3 comprising an aa sequence of SEQ ED NO:372; (g) anti-ErbB3 scFv antibody M1.3
  • compositions comprising a PBA; an anti-IGF-lR antibody; or an anti-
  • ErbB3 antibody and a pharmaceutically acceptable carrier.
  • a composition comprising an anti- IGF-1R antibody may further comprise an anti-ErbB3 antibody.
  • a composition comprising an anti-ErbB3 antibody may further comprise an anti-IGF-lR antibody.
  • nucleic acid molecules comprising at least one coding sequence, ⁇ ' at least one coding sequence encoding an antibody or a chain thereof, as set forth herein.
  • the nucleic acid molecule may comprise either or both of a promoter nucleotide sequence and an enhancer nucleotide sequence, which nucleotide sequence is operably linked to the at least one coding sequence and promotes or enhances the expression of the antibody.
  • vectors e.g., vectors comprising one or more nucleic acid molecules provided herein, as well as host cells comprising one or more vectors provided herein.
  • anti-IGF-lR+anti-ErbB3 PBAs wherein the PBA has a half-life of at least 45 hours in a Cynomolgus monkey, when the PBA is administred intraveniously at doses equal to or higher than 5mg/kg.
  • a PBA has a half-life that is statistically significantly longer (e.g., by 50%, 2 fold or more) in an organism that is a mouse or a cynomolgus monkey than the half-life of another polyvalent bispecific ab in the same organism, binding to the same epitopes, wherein the orientation of antigen binding specificities is reversed between of the fab and of the scfv.
  • PBAs may suppress heregulin-induced pAKT signaling in a cell, e.g., a cancer eel, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100%.
  • PBAs may suppress IGF-l-induced pAKT signaling in a cell, e.g., a cancer cell, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100%.
  • PBAs may suppress insulin-induced pAKT signaling in a cell, e.g., a cancer cell, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100%.
  • PBAs may suppress the IGF-2-induced pAKT signaling in a cell, e.g., a cancer cell, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%%, 97%, 98%, 99% or 100%.
  • a PBA may inhibit mTOR activation (phosphorylation) in a tumor cell in vivo or in vitro to a greater extent than monospecific anti-IGF-1 R Ab# A or than a monospecific anti-IGF- 1R Ab that binds to the same epitope on IGF-IR as the PBA.
  • PBAs may reduce mTOR protein levels in a tumor cell in vivo or in vitro to a greater extent than monospecific anti-IGF-1 R Ab# A, or than a monospecific anti-IGF-1 R Ab that binds to the same epitope on IGF- IR as the PBA.
  • a PBA reduces mTOR activation or mTOR protein levels in a tumor cell in vivo or in vitro by a factor of at least 50%, or by 2, 3, 4 or 5 fold or greater than 5 fold relative to monospecific anti-IGF-1 R Ab# A or relative to a monospecific anti-IGF-1 R Ab that binds to the same epitope on IGF-IR as the PBA.
  • a PBA is more effective at inhibiting tumor growth in a human xenograft model in nu/nu mice than is an equimolar amount of an anti-IGF-1 R IgG.
  • the xenograft models comprise human DU145, BxPC-3, S -ES-1 , or Caki-1 cell xenografts.
  • a polyvalent bispecific antibody is more effective at inhibiting tumor growth in a human xenograft model in nu/nu mice than is a combination of an equimolar amount of an anti-IGF-1 R IgG combined with an equimolar amount of an anti-ErbB3 IgG.
  • Fig. 1A-B an alignment of exemplary IGF-1R VH sequences (SEQ ID NOs:8-31 and 384-385, numbered consecutively from top to bottom) and a consensus sequence (SEQ ID NO: l) derived therefrom.
  • the CDRs are underlined and the SEQ ID NOs of the CDRs are provided above the CDRs as a number in square brackets (e.g. , "[S.302]").
  • Fig. 2A-E an alignment of exemplary IGF-1R VL sequences (SEQ ED NOs:32-133 and 386-387, numbered consecutively from top to bottom) and two consensus sequences (SEQ ID NOs:2 and 3) derived therefrom.
  • SEQ ED NO:2 includes the VL domain of 16F, whereas SEQ ID NO:3 does not.
  • the CDRs are underlined and the SEQ ID NOs of the CDRs are provided above the CDRs as a number in square brackets.
  • Fig. 3A-B an alignment of exemplary ErbB3 VH sequences (SEQ ID NOs: 134-165 and 388, numbered consecutively from top to bottom) and two consensus sequences (SEQ ID NOs:4 and 5) derived therefrom.
  • SEQ ID NO:4 includes the VH domain of 16F, whereas SEQ ID NO: 5 does not.
  • the CDRs are underlined and the SEQ ID NOs of the CDRs are provided above the CDRs as a number in square brackets.
  • Fig. 4A-B an alignment of exemplary ErbB3 VL sequences (SEQ ID NOs: 166-200, numbered consecutively from top to bottom) and two consensus sequences (SEQ ID NOs:6 and 7) derived therefrom.
  • SEQ ID NO:6 includes the VL domain of 16F, whereas SEQ ID NO:7 does not.
  • the CDRs are underlined and the SEQ ID NOs of the CDRs are provided above the CDRs as a number in parenthesis.
  • Fig. 5 Aa sequences of the light and heavy chains of exemplary anti-IGF-lR-IgGl-anti- ErbB3 (Fig. 5 A) and anti-ErbB3-IgGl- anti-IGF-l R (Fig. 5B) polyvalent bispecific antibodies.
  • Fig. 5A shows the aa sequences of the following anti-IGF-lR-IgG l-anti-ErbB3 hybrid heavy chains: SF-G1-C8 (i.e., 16F - SEQ ID NO:210); SF-G1-P1 (SEQ ID NO:212); SF-G1- M1.3 (SEQ ID NO:214); SF-G1 -M27 (SEQ ID NO:216); SF-G1-P6 (SEQ ID NO:218); SF-G1 - B69 (SEQ ID NO:220); P4-G1-C8 (SEQ ID NO:222); P4-G1 -P1 (SEQ ED NO:224); P4-G1- M1.3 (SEQ ID NO:226); P4-G1 -M27 (SEQ ED NO:228); P4-G1-P6 (SEQ ED NO:230); P4-G1 - B69 (SEQ ED NO:232); M
  • M57-G1 -M1.3 SEQ ED NO:250
  • M57-G1 -M27 SEQ ED NO:252
  • M57-G 1 -P6 SEQ ID NO:254
  • M57-G1-B69 SEQ D NO:256.
  • Fig. 5B shows the aa sequences of the following anti-ErbB3-IgG 1 - anti-IGF-lR hybrid heavy chains: P1-G1 -P4 (SEQ ID NO:268); P1-G1 -M57 (SEQ ED NO:270); P1-G1 -M78 (SEQ ED NO:272); M27-G1 -P4 (SEQ ID NO:274); M27-G1-M57 (SEQ ID NO:276); M27-G1-M78 (SEQ ED NO:278); M7-G1-P4 (SEQ ED NO:280); M7-G1 -M57 ((SEQ ED NO:282); M7-G1- M78 (SEQ ID NO:284); B72-G 1 -P4 (SEQ ID NO:286); B72-G1 -M57 (SEQ ID NO:288); B72- G1-M78 (SEQ ID NO:290); B
  • Each of these hybrid heavy chains of Fig.Figs. 5A and 5B comprises three named modules and each is named according to its modular composition (see Fig. 8), with, on the left, the name of a first, amino-terminal module, in the middle, the name of the second, middle module (always Gl or G2, as indicated, in the polyvalent bispecific antibodies whose sequences are provided in Fig.Figs. 5A and 5B) and on the right, the name of the third, carboxy-terminal module.
  • Each first, amino-terminal module comprises a heavy chain VR comprising from left to right a VHCDR1 , a VHCDR2 and a VHCDR3, each indicated by dotted underlining.
  • Each second, middle module is named Gl or G2 and comprises an IgGl CR, and does not form an antigen binding site in a polyvalent bispecific antibody.
  • the hinge, CH2 and CH3 portions of the Gl or G2 module sequence is single underlined.
  • the CHI portion starts at ASTK (SEQ ID NO: 392).
  • a Gly-Ser linker sequence linking the Gl module with the third module is double underlined.
  • Each third, carboxy-terminal module appears to the right of this Gly-Ser linker sequence and comprises an scFv that comprises a heavy chain VR comprising from left to right a VHCDR1, a VHCDR2 and a VHCDR3 (each dotted underlined), a Gly-Ser scFv linker (double wavy underlined), and a light chain VR comprising a VLCDR1, a VLCDR2 and a VLCDR3 (each dotted underlined).
  • each amino or carboxy-terminal heavy chain module is the same as the correspondingly named light chain of Fig. 5 A or 5B.
  • Fig. 5 A shows aa ("aa") sequences of the following mature anti-IGF-Rl kappa light chains: SF (SEQ ID NO:202), P4 (SEQ ID NO:204), M78 (SEQ ID NO:206), and M57 (SEQ ID NO:208).
  • Fig. 5B shows aa sequences of the following mature anti-ErbB3 lambda light chains: PI (SEQ ID NO:258), M27 (SEQ ID NO:260), M7 (SEQ ID NO:262), B72 (SEQ ID NO:264), and B60 (SEQ ID NO:266).
  • Each light chain of Fig.Figs. 5 A and 5B comprises, from left to right, a VLCDR 1 , a VLCDR2 and a VLCDR3 (each dotted underlined).
  • the CL domain starts at "RTVAA” (SEQ ID NO:393) in the anti-IGF-lR VL domain and at "QP AA” (SEQ ID NO:394) in the anti- ErbB3 VL domain.
  • each heavy chain is co-expressed with a light chain which shares the name of the amino-terminal module of the heavy chain.
  • Each of the resultant polyvalent bispecific antibodies takes the form of an IgG antibody (which comprises, as do native IgG antibodies, two essentially identical antigen binding sites) with an scFv appended to the carboxy terminus of each of the two heavy chains of the IgG.
  • Fig. 6 Aa sequences of the heavy chains of exemplary 6A) anti-IGF-lR IgGl antibodies and 6B) anti-ErbB3 IgGl antibodies; and aa sequences of 6C) anti-IGF-lR scFvs, and 6D) anti- ErbB3 scFvs.
  • Fig. 7 Aa sequences of 7A) the heavy chains and 7B) the light chains, of SF-G1-C8 (16F), each with a leader sequence that is absent in the mature antibody.
  • the heavy chain aa sequence (SEQ ID NO:300) is that of SF-G1-C8 (SEQ ID NO:210) with an added N-terminal leader sequence.
  • the light chain aa sequence (SEQ ID NO:298) is that of SF kappa light chain (SEQ ID NO:202) with an added N-terminal leader sequence.
  • the leader sequences are in boldface and underlined; the dotted underlined sequences are CDRs as indicated above each; the linkers (hinge, connecting linker and scFv linker) are indicated above their boldfaced sequences, and the individual CH3 aa residues E356 and M358 are in bold (these are aas that can be substituted as follows E356D and M358L).
  • the identities of the CHI , CH2, CH3, VH and VL domains in Fig. 7A and the CL domain in Fig. 7B are indicated above each domain, with the start point of each indicated by a right-angled arrow.
  • Fig. 8 Schematic view showing the derivation of modules of an Ig-like tetravalent bispecific antibody.
  • the antibodies from which the binding domains ("N-terminal module” and "C-terminal module”) are derived are labeled monoclonal antibody 1 and monoclonal antibody 2.
  • the diagrams and modules are conceptual in nature; the actual DNA fragments that are joined together to prepare such a bispecific antibody may not coincide with the limits of the modules, but the end result is essentially as shown.
  • monoclonal antibody 1 and monoclonal antibody 2 may not be in IgG format as shown - for example, either or both may be an scFv.
  • an scFv is used as the source of an N-terminal module, it is converted from scFv format to Fv format by removal of the DNA sequence encoding the scFv linker to yield VH and VL regions that are comprised by heavy and light polypeptide chains respectively.
  • Fig. 9 Simulation of the ErbB network predicts design of an optimal ErbB3 therapeutic.
  • 9A Complexity of the ErbB network depicted graphically: Each of ligand binding, receptor dimerization, receptor trafficking and intracellular signaling were captured in a mass-action based kinetic model.
  • 9B Simulated perturbation of each protein in the ErbB network was used to identify the sensitivity of the downstream signal, phospho-Akt, towards each protein under either heregulin or betacellulin stimulation.
  • 9C Dose responsiveness of Akt to an anti-ErbB3 antibody was examined for a variety of affinity binding constants through variation of the dissociation rate.
  • Fig. 10 Ability of a bispecific antibody to co-inhibit two pathways is predicted to be dependent on relative receptor levels. The effect of a computationally simulated bispecific antibody on the active level of A) IGF-1R, B) ErbB3 and C) a common downstream signaling pathway element, Akt (the Akt kinase), was computationally simulated for cells expressing three different molar ratios of each receptor to the other. The three curves in each graph can be identified by the relative positions at which each of their right-hand ends intersects the boarder of the graph.
  • Leftmost x-axis /bottommost y-axis intersecting curve simulation of 10 times more of IGF-1R than ErbB3
  • middle intersecting curve simulation of equal levels of IGF-1R and ErbB3
  • rightmost x-axis/topmost y-axis intersecting curve simulation of 10 times more ErbB3 than IGF-1R. Due to the lower affinity of the bispecific towards IGF-1R, potency of IGF-1R inhibition decreases when the ErbB3 levels decrease, indicating the effect of avidity. Failure to potently inhibit IGF-1R leads to a decreased ability to inhibit pAkt (right). The ability to inhibit ErbB3 is unaffected by the level of IGF-1R due the stronger affinity of the bispecific towards ErbB3.
  • Fig. 11 Concurrent optimization of scFv affinity and stability by covalent yeast display.
  • 1 1 A) Affinity of post-thermal-challenge-isolated yeast-displayed scFv modules to soluble GFR2(ErbB3)-Fc measured by fluorescence-activated cell sorting. 1 IB) Thermal challenge assay on optimized scFv modules covalently attached to yeast surface confirms their higher thermal stability. The residual binding activity to ErbB3-Fc remaining after heat stress for 5 minutes at 65°C was measured by fluorescence-activated cell sorting. MFI mean fluorescence intensity.
  • Fig. 12 Differential scanning fluorescence can be used to estimate serum stability.
  • Fig. 13 Optimized bispecific antibody displays stronger cellular binding compared to proof-of-concept bispecific antibody. Binding to BxPC-3 cells, which express both IGF-1R and ErbB3, was measured by fluorescence-activated cell sorting.
  • Fig. 14 Binding to ADRr and MCF7 cells.
  • 14A Binding to ADRr cells.
  • IgG of module 2-21 refers to an anti- ErbB3 antibody having the same anti-ErbB3 VRs as those in ILE-12.
  • IgG of module 2-3 refers an anti-ErbB3 antibody having the same anti-ErbB3 VRs as those in ELI-7 and ILE-10.
  • IgG of module 5-7 refers to an anti-IGF-lR antibody having the same anti-IGF-lR VRs as those in ELI-7, ILE-10 and ILE-12.
  • 14B Binding to MC7 cells.
  • Fig. 15 pAKT inhibition by ILE-7 and ELI-7.
  • Fig. 17 Inhibition of BxPC-3 cell growth by ELI-7 measured by CTG assay.
  • Fig. 18 Xenograft tumor growth curves. A description of the IgG antibodies is provided in the figure legend of Fig. 14A.
  • Fig. 19 BxPC-3 final xenograft tumor volumes on Day 41.
  • Fig. 20 Xenograft tumor growth rates and sizes. 20A) DU145 Tumor Growth Curves. 20B) DU145 Tumor Volumes on Day 36.
  • Fig. 21 Polyvalent bispecific antibodies inhibit signaling across a broad range of ErbB3 and IGF- I R receptor levels.
  • ELI-7 displays inhibition of pAkt across BxPC-3 cell lines modified to contain a broad range of IGF1 R and ErbB3 receptor levels.
  • BxPC-3-Control refers to BxPC-3 cells with unchanged IGF-1R and ErbB3 levels.
  • BxPC-3-IGFl R-Modl refers to BxPC-3 cells in which the IGF-1R level is reduced by 37%.
  • BxPC-3-ErbB3-Modl refers to BxPC-3 cells in which the ErbB3 level is reduced by 48%.
  • BxPC-3-ErbB3-Mod2 refers to BxPC-3 cells in which the ErbB3 level is reduced by 88%.
  • Fig. 22 Reduction of pIGF-l R levels by 16F (SF-G1-C8) "re-engineered bispecific” and ELI-7 "original bispecific" in BcPC3 cells.
  • Fig. 23 Inhibition by 16F (SF-G1-C8), Anti-IGF-IR Ab#B (cixutumumab; SEQ ID 324 + SEQ ID 325), Anti-ErbB3 Ab# A (SEQ ID NO:336 + SEQ ID NO:337) or Anti-IGF-IR Ab#B + Anti-ErbB3 Ab# A of phosphorylation of: 23A) IGF1R, 23B) ErbB3, and 23C) AKT, in
  • BxPC-3 cells and inhibition by 16F (SF-G1-C8), Anti-IGF-IR Ab#B (cixutumumab; SEQ ID NO:324 + SEQ ID NO:325), Anti-ErbB3 Ab# A (SEQ ID NO:336 + SEQ ID NO:337) or Anti- IGF-IR Ab#B + Anti-ErbB3 Ab# A of phosphorylation of: 23D) IGF1R, 23E) ErbB3, and 23F) AKT, in DU145 cells.
  • Fig. 24 Signaling inhibition by 24 A) 16F (SF-G1 -C8) compared to 24B) ANTI-IGF-IR
  • Ab# A (ganitumab; SEQ ID NO:327 + SEQ ID NO:328), anti-ErbB3 Ab# A (SEQ ID NO:336 + SEQ ID NO:337) and ANTI-IGF-IR Ab# A + anti-ErbB3 Ab# A.
  • inhibition of phosphorylation of IGF1 R is shown in the top graph
  • inhibition of phosphorylation of ErbB3 is shown in the middle graph
  • inhibition of phosphorylation of AKT is shown in the bottom graph; all in BxPC-3 cells.
  • Fig. 25 Bispecific antibodies display strong binding to BxPC-3 cells. Binding curves generated after incubation of indicated antibodies with BxPC-3 cells as measured by FACS.
  • Fig. 26 Bispecific antibodies display strong binding to recombinant ErbB3 protein, Binding curves generated after incubation of indicated antibodies in ErbB3-His-coated plates and measurement of bound antibody levels by ELISA.
  • Fig. 27 Bispecific antibodies display strong inhibition of dual pathway signaling. BxPC-3 signal inhibition of generation of pIGFIR, pErbB3, and pAKT, as indicated.
  • Fig. 28 Percent stability of indicated bispecific antibodies in serum for 72 hrs at 37°C.
  • Fig. 29 show the binding of various bispecific antibodies (as indicated) to BxPC-3 cells as measured by FACS.
  • the N-terminal modules of M27/M7-IgG-P4, M27/M7- IgG-M57, and M27/M7-IgG-M78 bispecific antibodies contain the M27 heavy chain and the 7 light chain.
  • Fig. 30 show BxPC-3 signal inhibition data for various bispecific antibodies (as indicated) as measured by changes in pIGFIR levels.
  • Fig. 31 show BxPC-3 signal inhibition data for various bispecific antibodies (as indicated) as measured by changes in pErbB3 levels.
  • Fig. 32 show BxPC-3 signal inhibition data for various bispecific antibodies (as indicated) as measured by changes in pAKT levels.
  • Fig. 33 show BxPC-3 signal inhibition data for various bispecific antibodies (as indicated) compared to a combination of anti-ErbB3 Ab# A (SEQ ID NO:336 + SEQ ID NO:337) and ANTI-IGF- 1R Ab# A (ganitumab; SEQ ID NO:327 + SEQ ID NO:328), as measured by changes in pIGFIR levels.
  • Fig. 34 show BxPC-3 signal inhibition data for various bispecific antibodies (as indicated) compared to a combination of anti-ErbB3 Ab# A (SEQ ID NO:336 + SEQ ID NO:337) and ANTI-IGF- 1 R Ab# A (ganitumab; SEQ ID NO:327 + SEQ ID NO:328), as measured by changes in pErbB3 levels.
  • Fig. 35 show BxPC-3 signal inhibition data for various bispecific antibodies compared to a combination of anti-ErbB3 Ab# A (SEQ ID NO:336 + SEQ ID NO:337) and ANTI-IGF- 1R Ab# A (ganitumab; SEQ ID NO:327 + SEQ ID NO:328), as measured by changes in pAKT levels.
  • Fig. 36 show normalized stability for various bispecific antibodies (as indicated) in mouse serum for 5 days at 37°C.
  • Fig. 37 Published aa sequences of heavy chains, light chains and scFvs of anti-IGF-lR antibodies that may be incorporated into polyvalent bispecific antibodies in accordance with the disclosure herein.
  • Fig. 38 Published aa sequences of heavy chains, light chains and scFvs of anti-ErbB3 antibodies to be incorporated into polyvalent bispecific antibodies in accordance with the disclosure herein.
  • FIG. 39 A-B show inhibition of IGFl and heregulin (HRG) signal transduction in DU145 cells by the PBAs
  • HRG heregulin
  • Anti- IGF1R and anti-ErbB3 mAbs in this Fig. and in Fig.Figs. 40-44 and 51 are ANTI-IGF-1R Ab# A (ganitumab; SEQ ID NO:327 + SEQ ID NO:328) and anti-ErbB3 Ab# A (SEQ ID NO:336 + SEQ ID NO:337), respectively.
  • Fig. 40 show inhibition of IGFl and heregulin (HRG) induced signal transduction by the PBAs M7-G1 -M78, P4-M 1.3, P4-C8 and SF-C8 in BxPC-3 cells which have A-D) wild type levels of IGF-1R and ErbB3; B-E) levels of IGF-1R reduced by about 50%; or C-F) levels of ErbB3 reduced by about 50%, as measured by inhibition of phosphorylation of AKT.
  • HRG heregulin
  • Fig. 41 show inhibition of signal transduction induced by A-B) 40 ng/ml of IGFl or C-D) or 400 ng/ml IGFl by the PBAs M7-G1-M78, P4-M1.3, P4-C8 and SF-C8 in BxPC-3 cells, as measured by inhibition of phosphorylation of AKT.
  • Fig. 42 show inhibition of signal transduction induced by A-B) 20 ng/ml of IGFl or C-D) or 200 ng/ml heregulin (HRG) by the PBAs M7-G1-M78, P4-M1.3, P4-C8 and SF-C8 in BxPC-3 cells, as measured by inhibition of phosphorylation of AKT.
  • HRG heregulin
  • Fig. 43 show inhibition of basal signaling in A549 cells after A) 15 minutes incubation with the PBAs M7-G1-M78, P4-M 1.3, P4-C8 and SF-C8; or B) 24 hours incubation with the PBAs.
  • C-D show inhibition of basal signaling in BsPC-3 cells after C) 15 minutes incubation with the PBAs M7-G1-M78, P4-M 1.3, P4-C8 and SF-C8; or D) 24 hours incubation with the PBAs. All signaling is determined by measuring pAKT levels.
  • FIG. 44 A-B show the total IGF1R level in A) A549 cells and B)BxPC-3 cells, after 24 hours of treatment with P4-G1-C3 or P4-G1 -M 1.3.
  • Fig. 45 Western blot showing the protein level of pIGFIR, pAKt, and B-Actin in DU145 or MIA PaCa-2 (High IR) cells that were serum starved ("Starved") or treated with IGFl or IGF2 alone or in the presence of the PBA P4-M1.3 or P4-C8.
  • Fig. 46 Western blot showing the protein level of pIGFIR, pAKt, and B-Actin in DU145 cells that were serum starved ("Starved") or treated with IGFl ; IGFl in the presence of P4-M1.3; insulin or insulin in the presence of P4-M1.3.
  • Fig. 47 Western blot showing the protein level of IGF1R, pIGFI R, ErbB3, pErbB3, pAkt and B-Actin in BxPC-3 cells incubated in the absence of ligand (lanes 1 -3) or in the presence of IGFl and heregulin (HRG) (lanes 4-6) and in the absence of a PBA or in the presence of PBA M7-78 or P4-C8.
  • Fig. 48 show the amount of A-B) M7-G1-M78; C-D) P4-G1 -M1.3; E-F) P4-G1 -C8 present after 0 or 5 days incubation in mouse or Cynomolgus monkey serum.
  • G-H show the amount of P4G1-M1.3 present after 0 or 6 days in human serum, in plates coated with IGF-IR (G) or ErbB3 (H).
  • FIG. 49 show the level of binding to A-C) human, mouse, rat and Cynomolgus ErbB3 and D-F) human, mouse, rat and Cynomolgus EGF-1R of PBAs P4-C8 (A, D), P4-M1.3 (B, E) and M7-M78 (C, F). Binding of M7-M78 to rat and Cynomolgus IGF-IR is not provided.
  • Fig. 50 A-B show the concentration of PBA P4-G1 -M1.3 that is necessary to detach A) IGFl and B) IGF2 from IGF-IR bound to a plate.
  • Fig. 51 show ng per total mg protein of Phospho-IGF-IR (A), Phospho-ErbB3 (B), Phospho-Akt (C), Phospho-ERK (p44/p42; D), Phospho-mTOR (Ser2448, E), and Phospho-S6 (Ser235/236; 5F) in vitro over time in BxPC-3 cells treated with IGF-1 + HRG or IGF-1 + HRG + P4-G1-M1.3.
  • Fig. 52 Levels of pIGFIR, pAKT and B actin in BxPC-3 and A673 cells treated with serum, IGFl , IGFl and P4M1.3 (P4-G1 -M1.3), IGF2, IGF2 and P4M1.3 (P4-G1-M1.3), insulin, and insulin and P4M1.3 (P4-G1-M1.3).
  • Fig. 53 show the level of mTOR (A) and phospho-mTOR ("pmTOR”) in end of study BxPC-3 tumors of mice in which one of PBS, P4-G1-M1.3 or anti-IGF-lR Ab# A was injected.
  • Fig. 54 show the level of IGF-IR and insulin receptor A), ErbB3 and EGFR (B), AKT phosphorylated on residue S473 ("pAKT S473") and T308 (“pAKT T308") (C), phospho- FoxOl and Fox03a (D, "Phospho-FoxOl (Thr24)/Fox03a (Thr32")), mTOR phosphorylated on residue S2448 and S2481 (E), and S6 phosphorylated on residue S235/236 and S 240/244 (F, "pS6 S235/236” and "pS6 S240/244")) in end of study Caki-1 tumors of mice in which one of PBS, P4-G1-M 1.3, anti-IGF-lR Ab# A + anti-ErbB3 IgG, and the mTOR inhibitor everolimus was injected.
  • Fig. 55 show the level of IGF-IR and ErbB3 (A), phospho-EGFR (B, "pEGFR”), and phospho-mTOR ("pmTOR S2448”) and phospho-S6 (“pS6 S235/236”) (C) in end of study BxPC-3 tumors of mice in which one of PBS, P4-G1-M1.3, and anti-IGF-lR Ab# A was injected.
  • A-C show the level of IGF-IR and ErbB3 (A), phospho-EGFR (B, "pEGFR”), and phospho-mTOR (“pmTOR S2448”) and phospho-S6 (“pS6 S235/236”) (C) in end of study BxPC-3 tumors of mice in which one of PBS, P4-G1-M1.3, and anti-IGF-lR Ab# A was injected.
  • Fig. 56 shows the level of IGF-1 ("IGFl ", left panel) and IGF-2 ("IGF2", right panel) in an ELISA assay wherein plates were coated with IGF-IR-His and a serial dilution of P4-G1- M1.3 was added to the wells.
  • A-D shows the mean tumor volume over time in a DU145 (A), BxPC-3 (B), SK-ES-1 (C), and Caki-l(D) xenograft model.
  • Mice were injected with one of PBS, 500 ⁇ g P4- G1-M1.3, 100 Mg P4-G1 -M 1.3, 500 Mg P4-G1-C8, or 100 Mg P4-G1-C8 (A); PBS, 500 Mg P4- G1-M1.3, 300 Mg P4-Gl-M 1.3, 100 Mg P4-G1 -M1.3, 500 Mg P4-G1-C8, 300 g P4-G1 -C8, 100 Mg P4-G1 -C8, 375 g anti-IGF-lR Ab# A (ganitumab; SEQ ID NO:327 + SEQ ID NO:328), 225 ⁇ g anti-IGF-lR Ab# A (ganitumab; SEQ ID NO
  • Fig. 58 shows the fitting of the target mediated drug disposition model to experimental data from mouse blood from mice injected with M1.3-G1-P4.
  • the solid line is the fit of a mouse given a 500 Mg dose and the dotted line is the fit of a mouse given a 100 Mg dose.
  • amino acid sequences referred to herein and listed in the sequence listing are identified below.
  • SEQ ID NO: l is an aa consensus sequence derived from exemplary IGF-1R VH sequences.
  • SEQ ID NO:2 is an aa consensus sequence derived from exemplary IGF-1R VL sequences.
  • SEQ ID NO:3 is an aa consensus sequence derived from exemplary IGF-1R VL sequences, which excludes the VL sequence of the IGF-1R binding site of 16F.
  • SEQ ID NO:4 is an aa consensus sequence derived from exemplary ErbB3 VH sequences.
  • SEQ ID NO: 5 is an aa consensus sequence derived from exemplary ErbB3 VH sequences, which excludes the VH of the ErbB3 binding site of 16F.
  • SEQ ID NO:6 is an aa consensus sequence derived from exemplary ErbB3 VL sequences.
  • SEQ ID NO:7 is an aa consensus sequence derived from exemplary ErbB3 VL sequences, which excludes the VL sequence of the ErbB3 binding site of 16F.
  • SEQ ID NOs:8-31 are the IGF-1R VH aa sequences of Fig. 1.
  • SEQ ID NOs:32-133 are the IGF-1R VL aa sequences of Fig. 2.
  • SEQ ID NOs: 134-165 are the ErbB3 VH aa sequences of Fig. 3.
  • SEQ ID NOs: 166-200 are the ErbB3 VL aa sequences of Fig. 4.
  • SEQ ID NOs:201-256 are the nucleotide sequence (odd numbers) and aa sequences (even numbers) of the mature light and heavy chains of anti-IGF-lR/anti-ErbB3 IgGl(scFv) 2 provided in Fig. 5A, the sequence ID numbers of which are as follows.
  • Kappa light chains SF (SEQ ID NOs:201 and 202); P4 (SEQ ID NOs:203 and 204); M78 (SEQ ID NOs:205 and 206); and M57 (SEQ ID NOs:207 and 208).
  • Heavy chain scFv fusions (hybrids): SF-G1 -C8 (i.e., 16F; SEQ ED NOs:209 and 210); SF-G1 -P1 (SEQ ED NOs:21 1 and 212); SF-G1 -M1.3 (SEQ ED NOs:213 and 214); SF-G1-M27 (SEQ ED NOs:215 and 216); SF-G1-P6 (SEQ ED NOs:217 and 218); SF-G1 - B69 (SEQ ED NOs:219 and 220); P4-G1 -C8 (SEQ ID NOs:221 and 222); P4-G1-P1 (SEQ ED NOs:223 and 224); P4-G1-M1.3 (SEQ ED NOs:225 and 226); P4-G1-M27 (SEQ ED NOs:227 and 228); P4-G1
  • SEQ ID NOs:257-296 are the nucleotide sequence (odd numbers) and aa sequences (even numbers) of the mature light and heavy chains of anti-ErbB3/anti-IGF-lR IgGl(scFv) 2 provided in Fig. 5B, the sequence ID numbers of which are as follows.
  • Heavy chain scFv fusions (hybrids): P1-G1 -P4 (SEQ ID NOs:267 and 268); P1 -G1-M57 (SEQ ID NOs:269 and 270); Pl - G1 -M78 (SEQ ID NOs:271 and 272); M27-G1 -P4 (SEQ ID NOs:273 and 274); M27-G1 -M57 (SEQ ID NOs:275 and 276); M27-G1-M78 (SEQ ID NOs:277 and 278); M7-G1 -P4 (SEQ ID NOs:279 and 280); M7-G1 -M57 ((SEQ ID NOs:281 and 282); M7-G1-M78 (SEQ ID NOs:283 and 284); B72-G1-P4 (SEQ ID NOs:285 and 286); B72-G1 -M57 (SEQ ID NOs:287 and
  • SEQ ID NOs:297 and 298 are the nucleotide and aa sequences of the light chain of 16F with a signal sequence, as shown in Fig. 7B.
  • SEQ ID NOs:299 and 300 are the nucleotide and aa sequences of the heavy chain of 16F with a signal sequence, as shown in Fig. 7A.
  • SEQ ID NO:301 is a portion of an exemplary heavy chain domain, wherein a lysine was inserted between the C-terminus of the CH3 domain and the N-terminus of the linker
  • SEQ ID NOs:302-304 are consensus sequences of anti-IGF-lR VHCDR1 , VHCDR2 and VHCDR3 domains, respectively, which are the CDR sequences of the VH consensus sequence of SEQ ID NO: 1 and shown in Fig. 1.
  • SEQ ID NOs:305-307 are consensus sequences of an anti-IGF-lR VLCDR1, VLCDR2 and VLCDR3, respectively, which are the CDR sequences of the VL consensus sequence of SEQ ID NO:2 and shown in Fig. 2.
  • SEQ ID NO:308 is a consensus sequence of an anti-IGF-lR VLCDR3, which is the CDR3 sequence of the VL consensus sequence of SEQ ID NO:3 and shown in Fig. 2.
  • SEQ ID Nos:209-31 1 are consensus sequences of anti-ErbB3 VHCDR1 , VHCDR2 and VHCDR3 domains, respectively, which are the CDR sequences of the VH consensus sequence of SEQ ID NO:4 and shown in Fig. 3.
  • SEQ ID Nos:312-314 are consensus sequences of anti-ErbB3 VLCDR1 , VLCDR2 and VLCDR3 domains, respectively, which are the CDR sequences of the VL consensus sequence of SEQ ID NO:6 and shown in Fig. 4.
  • SEQ ID NO:315 is a consensus sequence of an anti-ErbB3 VLCDR3, which is the CDR3 sequence of the VL consensus sequence of SEQ ID NO:7 and shown in Fig. 4.
  • SEQ ID NO.-316 is the aa sequence of the heavy chain of the anti-ErbB3/anti-IGF-l R IgG2 tetravalent bispecific protein ELI-7.
  • SEQ ID NO:317 is the aa sequence of the light chain of the anti-ErbB3/anti-IGF-lR IgG2 tetravalent bispecific protein ELI-7.
  • SEQ ID NO:318 is the aa sequence of the heavy chain of the anti-IGF-lR/anti-ErbB3 tetravalent bispecific protein ILE-10.
  • SEQ ID NO:319 is the aa sequence of the heavy chain of the anti-IGF-lR anti-ErbB3 tetravalent bispecific protein ILE-12.
  • SEQ ID NO: 320 is the aa sequence of the light chain of the anti-IGF-l R/anti-ErbB3 tetravalent bispecific proteins ILE- 10 and ILE- 12.
  • SEQ ID NOs:321-335 are the aa sequences of Fab heavy chains (Fab HC), Fab light chains (Fab LC) and scFvs from the anti-IGF-lR antibodies of Table 1 , which sequences are of Fig. 37.
  • SEQ ID NOs:336-353 are the aa sequences of Fab heavy chains (Fab HC), Fab light chains (Fab LC) and scFvs from the anti-ErbB3 antibodies of Table 2, which sequences are of Fig. 38.
  • Table 2 - anti-ErbB3 antibodies are the aa sequences of Fab heavy chains (Fab HC), Fab light chains (Fab LC) and scFvs from the anti-ErbB3 antibodies of Table 2, which sequences are of Fig. 38. Table 2 - anti-ErbB3 antibodies
  • SEQ ID NOs:354 and 355 are the nucleotide and aa sequences for the B60-IgG2-M78 polyvalent bispecific antibody shown in Fig. 5B.
  • SEQ ID NOs:356 and 357 are the nucleotide and aa sequences for the M7-IgG2-M78 polyvalent bispecific antibody shown in Fig. 5B.
  • SEQ ID NOs:358-360 are aa sequences of SF, P4, M78, and M57 anti-IGF-lR IgGl monoclonal antibody heavy chains shown in Fig. 6A.
  • SEQ ID NOs:362-366 are aa sequences of PI , M27, M7, B72, and B60 anti-ErbB3 IgGl monoclonal antibody heavy chains shown in Fig. 6B.
  • SEQ ID NOs: 367-369 are aa sequences of P4, M57, and M78 anti-IGF-lR scFv monoclonal antibodies shown in Fig. 6C.
  • SEQ ID NOs:370-375 are aa sequences of C8, PI , M1.3, M27, P6, and B69 anti-ErbB3 scFv monoclonal antibodies shown in Fig. 6D.
  • SEQ ID NOs:376-379 are aa sequences of the heavy chains P4M-G1-M 1.3, P4M-G1 -C8, P33M-G1-M1.3, and P33M-G1-C8, respectively.
  • SEQ ID NOs:380 and 381 are aa sequences of P33M kappa light chain and P4M kappa light chain, respectively.
  • SEQ ID NOs:382 and 383 are aa sequences of the anti-IGF-lR scFv M76 and the anti-ErbB3 scFv P6L, respectively.
  • the VH and VL domains of binding site M76 consist of the aa sequences of SEQ ID NOs:31 and 133, respectively.
  • SEQ ID NOs:384 and 385 are aa sequences of the VH domain of the anti-IGF-lR binding site modules P4M and P33M, respectively.
  • SEQ ID NOs:386 and 387 are aa sequences of the VL domain of the anti-IGF-lR binding site modules P4M and P33M, respectively.
  • SEQ ID NO:388 is the aa of the VH domain of the anti-ErbB3 binding site module P6L.
  • the VL domain consists of the aa sequence of SEQ ID NO: 173.
  • SEQ ID NOs: 389 and 390 are aa sequences of the anti-IGF-lR heavy chains P4M-G1-P6L and P33M-G1-P6L, respectively.
  • SEQ ID NO:391 is the aa sequence of the anti-ErbB3 heavy chain P1-G1-M76.
  • SEQ ID NO:392 is the aa sequence of the beginning of the CHI portion of the hybrid heavy chains of Fig.Figs. 5A and 5B.
  • SEQ ID NO:393 and 394 are aa sequences of the beginning of the CL domain in the anti-IGF- 1R and ErbB3 VL domains of the light chains of Fig.Figs. 5A and 5B, respectively.
  • SEQ ⁇ ) NOs:395-402 are the aa sequence of exemplary Gly-Ser polypeptide linkers.
  • SEQ ID NO:403 is the aa sequence of a hexa-histidine tag.
  • SEQ ID NO:404 is the aa sequence of the IgG2 constant domain (including CHI , Hinge, CH2, and CH3 regions).
  • SEQ ID NOs:405-408 are the aa sequence of the heavy chains of SF-Gl-Pl, SF-G1-M27, M57- G1-C8, M7-G1-M78 heavy chains, respectively, including the leader sequence (the N-terminal 19 aas of each sequence).
  • SEQ ID NO:409 is the nucleotide sequence of the M7-G1 -M78 heavy chain, including the leader sequence.
  • SEQ ID NOs:410-411 are the aa and nucleotide sequences of the P4-G1 -M1.3 heavy chain, respectively, including the leader sequence (the N-terminal 19 aas of the aa sequence).
  • SEQ ID NOs:412-413 are the aa and nucleotide sequences of the P4-G1 -C8 heavy chain, respectively, including the leader sequence (the N-terminal 19 aas of the aa sequence).
  • SEQ ID NOs:414-415 are the aa and nucleotide sequences of the M7 Lambda Light Chain, respectively, including the leader sequence (the N-terminal 21 aas of the aa sequence).
  • SEQ ID NOs:416-417 are the aa and nucleotide sequences of the P4 Kappa Light Chain, respectively, including the leader sequence (the N-terminal 20 aas of the aa sequence).
  • SEQ ID NO:418 is the aa sequence of the IgGl module with Hinge, CH2, and CH3 regions (the C-terminal 231 aas of the sequence).
  • SEQ ID NOs:419-424 are nucleotide sequences of the heavy chains P4M-G1-M 1.3, P4M-G1 - C8, P4M-G1-P6L, P33M-G1-M1.3, P33M-G1-C8, and P33M-G1-P6L respectively.
  • SEQ ID NO:425 is the nucleotide sequence of the P1-G1-M76 anti-ErbB3-Gl/anti-EGF-l R bispecific antibody.
  • SEQ ID Nos:426 and 427 are nucleotide sequences of the P33M Kappa and P4M Kappa light chains, respectively.
  • SEQ D3 NO:428 is the nucleotide sequence of the M76 anti-IGF-lR scFv.
  • SEQ ID NO:429 is the nucleotide sequence of the P6L anti-ErbB3 scFv. DETAILED DESCRIPTION
  • novel monospecifc antibodies that bind specifically to IGF-1R or to ErbB3.
  • Such antibodies include IgG antibodies and scFv antibodies.
  • bispecific antibodies e.g. , polyvalent bispecific antibodies (“PBAs") that bind specifically to human IGF-1R and to human ErbB3.
  • PBAs polyvalent bispecific antibodies
  • These proteins are potent inhibitors of tumor cell proliferation and of signal transduction through either or both of IGF-1R and ErbB3.
  • the proteins may be used for treating a cell proliferative disorder, e.g., a cancer.
  • Agent refers to an active molecule, e.g., a therapeutic protein, e.g., a drug.
  • a substitution refers to the replacement of one specific aa ("aa”) in a protein with another aa.
  • a substitution may be a conservative substitution, as defined below.
  • Anti-ErbB3 binding site refers to a binding site that binds specifically to human ErbB3.
  • Anti-IGF-IR binding site refers to a binding site that binds specifically to human IGF-
  • Antigen binding site refers to a binding site that comprises the VH and/or VL domain of an antibody, or at least one CDR thereof.
  • an antigen binding site may comprise, consist essentially of, or consist of a VHCDR3 alone or together with a VHCDR2 and optionally a VHCDR1.
  • an antigen binding site comprises a VH domain and a VL domain, which may be present on the same polypeptide or on two different polypeptides, e.g., the VH domain is present on a heavy chain and a VL domain is present on a light chain.
  • Antigen-binding portion of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., IGF-1R or ErbB3). It has been shown that the antigen-binding function of an antibody can be retained by fragments of a full- length antibody.
  • an antigen e.g., IGF-1R or ErbB3
  • binding fragments encompassed within the term "antigen-binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CHI domains; (iv) an Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR).
  • a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CHI domains
  • F(ab') 2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
  • VL and VH are two domains of an Fv fragment
  • VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent proteins, known as single chain Fvs (scFvs) see U.S. Pat. No. 5,892,019.
  • single chain Fvs single chain Fvs
  • Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody.
  • Other forms of single chain antibodies, such as diabodies are also encompassed.
  • Diabodies are bivalent, bispecific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites.
  • Binding affinity refers to the strength of a binding interaction and includes both the actual binding affinity as well as the apparent binding affinity.
  • the actual binding affinity is a ratio of the association rate over the disassociation rate.
  • the apparent affinity can include, for example, the avidity resulting from a polyvalent interaction.
  • Dissociation constant (K d ) is typically the reciprocal of the binding affinity, and may be conveniently measured using a surface plasmon resonance assay (e.g., as determined in a BIACORE 3000 instrument (GE Healthcare) e.g., using recombinant ErbB3 as the analyte and an anti-ErbB3 antibody as the ligand) or a cell binding assay, each of which assays is described in Example 3 of US Patent No. 7,846,440.
  • Binding moiety refers to the portion, region, or site of a binding polypeptide or, when so specified, of a heavy or light chain thereof, that is directly involved in mediating the specific binding of an antibody to a target molecule (i.e. an antigen).
  • exemplary binding domains include an antigen binding site, a receptor binding domain of a ligand, a ligand binding domain of a receptor or an enzymatic domain.
  • the binding domain comprises or consists of an antigen binding site (e.g., comprising a variable heavy (VH) chain sequence and variable light (VL) chain sequence or six CDRs from an antibody placed into alternative framework regions (e.g.
  • a binding site may be comprised essentially only of a VH or a VL chain sequence.
  • a binding site may be entirely from one species, e.g. , it has only sequences that derive from the germline sequences of one species.
  • a binding site may be human (i.e., from the human species), mouse, or rat.
  • a binding site may also be humanized, i.e., the CDRs are from one species and the frameworks (FRs) are from another species.
  • a binding site may have CDRs that were derived from a mouse antibody and FRs that are from the human species.
  • Certain humanized binding sites comprise mutations in one or more CDR to make the CDRs look more like the CDRs of the donor antibody.
  • Certain humanized antibodies may also comprise mutations in one or more FR.
  • mutations in a binding site may enhance the affinity of binding of the binding site to its target antigen, and/or they may stabilize the binding site, e.g., to extend its half-life.
  • CDR or “complementarity determining region” refers to the noncontiguous antigen combining sites found within the VR of both heavy and light chain polypeptides. These particular regions have been described by Kabat et al., J. Biol. Chem. 252, 6609-6616 (1977) and Kabat et al., Sequences of protein of immunological interest.
  • CDR is as defined by Kabat.
  • Residue numbering follows the nomenclature of Kabat et al., 1991 , supra
  • CHI domain refers to the heavy chain immunoglobulin constant domain located between the VH domain and the hinge. It spans EU positions 1 18-215.
  • a CHI domain may be a naturally occurring CHI domain, or a naturally occurring CHI domain in which one or more aas have been substituted, added or deleted, provided that the CHI domain has the desired biological properties.
  • a desired biological activity may be a natural biological activity, an enhanced biological activity or a reduced biological activity relative to the naturally occurring sequence.
  • CH2 domain refers to the heavy chain immunoglobulin constant domain that is located between the hinge and the CH3 domain. It spans EU positions 231 -340.
  • a CH2 domain may be a naturally occurring CH2 domain, or a naturally occurring CH2 domain in which one or more aas have been substituted, added or deleted, provided that the CH2 domain has the desired biological properties.
  • a desired biological activity may be a natural biological activity, an enhanced biological activity or a reduced biological activity relative to the naturally occurring sequence.
  • CH3 domain refers to the heavy chain immunoglobulin constant domain that is located C-terminally of the CH2 domain and spans approximately 1 10 residues from the N- terminus of the CH2 domain, e.g., about positions 341-446b (EU numbering system).
  • a CH3 domain may be a naturally occurring CH3 domain, or a naturally occurring CH3 domain in which one or more aas ("aas") have been substituted, added or deleted, provided that the CH3 domain has the desired biological properties.
  • a desired biological activity may be a natural biological activity, an enhanced biological activity or a reduced biological activity relative to the naturally occurring sequence.
  • a CH3 domain may or may not comprise a C-terminal lysine.
  • CH4 domain refers to the heavy chain immunoglobulin constant domain that is located C-terminally of the CH3 domain in IgM and IgE antibodies.
  • a CH4 domain may be a naturally occurring CH4 domain, or a naturally occurring CH4 domain in which one or more aas have been substituted, added or deleted, provided that the CH4 domain has the desired biological properties.
  • a desired biological activity may be a natural biological activity, an enhanced biological activity or a reduced biological activity relative to the naturally occurring sequence.
  • CL domain refers to the light chain immunoglobulin constant domain that is located
  • a CL domain may be a naturally occurring CL domain, or a naturally occurring CL domain in which one or more aas have been substituted, added or deleted, provided that the CL domain has the desired biological properties.
  • a desired biological activity may be a natural biological activity, an enhanced biological activity or a reduced biological activity relative to the naturally occurring sequence.
  • a CL domain may or may not comprise a C-terminal lysine.
  • Constant substitution or “conservative aa substitution” refers to the replacement of one or more aa residues in a protein or a peptide with, for each particular pre-substitution aa residue, a specific replacement aa that is known to be unlikely to alter either the confirmation or the function of a protein or peptide in which such a particular aa residue is substituted for by such a specific replacement aa.
  • Such conservative substitutions typically involve replacing one aa with another that is similar in charge and/or size to the first aa, and include replacing any of isoleucine (I), valine (V), or leucine (L) for each other, substituting aspartic acid (D) for glutamic acid (E) and vice versa; glutamine (Q) for asparagine (N) and vice versa; and serine (S) for threonine (T) and vice versa.
  • Other substitutions are known in the art to be conservative in particular sequence or structural environments. For example, glycine (G) and alanine (A) can frequently be substituted for each other to yield a conservative substitution, as can be alanine and valine (V).
  • Methionine (M) which is relatively hydrophobic, can frequently conservatively substitute for or be conservatively substituted by leucine or isoleucine, and sometimes valine. Lysine (K) and arginine (R) are frequently interchangeable in locations in which the significant feature of the aa residue is its charge and the differing pK's of these two basic aa residues are not expected to be significant. The effects of such substitutions can be calculated using substitution score matrices such PAM120, PAM-200, and PAM-250. Other such conservative substitutions, for example, substitutions of entire regions having similar hydrophobicity characteristics (e.g. , transmembrane domains), are well known.
  • a CR domain on a light chain of an immunoglobulin is referred to interchangeably as a
  • CL light chain CR domain
  • CL region CL domain
  • a constant domain on a heavy chain (e.g., hinge, CHI , CH2 or CH3 domains) of an immunoglobulin is referred to interchangeably as a "CH,” “heavy chain constant domain,” “CH” region or “CH domain.”
  • a variable domain on an immunoglobulin light chain is referred to interchangeably as a "VL,” “light chain variable domain,” “VL region” or “VL domain.”
  • VH variable domain on an immunoglobulin heavy chain is referred to interchangeably as a "VH,” “heavy chain variable domain,” “VH region” or “VH domain.”
  • Domain refers to a region, e.g., an independently folding, globular region or a non- globular region (e.g., a linker domain), of a heavy or light chain polypeptide which may comprise peptide loops (e.g. , 1 to 4 peptide loops) that may be stabilized, for example, by a ⁇ - pleated sheet and/or an intrachain disulfide bond.
  • the constant and VRs of immunoglobulin heavy and light chains are typically folded into domains.
  • each one of the CHI , CH2, CH3, CH4, CL, VH and VL domains typically form a loop structure.
  • EC 5 o or “EC50” refers to the concentration of a molecule, e.g. , a PBA, that provides 50% of the maximal effect of the protein on a particular system such as a binding assay or a signal transduction pathway.
  • ErbB3 and HER3 refer to ErbB3 protein, as described in U.S. Pat. No. 5,480,968.
  • the human ErbB3 protein sequence is shown in Fig. 4 and SEQ ID NO:4 of U.S. Pat. No. 5,480,968, wherein the first 19 aas correspond to the leader sequence that is cleaved from the mature protein.
  • ErbB3 is a member of the ErbB family of receptors, other members of which include ErbB l (EGFR), ErbB2 (HER2/Neu) and ErbB4.
  • ErbB3 itself lacks tyrosine kinase activity, but is itself phorphorylated upon dimerization of ErbB3 with another ErbB family receptor, e.g., ErbB l , ErbB2 and ErbB4, which are receptor tyrosine kinases.
  • Ligands for the ErbB family include heregulin (HRG), betacellulin (BTC), epidermal growth factor (EGF), heparin-binding epidermal growth factor (HB-EGF), transforming growth factor alpha (TGF-a ), amphiregulin (AR), epigen (EPG) and epiregulin (EPR).
  • HRG heregulin
  • BTC betacellulin
  • EGF epidermal growth factor
  • HB-EGF heparin-binding epidermal growth factor
  • TGF-a transforming growth factor alpha
  • AR amphiregulin
  • EPG epigen
  • EPR epiregulin
  • EU indicates that aa positions in a heavy chain CR, including aa positions in the CHI , hinge, CH2, and CH3 domains, are numbered herein according to the EU index numbering system (see Kabat et al., in “Sequences of Proteins of Immunological Interest", U.S. Dept. Health and Human Services, 5 th edition, 1991).
  • Fab refers to the antigen binding portion of an antibody, comprising two chains: a first chain that comprises a VH domain and a CHI domain and a second chain that comprises a VL domain and a CL domain.
  • a Fab is typically described as the N-terminal fragment of an antibody that was treated with papain and comprises a portion of the hinge region, it is also used herein as referring to a binding domain wherein the heavy chain does not comprise a portion of the hinge.
  • Fc region refers to the portion of a single immunoglobulin heavy chain beginning in the hinge region just upstream of the papain cleavage site (i.e. residue 216 in IgG, taking the first residue of heavy chain CR to be 1 14) and ending at the C-terminus of the antibody.
  • a complete Fc region comprises at least a hinge, a CH2 domain, and a CH3 domain.
  • Two Fc regions that are dimerized are referred to as "Fc" or "Fc dimer.”
  • An Fc region may be a naturally occurring Fc region, or a naturally occurring Fc region in which one or more aas have been substituted, added or deleted, provided that the Fc region has the desired biological properties.
  • a desired biological activity may be a natural biological activity, an enhanced biological activity or a reduced biological activity relative to the naturally occurring sequence.
  • Framework region or "FR” or “FR region” includes the aa residues that are part of the VR, but are not part of the CDRs (e.g., using the Kabat definition of CDRs). Therefore, a VR framework is between about 100-120 aas in length but includes only those aas outside of the CDRs.
  • framework region 1 corresponds to the domain of the VR encompassing aas 1- 30
  • framework region 2 corresponds to the domain of the VR encompassing aas 36-49;
  • framework region 3 corresponds to the domain of the VR encompassing aas 66-94
  • framework region 4 corresponds to the domain of the VR from aas 103 to the end of the VR.
  • the framework regions for the light chain are similarly separated by each of the light chain VR CDRs.
  • the framework region boundaries are separated by the respective CDR termini as described above.
  • the CDRs are as defined by Kabat.
  • “Full-length antibody” is an antibody that comprises one or more heavy chains and one or more light chains.
  • Each heavy chain is comprised of a heavy chain VR (abbreviated herein as VH) and a heavy chain CR.
  • the heavy chain CR is comprised of three domains CHI, CH2, and CH3, and optionally a fourth domain, CH4.
  • Each light chain is comprised of a light chain VR (abbreviated herein as VL) and a light chain CR.
  • the light chain CR is comprised of one domain, CL.
  • the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino- terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
  • Immunoglobulin proteins can be of any type class (e.g., IgG, IgE, IgM, IgD, IgA and IgY) or, subclass (e.g. , IgG 1 , IgG2, IgG 3, IgG4, IgAl and IgA2) or subclass.
  • Gly-Ser linker or “Gly-Ser peptide” refers to a peptide that consists of glycine and serine residues.
  • n is a number between 1 and 5
  • n is a number between 6 and 10
  • n is a number between 11 and 15, n is a number between 16 and 20
  • n is a number between 21 and 25, or n is a number between 26 and 30.
  • Heavy chain immunoglobulin CR or “HC Ig CR” may comprise a CHI domain and an Fc region, which Fc region may comprise a hinge, a CH2 domain, a CH3 domain and/or a CH4 domain.
  • a light chain immunoglobulin CR may comprise a CL domain.
  • Hinge or “hinge region” or “hinge domain” refers to the flexible portion of a heavy chain located between the CHI domain and the CH2 domain. It is approximately 25 aas long, and is divided into an "upper hinge,” a “middle hinge,” and a “lower hinge.”
  • a hinge may be a naturally occurring hinge, or a naturally occurring hinge in which one or more aas have been substituted, added or deleted, provided that the hinge has the desired biological properties.
  • a desired biological activity may be a natural biological activity, an enhanced biological activity or a reduced biological activity relative to the naturally occurring sequence.
  • IC 50 refers to the concentration of a molecule, e.g., a PBA, that provides a 50% inhibition of a maximal activity (e.g. , a response to a stimulus or a constitutive activity), i.e., a concentration that reduces the activity to a level halfway between the maximal activity and the baseline.
  • the IC 50 value may be converted to an absolute inhibition constant (Ki) using, e.g., the Cheng-Prusoff equation.
  • the IC50 may be indistinguishable from the EC50.
  • IGF-1R insulin-like growth factor 1
  • IGF-1R insulin-like growth factor 1
  • IGF-2 insulin-like growth factor 2
  • IGF1-R is a receptor tyrosine kinase, which upon activation by IGF-1 or IGF-2 is auto-phosphorylated.
  • Genbank Accession No. NP_000866 Genbank Accession No. NP_000866 and is assigned Gene ID: 3480.
  • IgG-(scFv) 2 indicates a tetravalent PBA consisting of an IgG having two N-terminal
  • IgGl-(scFv) 2 Exemplary IgGl-(scFv) 2 PBAs are those where the four binding sites comprise two essentially identical anti-IGF-l R binding sites and two essentially identical anti-ErbB3 binding sites.
  • immunoglobulin CRs When the immunoglobulin CRs are those of IgG2, the protein is referred to as an "IgG2-(scFv) 2 .”
  • An exemplary "IgG2-(scFv) 2 protein is ELI-7.
  • the immunoglobulin CRs are partially from an IgGl and partially from another isotype of IgG, e.g., an IgG2, the protein is referred to as e.g., an "IgGl/2-(scFv) 2 .”
  • immunoglobulin CR or “Ig CR” refers to the parts of an immunoglobulin, (i.e., an antibody,) outside of its variable domains.
  • an immunoglobulin CR comprises a "heavy chain immunoglobulin CR” and a "light chain immunoglobulin CR.”
  • “Inhibition” of a biological activity by a binding protein refers to any reproducibly detectable decrease in biological activity mediated by the binding protein.
  • inhibition provides a statistically significant decrease in biological activity, e.g. , a decrease of about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100% in biological activity relative to the biological activity determined in he absence of the binding protein.
  • isolated in reference to polynucleotides, polypeptides or proteins, means that the polynucleotide, polypeptide or protein is substantially removed from polynucleotides, polypeptides, proteins or other macromolecules with which it, or its analogues, occurs in nature.
  • isolated is not intended to require a specific degree of purity, typically, the protein will be at least about 75% pure, more preferably at least about 80% pure, more preferably at least about 85% pure, more preferably at least about 90% pure, more preferably still at least about 95% pure, and most preferably at least about 99% pure.
  • Kabat index numbering system see Kabat et al., 1991., op. cit.
  • Linked to refers to direct or indirect linkage or connection of, in context, aas or nucleotides.
  • An “indirect linkage” refers to a linkage that is mediated through a linker or a domain, comprising, e.g. , one or more aas or nucleotides.
  • a “direct linkage” or “linked directly” when referring to two polypeptide segments refers to the presence of covalent bond between the two polypeptide segments, e.g. , the two polypeptide segments are joined contiguously without intervening sequences.
  • Linker refers to one or more aas connecting two domains or regions together.
  • a linker may be flexible to allow the domains being connected by the linker to form a proper three dimensional structure thereby allowing them to have the required biological activity.
  • a linker connecting the VH and the VL of an scFv is referred to herein as an "scFv linker.”
  • a linker connecting the N-terminus of a VH domain or the C-terminus of the CH3 domain to a second VH domain, e.g., that of an scFv is referred to as a "connecting linker.”
  • Module refers to a structurally and/or functionally distinct part of a PBA, such a binding site (e.g. , an scFv domain or a Fab domain) and the Ig constant domain. Modules provided herein can be rearranged (by recombining sequences encoding them, either by recombining nucleic acids or by complete or fractional de novo synthesis of new
  • an "SF' module refers to the binding site "SF,” i.e., comprising at least the CDRs of the SF VH and SF VL domains.
  • a “C8” module refers to the binding site "C8.”
  • PBA refers to a polyvalent bispecific antibody, an artificial hybrid protein comprising at least two different binding moieties or domains and thus at least two different binding sites (e.g., two different antibody binding sites), wherein one or more of the pluralities of the binding sites are covalently linked, e.g., via peptide bonds, to each other.
  • a preferred PBA described herein is an anti-IGF-lR+anti-ErbB3 PBA, which is a polyvalent bispecific antibody that comprises one or more first binding sites binding specifically to an IGF-1R protein, e.g., a human IGF-1R protein, and one or more second binding sites binding specifically to an ErbB3 protein, e.g., a human ErbB3 protein.
  • An anti-IGF-lR+anti-ErbB3 PBA is so named regardless of the relative orientations of the anti-IGF-lR and anti-ErbB3 binding sites in the molecule, whereas when the PBA name comprises two antigens separated by a slash (/) the antigen to the left of the slash is amino terminal to the antigen tot the right of the slash.
  • a PBA may be a bivalent binding protein, a trivalent binding protein, a tetravalent binding protein or a binding protein with more than 4 binding sites.
  • An exemplary PBA is a tetravalent bispecific antibody, i.e., an antibody that has 4 binding sites, but binds to only two different antigens or epitopes.
  • Exemplary bispecific antibodies are tetravalent "anti-IGF-l R/anti-ErbB3" PBAs and "anti- ErbB3 /anti- IGF-1R" PBAs.
  • N-terminal binding sites of a tetravalent PBA are Fabs and the C-terminal binding sites are scFvs.
  • Percent identical or “% identical” refers to two or more nucleic acid or polypeptide sequences or subsequences that are the same (100% identical) or have a specified percentage of nucleotide or aa residues that are the same, when the two sequences are aligned for maximum correspondence and compared. To align for maximum correspondence, gaps may be introduced into one of the sequences being compared. The aa residues or nucleotides at corresponding positions are then compared and quantified. When a position in the first sequence is occupied by the same residue as the corresponding position in the second sequence, then the sequences are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (e.g.
  • % identity # of identical positions/total # of positions (e.g., overlapping positions) x 100).
  • the two sequences are the same length.
  • the determination that one sequence is a measured % identical with another sequence can be determined using a mathematical algorithm.
  • a non- limiting example of a mathematical algorithm utilized for such comparison of two sequences is incorporated in the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package.
  • ALIGN program version 2.0
  • a gap length penalty of 12 may be used. Additional algorithms for sequence analysis are well known in the art and many are available online.
  • Portion or “fragment” (e.g., of a domain) of a reference moiety refers to a discrete part of the whole reference moiety (e.g. , domain, e.g., a naturally occurring domain) that is at least, or at most 10% 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, or 99% of the size of the reference moiety.
  • scFv linker refers to a peptide or polypeptide domain interposed between the VL and
  • an scFv linker preferably allows orientation of the VL and VH domains in a antigen binding conformation.
  • an scFv linker comprises or consists of a peptide or polypeptide linker that only comprises glycines and serines (a "Gly-Ser linker").
  • an scFv linker comprises a disulfide bond.
  • scFv protein refers to a binding protein that consists of a single polypeptide comprising one light chain variable domain (VL), and one heavy chain variable domain (VH), wherein each variable domain is derived from the same or different antibodies.
  • scFv proteins typically comprise an scFv linker interposed between the VH domain and the VL domain. ScFv proteins are known in the art and are described, e.g., in U.S. Pat. No. 5,892,019.
  • Similarity or “percent similarity” in the context of two or more polypeptide sequences refer to two or more sequences or subsequences that have a specified percentage of aa residues that are the same or conservatively substituted when compared and aligned for maximum correspondence.
  • a first aa sequence can be considered similar to a second aa sequence when the first aa sequence is at least 50%, 60%, 70%, 75%, 80%, 90%, or even 95% identical, or conservatively substituted, to the second aa sequence when compared to an equal number of aas as the number contained in the first sequence, or when compared to an alignment of polypeptides that has been aligned by a computer similarity program known in the art.
  • These terms are also applicable to two or more polynucleotide sequences.
  • Specific binding means that the binding site(s) exhibit(s) immunospecific binding to the target epitope(s).
  • a binding site that binds specifically to an epitope exhibits appreciable affinity for a target epitope and, generally, does not exhibit cross-reactivity with other epitopes in that it does not exhibit appreciable affinity to any unrelated epitope and preferably does not exhibit affinity for any unrelated epitope that is equal to, greater than, or within two orders of magnitude lower than the affinity for the target epitope.
  • "Appreciable” or preferred binding includes binding with a dissociation constant (Kd) of 10 '8 , 10 "9 M, 10 " '°, 10", lO 12 M, 10 " ' 3 M or an even lower d value.
  • Kd dissociation constant
  • Dissociation constants with values of about 10 "7 M, and even as low as about 10 "8 M, are at the high end of dissociation constants suitable for therapeutic antibodies. Binding affinities may be indicated by a range of dissociation constants, for example, 10 "6 to 10 "I2 M, 10 "7 to 10 "12 M, 10 '8 to 10 "12 M or better (i.e., or lower value dissociation constant).
  • Dissociation constants in the nanomolar (10 '9 M) to picomolar ( 10 "I2 M) range or lower are typically most useful for therapeutic antibodies.
  • Suitable dissociation constants are Kds of 50 nM or less (i.e., a binding affinity of 50 nM or higher - e.g. , a Kd of 45 nM) or Kds of 40 nM, 30 nM, 20 nM, 10 nM, 1 nm, 100 pM, 10 pM or 1 pM or less.
  • Specific or selective binding can be determined according to any art-recognized means for determining such binding, including, for example, according to Scatchard analysis and/or competitive binding assays.
  • PBAs polyvalent bispecific antibodies
  • Exemplary PBAs comprise at least one anti-IGF-lR binding site and at least one anti-ErbB3 binding site or at least two anti-IGF-lR binding sites and at least two anti- ErbB3 binding sites.
  • the anti-IGF- 1R binding site binds specifically to a human IGF-1R and the anti-ErbB3 binding site binds specifically to human ErbB3.
  • the PBA comprises two heavy-light chain pairs that associate with each other to form a single protein, wherein each heavy-light chain pair comprises an anti-IGF- 1 R binding site and an anti-ErB3 binding site.
  • the anti-IGF- 1 R binding site and the anti-ErbB3 binding site of a first heavy-light chain pair are connected through an immunoglobulin CR that associates with the immunoglobulin CR of another heavy-light chain pair (e.g., by disulfide bonds) to form, e.g., a single IgG-like protein.
  • a preferred PBA as described herein has advantageous properties, such as the ability to inhibit tumor cell proliferation and to reduce or stabilize tumor growth equivalently to or more potently than either its isolated anti-IGF-lR binding moiety or its isolated anti-ErbB3 binding moiety, and in certain embodiments, the ability to inhibit either or both of tumor invasiveness and tumor metastasis.
  • An exemplary PBA described herein can inhibit either or both of IGF-1R and ErbB3 mediated signal transduction, such as IGF-1R, ErbB3 and AKT phosphorylation, equivalently to or more potently than either its isolated anti-IGF-lR binding moiety or its isolated anti-ErbB3 binding moiety.
  • An exemplary PBA will (i) inhibit growth of tumor cells, e.g., by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more; or (ii) inhibit IGF-lr, ErbB3 or Akt phosphorylation, e.g.
  • An exemplary PBA will (iii) be stable, e.g., be at least 80% monomeric in a solution after 1 , 2, 3, 4, 5 or more days at 4°C, room temperature or 37°C, or (iv) have a Tm (e.g., as determined by DSF) of at least 50°C, 55°C, 60°C, 65°C or more, or both (iii) and (iv).
  • the PBAs described herein may be used, e.g., for treating a subject having a cancer.
  • the immunoglobulin CR of a PBA may comprise the CR of an IgG heavy chain, which may comprise an Fc region.
  • An immunoglobulin constant domain may exist as a heavy-light chain pair, the heavy chain Fc region of which may comprise a CH3 domain that associates (e.g., by disulfide bonds) with the CH3 domain of another such heavy- light chain pair.
  • the immunoglobulin CR moiety may also comprise a CH2 domain, a hinge and/or a CHI domain.
  • each of a CHI , hinge, CH2, or CH3 domain of a PBA may be a naturally occurring (or wild type) domain, or it may differ from a naturally occurring domain by one or more aa substitutions (e.g., conservative substitutions), additions or deletions, provided that the particular domain retains its desired biological activity, such as either or both of CH3 and CL association activity.
  • the CHI , hinge, CH2 and CH3 domains are preferably in N- to C-terminal order as they occur naturally, i.e., CHI , hinge, CH2, CH3. These domains may be connected, or linked, to each other directly or indirectly.
  • An indirect linkage is a linkage that is mediated through a linker of one or more aas.
  • each CH domain is directly linked to its adjacent domains.
  • a CHI domain is linked at its C-terminus to the N-terminus of a hinge domain, which is linked at its C-terminus to the N-terminus of a CH2 domain, which is linked at its C- terminus to the N-terminus of a CH3 domain.
  • Certain PBAs comprise at least two anti-IGF-lR and at least two anti-ErbB3 binding sites, each of which bind specifically to IGF-1R or ErbB3, respectively.
  • the binding sites may be any type of immunoglobulin-derived or mimetic binding site, provided that each binding site binds specifically to its respective target.
  • a binding site may be a Fab domain, an scFv, or a fragment of a single domain antibody.
  • the anti-IGF-lR and anti-ErbB3 binding sites of a PBA may be the same type of binding site or a different type.
  • the anti-IGF- 1 R binding sites may be Fabs and the anti-ErbB3 binding sites may be scFvs.
  • the anti-IGF-lR binding sites may be scFvs and the anti-ErbB3 binding sites may be Fabs.
  • one anti-ErbB3 binding site is a Fab and another anti-ErbB3 binding site is an scFv; in another embodiment, one anti-IGF-l R binding site is a Fab and another anti-IGF-l R binding site is an scFv.
  • a first and a second Fab are linked to the N- terminus and C-terminus of the immunoglobulin CR domain, respectively.
  • a first and a second scFv are linked to the N-terminus and C-terminus of the immunoglobulin CR domain, respectively.
  • At least one Fab domain is linked to the N-terminus of the immunoglobulin CR (e.g. , in the Fab and CRs' natural arrangement) and at least one scFv is linked to the C-terminus of the immunoglobulin CR.
  • at least one scFv is linked to the N-terminus of the immunoglobulin CR and at least one Fab is linked to the C-terminus of the immunoglobulin CR.
  • Exemplary arrangements of Fab and scFv and anti-IGF-lR and anti-ErbB3 bispecific antibodies are of Table 4.
  • Table 4 Exemplary anti-IGF- 1R and anti-ErbB3 arrangements in PBAs
  • the immunoglobulin CR of a PBA comprises a CHI domain that is linked to a first heavy chain variable domain (VH) domain.
  • VH variable domain
  • the CHI domain may be linked at the N-terminus to the C-terminus of a first VH domain.
  • the immunoglobulin CR of a PBA comprises a CH3 that is linked to a second VH domain.
  • first and second binding sites of an IgG based (e.g., derived from or comprising at least part of the CR of and IgG) PBA provided herein, the "first" binding site refers to the binding site that is located N-terminally to the immunoglobulin CR moeity, whereas the "second" binding site is the binding site that is located C-terminally to the immunoglobulin CR moeity.
  • a CH3 domain can be linked at its C-terminus to the N-terminus of a second VH domain.
  • the CH3 domain may be linked at its C terminus to the N-terminus of a linker, which linker is linked at its C-terminus to the N-terminus of the second VH domain.
  • a linker may be useful to provide flexibility between the constant immunoglobulin region and the second VH domain, such that a proper three-dimensional structure may be obtained to allow the protein to have a biological activity.
  • a PBA comprises two binding sites that are antigen-binding sites as typically found in antibodies (i.e., it comprises two Fabs).
  • Such PBAs usually comprise two light chains, wherein each light chain comprises a light chain variable (VL) domain that associates with (e.g. , by disulfide binding) the VH domain of each of two heavy chains, to form two binding sites.
  • VL domain may be linked to a constant light chain (CL) domain and form a light chain Fab region.
  • CL constant light chain
  • a VL domain may be linked at its C-terminus to the N-terminus of a CL domain.
  • the PBA has two different light chains, referred to as a first and a second light chain, wherein the first and the second light chains comprise a first and a second VL domain, respectively, and optionally a first and a second CL domain, respectively, and associate (e.g., dimerize) with the first and the second VH domain and optionally a first and a second CHI domain, respectively.
  • a PBA comprises one or more scFvs
  • the VH domain of each scFv is linked to an scFv linker, which is linked to a VL domain
  • a VH domain and a VL domain associate with each other to form an antigen binding site.
  • a VH domain is linked at its C-terminus to the N-terminus of an scFv linker, which is linked at its C- terminus to the N-terminus of a VL domain.
  • the N-terminus of the immunoglobulin CR is linked to a first VH domain, which is linked to a first scFv linker, which is linked to a first VL domain, and the first VH domain and the first VL domain form the first binding site; and the C-terminus of the immunoglobulin CR is linked to a second VH domain, which is linked to a second scFv linker, which is linked to a second VL domain, and the second VH domain and the second VL domain form the second binding site and two such immunoglobulin CRs are dimerized or otherwise associated (e.g. , by at least one bond, e.g., a disulfide bond or a van der Waals bond) to form a single tetravalent protein.
  • a first scFv linker which is linked to a first VL domain
  • the first VH domain and the first VL domain form the first binding site
  • the C-terminus of the immunoglobulin CR is
  • the immunoglobulin CR is a human immunoglobulin CR, i.e., it essentially consists of an aa sequence obtained from the human immunoglobulin repertoire.
  • the immunoglobulin CR may be that of any immunoglobulin isotype, class or subclass.
  • an immunoglobulin CR is an IgG CR, such as an IgG 1 , IgG2, IgG3 or IgG4 CR.
  • the CR is a hybrid that is made up of at least two different classes or subclasses or types of immunoglobulins.
  • an immunoglobulin CR may have one domain from IgGl and one or more other domains from an IgG4 protein.
  • a domain within the immunoglobulin CR may be mostly from one isotype of immunoglobulin, but may have one or more aa mutation(s) (e.g., substitution, addition or deletion) e.g., to provide the mutated immunoglobulin CR an attribute from another type or class of immunoglobulin CR.
  • aa mutation(s) e.g., substitution, addition or deletion
  • a PBA has an IgG-(scFv) 2 structure.
  • Such proteins comprise an
  • IgG antibody having two first binding sites, to which is linked an scFv having a second binding site, e.g., to each of the two C-termini of the IgG protein.
  • An exemplary IgG-(scFv) 2 is an IgGl - (scFv) 2 , wherein the IgG is an IgGl .
  • a PBA comprises a heavy chain having the structure represented by scFv-Fc-scFv and the PBA may have the structure (scFv-Fc-scFv) 2 .
  • the Fc may be an Fc region comprising a hinge, a CH2 and a CH3 domain. In certain embodiments, such proteins do not comprise a CHI or a CL domain.
  • a PBA comprises two identical heavy-light chain pairs that form an IgG like molecule, wherein each pair comprises one binding moiety that is an anti-IGF-l R Fab and another binding moiety that is an anti-ErbB3 scFv and wherein the two binding moieties are connected through an immunoglobulin CR, which comprises in N-terminal to C-terminal order a hinge domain, a CH2 domain and a CH3 domain.
  • the scFv may be linked to the CH3 domain via a linker.
  • a PBA comprises two identical heavy chains that form a dimer and two identical light chains, wherein each light chain associates with a heavy chain, and wherein each heavy chain comprises: a first VH domain that is linked at its C- terminus to the N-terminus of a CHI domain, which CHI domain is linked at its C-terminus to the N-terminus of a hinge domain, which hinge domain is linked at its C-terminus to the N- terminus of a CH2 domain, which CH2 domain is linked at its C-terminus to the N-terminus of a CH3 domain, which CH3 domain is linked at its C-terminus to the N-terminus of a linker, which linker is linked at its C-terminus to the N-terminus of a second VH domain, which second VH domain is linked at its C-terminus to the N-terminus of an scFv linker, which scFv linker is linked at its C-terminus to the N-terminus of a second VL
  • the first binding site is an anti-IGF-l R binding site and the second binding site is an anti-ErbB3 binding site. In another embodiment, the first binding site is an anti-ErbB3 binding site and the second binding site is an anti-IGF-lR binding site.
  • a PBA comprises an IGF-1R binding site comprising a VHCDR3 consisting of the consensus sequence of SEQ ID NO: 304, and optionally a VHCDRl and/or VHCDR2 consisting of the consensus sequences of SEQ ID NOs:302 and 303, respectively (see Fig. 1).
  • the last (C-terminal) X aa of SEQ ID NO:304 is not I.
  • a PBA may also comprise an anti-IGF- l R binding site comprising a VLCDR3 consisting of the consensus sequence of SEQ ID NO:307 or 308, and optionally either or both of a VLCDRl and a VLCDR2 consisting of the sequences of SEQ ID NOs:305 and 306, respectively (see Fig. 2).
  • a PBA comprises an anti-IGF-l R binding site comprising a VHCDRl , VHCDR2, VHCDR3, VLCDRl , VLCDR2 and VLCDR3 consisting of the consensus sequences of SEQ ID NOs:302, 303, 304, 305, 306, and 307 (or 308), respectively.
  • a PBA comprises an anti-ErbB3 binding site comprising a VHCDR3 consisting of the consensus sequence of SEQ ID NO: 31 1 , and optionally a VHCDR 1 and/or a VHCDR2 consisting of the sequences of SEQ ID NOs:309 and 310, respectively (see Fig. 3).
  • a PBA may also comprise an anti-IGF-lR binding site comprising a VLCDR3 consisting of the consensus sequence of SEQ ID NO:314 or 315, and optionally a VLCDRl and/or VLCDR2 consisting of the sequences of SEQ ID NOs:312 and 313, respectively (see Fig. 4).
  • a PBA comprises an anti-IGF-lR binding site comprising a
  • VHCDRl , VHCDR2, VHCDR3, VLCDRl, VLCDR2 and VLCDR3 consisting of the sequences of SEQ ID NOs:309, 310, 31 1 , 312, 313, and 314 (or 315), respectively.
  • sequences of SEQ ID Nos: 302-315 are set forth below:
  • VHCDRl consensus sequence GFX1FSX2YPMH (SEQ ID NO:302)
  • VHCDR2 consensus sequence ISX 1 X2GGATX3 YADS VKG (SEQ ID NO: 303)
  • VHCDR3 consensus sequence DFYX 1 X2LTGNAFDX3 (SEQ ID NO:304)
  • VLCDR 1 sequence RASQGISS YLA (SEQ ID NO: 305)
  • VLCDR2 consensus sequence AX1 STX2QS (SEQ ID NO: 306)
  • VLCDR3 consensus sequence QQYX1X2X3PLT (SEQ ID NO:307) and QQYWX1X2PLT (SEQ ID NO:308)
  • VHCDRl sequence GFTFDDYAMH (SEQ ID NO: 309)
  • VHCDR2 consensus sequence IS WX 1 SGSX2GYADSVKG (SEQ ID NO: 310)
  • VHCDR3 consensus sequence DLGX 1 X2QWX3X4GFD Y (SEQ ED NO:31 1)
  • VLCDRl sequence QGDSLRSYYAS (SEQ ED NO:312)
  • VLCDR2 sequence GKNNRPS (SEQ ID NO:313)
  • VLCDR3 consensus sequence X 1 SRDX2X3GX4X5WV (SEQ ID NO:314) and
  • X1SRDX2PGX3X4WV (SEQ ID NO: 315)
  • Each aa "X” followed by a numeral is a variable aa, which independently represents any aa, such as any aa located at a corresponding position in Fig.Figs. 1 , 2, 3 or 4.
  • Exemplary aas for X1-X2 of SEQ ID NO:302, X1-X2 of SEQ ID NO:303 and X1-X3 of SEQ ID NO:304 are provided at the corresponding positions in the aa sequences in Fig. 1.
  • Exemplary aas for XI -X2 of SEQ ID NO:306, X1-X3 of SEQ ID NO:307 and X1-X2 of SEQ ID NO:308 are provided at the corresponding positions in the aa sequences in Fig. 2.
  • Exemplary aas for XI -X2 of SEQ ID NO:310 and X 1-X4 of SEQ ID NO:31 1 are provided at the corresponding positions in the aa sequences in Fig. 3.
  • Exemplary aas for X1 -X5 of SEQ ID NO:314 or X1-X4 of SEQ ID NO:315 are provided at the corresponding positions in the aa sequences in Fig. 4.
  • An exemplary PBA comprises an anti-IGF-lR binding site comprising a VHCDR1 , VHCDR2, VHCDR3, VLCDRl , VLCDR2 and VLCDR3 consisting of the sequences of SEQ ID NOs:302, 303, 304, 305, 306, and 307 (or 308), respectively, and the anti-ErbB3 binding site comprising a VHCDR1 , VHCDR2, VHCDR3, VLCDRl , VLCDR2 and VLCDR3 consisting of the sequences of SEQ ID NOs:309, 310, 31 1 , 312, 313, and 314 (or 315), respectively.
  • Exemplary PBAs comprise one or more CDRs from one or more of the VRs provided in Fig.Figs. 1-4.
  • an anti-IGF-lR binding site comprises 1 , 2 or 3 CDRs of one of the VH domains of Fig. 1 and/or 1, 2 or 3 CDRs of one of the VL domains of Fig. 2.
  • an anti-IGF-lR binding moiety may comprise CDR1, CDR2 and/or CDR3 from SEQ ID NO: l 1 and/or CDR1 , CDR2 and/or CDR3 from SEQ ID NO:35 (CDRs of 16F).
  • an anti-IGF-lR binding moiety comprises a combination of CDRs of Fig.Figs.
  • Exemplary PBAs comprise an anti-IGF-lR binding entity comprising a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of a sequence in Fig. 1 , e.g. , one of SEQ ID Nos:8, 9, 10 and 1 1 (the location of these CDRs is shown in Fig. 1).
  • PBAs may also comprise an anti-IGF-l R binding entity comprising a VL domain comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of one of SEQ ID Nos:32, 33, 34 and 35 (the location of these CDRs is shown in Fig. 2).
  • PBAs comprise an anti-IGF-lR binding entity comprising a VH domain comprising the VHCDR1, VHCDR2 and VHCDR3 aa sequences of one of SEQ ID Nos:8, 9, 10 and 1 1 and a VL domain comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of one of SEQ ID Nos:32, 33, 34 and 35.
  • an anti-IGF-lR binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ID No:8 and a VL domain comprising the VLCDR 1 , VLCDR2 and VLCDR3 aa sequences of SEQ ED No: 32.
  • an anti-IGF-lR binding domain comprises a VH domain comprising the
  • an anti-IGF- lR binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ID No: 10 and a VL domain comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of SEQ ID No:34.
  • an anti-IGF-lR binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ID No: 11 and a VL domain comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of SEQ ID No:35.
  • an anti-IGF-lR binding domain comprises a VH domain comprising the VHCDR 1 , VHCDR2 and VHCDR3 aa sequences of SEQ ⁇ ) No: 8 and a VL domain comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of SEQ ID No: 33.
  • an anti-IGF-lR binding domain comprises a VH domain comprising the VHCDR 1 , VHCDR2 and VHCDR3 aa sequences of SEQ ID No: 10 and a VL domain comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of SEQ ID No:32.
  • an anti-ErbB3 binding site comprises 1 , 2 or 3 CDRs of one of the VH domains of Fig. 3 and/or 1 , 2 or 3 CDRs of one of the VL domains of Fig. 4.
  • an anti-ErbB3 binding moiety may comprise CDR1 , CDR2 and/or CDR3 from SEQ ID NO: 143 and/or CDR 1 , CDR2 and/or CDR3 from SEQ ID NO: 175 (CDRs of 16F).
  • an anti-ErbB3 binding moiety comprises a combination of CDRs of Fig.Figs.
  • Exemplary PBAs comprise an anti-ErbB3 binding entity comprising a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of a sequence in Fig. 3, e.g., one of SEQ ID Nos: 134-143 (the location of these CDRs are provided in Fig. 3).
  • PBAs may also comprise an anti-ErbB3 binding entity comprising a VL domain comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of one of SEQ ID Nos: 166-175 (the location of these CDRs are provided in Fig. 4).
  • PBAs comprise an anti-ErbB3 binding entity comprising a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of one of SEQ ID Nos: 134- 143 and a VL domain comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of one of SEQ ID NOs: 166-175.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1, VHCDR2 and VHCDR3 aa sequences of SEQ ID No: 134 and a VL domain comprising the VLCDR1 , VLCDR2 and VLCDR3 aa sequences of SEQ ED No: 166.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ED No: 135 and a VL domain comprising the VLCDR1 , VLCDR2 and VLCDR3 aa sequences of SEQ ED No: 167.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ED No: 136 and a VL domain comprising the VLCDR1 , VLCDR2 and VLCDR3 aa sequences of SEQ ED No: 168.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ED No: 137 and a VL domain comprising the VLCDR1 , VLCDR2 and VLCDR3 aa sequences of SEQ ID No: 169.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ED No: 138 and a VL domain comprising the VLCDR1 ,
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ED No: 139 and a VL domain comprising the VLCDR1 , VLCDR2 and VLCDR3 aa sequences of SEQ ED No: 171.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ED No: 140 and a VL domain comprising the VLCDR1 , VLCDR2 and VLCDR3 aa sequences of SEQ ED No: 172.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ED No: 141 and a VL domain comprising the VLCDR1 , VLCDR2 and VLCDR3 aa sequences of SEQ ED No: 173.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ED No: 142 and a VL domain comprising the VLCDR1 , VLCDR2 and VLCDR3 aa sequences of SEQ ED No: 174.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ED No: 143 and a VL domain comprising the VLCDR1,
  • an anti- ErbB3 binding domain comprises a VH domain comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of SEQ ED No: 136 and a VL domain comprising the VLCDR1 , VLCDR2 and VLCDR3 aa sequences of SEQ ED No: 169.
  • Binding sites may also comprise one or more CDRs of the VRs of Fig.Figs. 1-4, wherein 1 , 2 or 3 aas have been changed, e.g. , substituted, added or deleted, provided that the binding sites are still able to bind specifically to their target.
  • an anti-IGF-lR binding site comprises a VH domain comprising the following consensus sequence:
  • This consensus sequence was obtained by aligning the VH sequences of 24 high affinity anti- IGF-1R binding sites. The alignment is shown in Fig. 1.
  • each of aas XI -XI 1 of SEQ ID NO: 1 independently represents any aa. In other embodiments, each of aas XI -XI 1 of SEQ ID NO: 1 independently represents any aa set forth at those positions in any of the sequences in Fig. 1.
  • XI is T
  • X2 is V
  • X3 is S
  • X4 is S
  • X5 is S
  • X6 R
  • X7 is A
  • X8 is D
  • X9 I
  • X10 is I
  • XI 1 is T (SF heavy chain 16F; SEQ ID NO: l 1).
  • Exemplary IGF-1R VH sequences are set forth as SEQ ID NOs:8-31.
  • a VH domain of an anti-IGF-lR binding site comprises the consensus sequence of SEQ ID NO: l with the proviso that (i.e., wherein) the sequence is not that of SF heavy chain 16F, e.g., by differing from it in at least one aa.
  • a VH domain of an anti-IGF-lR binding site comprises the consensus sequence of SEQ ID NO: 1 with the proviso that (i.e., wherein) XI is not T, X2 is not V, X6 is not R, X8 is not D or X10 is not I.
  • Exemplary anti-IGF-lR VH sequences are set forth as SEQ ID NOs:8-10 and 12-31.
  • an anti-IGF-lR binding site comprises a VL domain comprising the following consensus sequence:
  • This consensus sequence was obtained by aligning the VL sequences of about 100 high affinity anti-IGF-lR binding sites. The alignment is shown in Fig. 2.
  • each of aas X1-X10 of SEQ ID NO:2 independently represents any aa. In other embodiments, each of aas X1-X10 of SEQ ID NO:2 independently represents any aa set forth at those positions in any of the sequences in Fig. 2.
  • XI is M
  • X2 is T
  • X3 is A
  • X4 is L
  • X5 is D
  • X6 is F
  • X7 is A
  • X8 is F
  • X9 T
  • X10 is F (SF kappa light chain 16F; SEQ ID NO: 35).
  • Exemplary IGF-1R VL sequences are set forth as SEQ ID NOs:32-133.
  • a VL domain of an anti-IGF-lR binding site comprises the consensus sequence of SEQ ID NO:2, with the proviso that (i.e., wherein) the sequence is not that of SF light chain 16F, e.g. , by differing from it in at least one aa.
  • a VL domain of an anti-IGF-lR binding site comprises the consensus sequence of SEQ ED NO:2 with the proviso that (i.e., wherein) X2 is not T, X6 is not F or X8 is not F.
  • X2 may be an L
  • X6 may be an F and/or X8 may be an F, as of the following consensus sequence:
  • a VL domain of an anti-IGF-lR binding site comprises the consensus sequence of SEQ ID NO:3, wherein each of aas X1-X7 of SEQ ID NO:3 independently represents any aa. In other embodiments, each of aas XI -X7 of SEQ ID NO: 3 independently represents any aa set forth at those positions in any of the sequences in Fig. 2. Exemplary IGF-1R VL sequences are set forth as SEQ ID NOs:32-34 and 36-133.
  • an anti-ErbB3 binding site comprises a VH domain comprising the following consensus sequence:
  • This consensus sequence was obtained by aligning the VH sequences of 32 high affinity anti-IGF-lR binding sites. The alignment is shown in Fig. 3.
  • each of aas X1-X12 of SEQ ID NO:4 independently represents any aa. In other embodiments, each of aas X 1-X12 of SEQ ID NO:4 independently represents any aa set forth at those positions in any of the sequences in Fig. 3.
  • XI is Q
  • X2 is Q
  • X3 is G
  • X4 is A
  • X5 is N
  • X6 is I
  • X7 is P
  • X8 is V
  • X9 Y
  • X10 is N
  • XI 1 is V
  • X 12 is E (C8 heavy chain 16F; SEQ ID NO: 143).
  • Exemplary ErbB3 VH sequences are set forth as SEQ ID NOs: 134-165.
  • a VH domain of an anti-ErbB3 binding site comprises the consensus sequence of SEQ ID NO:4, with the proviso that (i.e., wherein) the sequence is not that of C8 heavy chain 16F, e.g., by differing from it in at least one aa.
  • a VH domain of an anti- ErbB3 binding site comprises the consensus sequence of SEQ ID NO:4 with the proviso that (i.e., wherein) aa X7 is not P or X8 is not V.
  • X7 When X7 is not P and/or X8 is not V, X7 may be an A an/or X8 may be an L, as of the following consensus sequence: X 1 VOLVX2SGGGLVOPGX3SLRLSCAASGFTFDDYA HWVROAPGKGLEWVX4GISW X5SGSX6GYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCARDLGX7X80WX9 X 10GFDYWGOGTLVTVSS (SEQ ID NO:5; the CDRs are underlined).
  • a VH domain of an anti-ErbB3 binding site comprises the consensus sequence of SEQ ID NO:5, wherein each of aas X1-X10 of SEQ ID NO:5 independently represents any aa. In other embodiments, each of aas X1-X10 of SEQ ID NO:5 independently represents any aa set forth at those positions in any of the sequences in Fig. 3. Exemplary ErbB3 VH sequences are set forth as SEQ ID NOs: 134-142 and 144-165.
  • an anti-ErbB3 binding site comprises a VL domain comprising the following consensus sequence:
  • This consensus sequence was obtained by aligning the VL sequences of 35 high affinity anti-IGF-lR binding sites. The alignment is shown in Fig. 4.
  • each of aas X1-X9 of SEQ ID NO:6 independently represents any aa. In other embodiments, each of aas X1-X10 of SEQ ID NO:6 independently represents any aa set forth at those positions in any of the sequences in Fig. 4.
  • XI is Y
  • X2 is T
  • X3 is S
  • X4 is N
  • X5 is S
  • X6 is S
  • X7 is N
  • X8 H
  • X9 is L (C8 lambda light chain 16F; SEQ ID NO: 175).
  • Exemplary ErbB3 VL sequences are set forth as SEQ ID NOs: 166-200.
  • a VL domain of an anti-ErbB3 binding site comprises the consensus sequence of SEQ ID NO:6, with the proviso that (i.e., wherein) the sequence is not that of C8 lambda light chain 16F, e.g., by differing from it in at least one aa.
  • a VL domain of an anti- ErbB3 binding site comprises the consensus sequence of SEQ ID NO:6 with the proviso that (i.e., wherein) X6 is not S.
  • X6 may be P, as of the following consensus sequence:
  • a VL domain of an anti-ErbB3 binding site comprises the consensus sequence of SEQ ID NO:7, each of aas X1-X8 of SEQ ID NO:7 independently represents any aa. In other embodiments, each of aas X1-X8 of SEQ ID NO:7 independently represents any aa set forth at those positions in any of the sequences in Fig. 4. Exemplary ErbB3 VL sequences are set forth as SEQ ID NOs: 166-174 and 176-200.
  • Exemplary anti-IGF-l R VH domains include the M57 VH domain (SEQ ID NO:8), M78 VH domain (SEQ ID NO:9), P4 VH domain (SEQ ID NO: 10) and SF VH domain (SEQ ID NO: 1 1).
  • Exemplary anti-IGF-l R VL domains include the M57 VL domain (SEQ ID NO:32), M78 VL domain (SEQ ID NO:33), P4 VL domain (SEQ ID NO:34) and SF VL domain (SEQ ID NO:35).
  • Exemplary anti-ErbB3 VH domains include the B60 VH domain (SEQ ID NO: 134), B72 VH domain (SEQ ID NO: 135), M27 VH domain (SEQ ID NO: 136), M7 VH domain (SEQ ID NO: 137), PI VH domain (SEQ ID NO: 138), M27 VH domain (SEQ ID NO: 139), B69 VH domain (SEQ ID NO: 140), P6 VH domain (SEQ ID NO: 141), Ml .3 VH domain (SEQ ID NO: 142), and C8 VH domain (SEQ ID NO: 143).
  • Exemplary anti-ErbB3 VL domains include the B60 VL domain (SEQ ID NO: 166), B72 VL domain (SEQ ID NO: 167), M27 VL domain (SEQ ID NO: 168), M7 VL domain (SEQ ED NO: 169), PI VL domain (SEQ ID NO: 170), M27 VL domain (SEQ ID NO: 171 ), B69 VL domain (SEQ ID NO: 172), P6 VH domain (SEQ ID NO: 173), M1.3 VL domain (SEQ ID NO: 174), and C8 VL domain (SEQ ID NO: 175).
  • Binding sites may comprise a VH and a VL domain having the same module name (e.g.,
  • anti-IGF-lR binding moieties may comprise: (i) the VH domain of module M57 (SEQ ID NO:8) and the VL domain of module M57 (SEQ ID NO:32); the VH domain of module M78 (SEQ ID NO:9) and the VL domain of module M78 (SEQ ID NO:33); (iii) the VH domain of module P4 (SEQ ID NO: 10) and the VL domain of module P4 (SEQ ED NO:34) or (iv) the VH domain of module SF (SEQ ID NO: 1 1) and the VL domain of module SF (SEQ ID NO:35).
  • An anti-ErbB3 binding moieties may comprise: (i) the VH domain of module B60 (SEQ ED NO: 134) and the VL domain of module B60 (SEQ ID NO: 166); (ii) the VH domain of module B72 (SEQ ID NO: 135) and the VL domain of module B72 (SEQ ID NO: 167); (iii) the VH domain of module M27
  • Binding moieties of PB may also comprise mixed and matched VH and VL domains, i.e., a binding moiety may comprise a VH domain from one module and a VL domain from another module.
  • a binding moiety may comprise a VH domain from one module and a VL domain from another module.
  • an IGF-IR binding moiety may comprise the VH domain of module M57 (SEQ ID NO:8) and the VL domain of module M78 (SEQ ID NO:33) or the VH domain of module P4 (SEQ ID NO: 10) and the VL domain of module M57 (SEQ ID NO:32).
  • An anti-ErbB3 binding moiety may comprise the VH domain of module M27 (SEQ ID NO: 136) and the VL domain of module M7 (SEQ ID NO: 169; see, e.g.. Example 7).
  • Mixed chain binding moieties that bind with high affinity to their targets are preferred.
  • a PBA may also comprise aa sequences falling within more than one of the IGF-IR VH (SEQ ID NO: l), IGF-IR VL (SEQ ID NO:2), ErbB3 VH (SEQ ID NO:4) and ErbB3 VL (SEQ ID NO:6) consensus sequences described herein, provided that the PBA specifically binds to IGF-IR and ErbB3.
  • a PBA may comprise any of:
  • an IGF-IR VH domain comprising SEQ ED NO: 1 and an IGF-IR VL domain
  • an IGF-IR VH domain comprising SEQ ED NO: 1 and an ErbB3 VH domain comprising SEQ ED NO:4;
  • an IGF-IR VH domain comprising SEQ ED NO: l
  • an IGF-IR VL domain comprising SEQ ED NO:2
  • an ErbB3 VH domain comprising SEQ ED NO:4;
  • an IGF-IR VH domain comprising SEQ ED NO: l
  • an IGF-IR VL domain comprising SEQ ED NO:2
  • an ErbB3 VL domain comprising SEQ ED NO:6;
  • an IGF- 1 R VH domain comprising SEQ ED NO: 1
  • an IGF- 1 R VL domain comprising SEQ ED NO:2
  • an ErbB3 VH domain comprising SEQ ID NO:4
  • an ErbB3 VL domain comprising SEQ ID NO:6;
  • an IGF-IR VL domain comprising SEQ ED NO:2 and an ErbB3 VH domain comprising SEQ ED NO:4;
  • an IGF-IR VL domain comprising SEQ ID NO:2 and an ErbB3 VL domain comprising SEQ ED NO:6;
  • an IGF-IR VL domain comprising SEQ ED NO:2, an ErbB3 VH domain comprising SEQ ED NO:4, and an ErbB3 VL domain comprising SEQ ED NO:6; or
  • variable aas are independently any aa, or wherein the variable aas are independently any of the aas set forth at the corresponding position for each of these consensus sequences of Fig.Figs. 1-4, provided that the PBA binds specifically to IGF-IR and to ErbB3.
  • a PBA may also comprise aa sequences falling within more than one of the IGF-IR VH (SEQ ID NO: 1), IGF-IR VL (SEQ ID NO:2), ErbB3 VH (SEQ ID NO:4) and ErbB3 VL (SEQ ID NO:6) consensus sequences described herein, provided that the PBA specifically binds to IGF-IR and ErbB3, with the proviso that (i.e., wherein) the PBA is not 16F.
  • a PBA may comprise aa sequences falling within more than one of the IGF-I R VH (SEQ ID NO: l ), IGF-IR VL (SEQ ID NO:3), ErbB3 VH (SEQ ID NO:5) and ErbB3 VL (SEQ ID NOs:7) consensus sequences described herein, provided that they specifically bind to IGF-IR and ErbB3.
  • a PBA may comprise:
  • an IGF-IR VH domain comprising SEQ ID NO: 1 and an IGF-IR VL domain
  • an IGF-IR VH domain comprising SEQ ID NO: 1 and an ErbB3 VH domain comprising SEQ ED NO:5;
  • an IGF-IR VH domain comprising SEQ ID NO: 1 and an ErbB3 VL domain comprising SEQ ID NO:7;
  • an IGF-IR VH domain comprising SEQ ID NO: 1
  • an IGF-IR VL domain comprising SEQ ID NO:3
  • an ErbB3 VH domain comprising SEQ ID NO:5;
  • an IGF-IR VH domain comprising SEQ ID NO: 1
  • an IGF-IR VL domain comprising SEQ ID NO:3, and an ErbB3 VL domain comprising SEQ ID NO:7;
  • an IGF- 1 R VH domain comprising SEQ ID NO: 1
  • an IGF- 1 R VL domain comprising SEQ ID NO:3, an ErbB3 VH domain comprising SEQ ID NO:5, and an ErbB3 VL domain comprising SEQ ID NO:7;
  • an IGF-IR VL domain comprising SEQ ID NO:3 and an ErbB3 VH domain comprising SEQ ID NO:5;
  • an IGF-IR VL domain comprising SEQ ID NO:3 and an ErbB3 VL domain comprising SEQ ID NO:7;
  • an IGF-IR VL domain comprising SEQ ID NO:3, an ErbB3 VH domain comprising SEQ ID NO:5, and an ErbB3 VL domain comprising SEQ ID NO:7; or
  • an ErbB3 VH domain comprising SEQ ID NO:5 and an ErbB3 VL domain comprising SEQ ID NO:7;
  • variable aas are independently any aa, or wherein the variable aas are independently any of the aas set forth at the corresponding position for each of these consensus sequences of Fig.Figs. 1-4, provided that the PBA binds specifically to IGF-IR and to ErbB3.
  • Exemplary PBAs comprise an anti-IGF-lR binding entity comprising a VH domain comprising an aa sequence in Fig. 1 , e.g., the aa sequence of one of SEQ ID Nos:8, 9, 10 and 1 1.
  • PBAs may also comprise an anti-IGF-lR binding entity comprising a VL domain comprising an aa sequence in Fig. 2, e.g., the aa sequence of one of SEQ ID Nos:32, 33, 34 and 35.
  • PBAs comprise an anti-IGF-lR binding entity comprising a VH domain comprising the aa sequence of one of SEQ ID Nos:8, 9, 10 and 11 and a VL domain comprising the aa sequence of one of SEQ ID Nos:32, 33, 34 and 35.
  • an anti- IGF-1R binding domain comprises a VH domain comprising the aa sequence of SEQ ID No:8 and a VL domain comprising the aa sequence of SEQ ID No:32.
  • an anti-IGF-lR binding domain comprises a VH domain comprising the aa sequence of SEQ ID No:9 and a VL domain comprising the aa sequence of SEQ ID No:33.
  • an anti-IGF-lR binding domain comprises a VH domain comprising the aa sequence of SEQ ID No: 10 and a VL domain comprising the aa sequence of SEQ ID No:34.
  • an anti-IGF-lR binding domain comprises a VH domain comprising the aa sequence of SEQ ID No: 11 and a VL domain comprising the aa sequence of SEQ ID No: 35.
  • an anti-IGF-lR binding domain comprises a VH domain comprising the aa sequence of SEQ ID No:8 and a VL domain comprising the aa sequence of SEQ ID No:33.
  • an anti-IGF-lR binding domain comprises a VH domain comprising the aa sequence of SEQ ID No: 10 and a VL domain comprising the aa sequence of SEQ ID No:32.
  • Exemplary PBAs comprise an anti-ErbB3 binding entity comprising a VH domain comprising the aa sequence of one of SEQ ID Nos: 134-143.
  • PBAs may also comprise an anti- ErbB3 binding entity comprising a VL domain comprising the aa sequence of one of SEQ ID Nos: 166-175.
  • PBAs comprise an anti-ErbB3 binding entity comprising a VH domain comprising the aa sequence of one of SEQ ID Nos: 134-143 and a VL domain comprising the aa sequence of one of SEQ ID NOs: 166-175.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ ID No: 134 and a VL domain comprising the aa sequence of SEQ ID No: 166.
  • an anti-ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ ED No: 135 and a VL domain comprising the aa sequence of SEQ ED No: 167.
  • an anti-ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ DD No: 136 and a VL domain comprising the aa sequence of SEQ DD No: 168.
  • an anti-ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ ID No: 137 and a VL domain comprising the aa sequence of SEQ DD No: 169.
  • an anti-ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ DD No: 138 and a VL domain comprising the aa sequence of SEQ DD No: 170.
  • an anti-ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ DD No: 139 and a VL domain comprising the aa sequence of SEQ DD No: 171.
  • an anti-ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ DD No: 140 and a VL domain comprising the aa sequence of SEQ ID No: 172.
  • an anti-ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ ID No: 141 and a VL domain comprising the aa sequence of SEQ ID No: 173.
  • an anti- ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ ID No: 142 and a VL domain comprising the aa sequence of SEQ ID No: 174.
  • an anti-ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ ID No: 143 and a VL domain comprising the aa sequence of SEQ ID No: 175.
  • an anti-ErbB3 binding domain comprises a VH domain comprising the aa sequence of SEQ ID No: 136 and a VL domain comprising the aa sequence of SEQ ID No: 169.
  • a PBA comprises a heavy chain comprising an immunoglobulin CR comprising, consisting essentially of, or consisting of the CHI domain, hinge, CH2 domain and CH3 domain of an IgGl (referred to as an "IgGl CR")-
  • Exemplary PBAs comprise an IgG l CR and one or more of the following aa sequences: an IGF- IR VH domain comprising a consensus sequence of SEQ ID NO: l ; an IGF-IR VL domain comprising a consensus sequence of SEQ ID NO:2; an ErbB3 VH domain comprising the consensus sequence of SEQ ID NO:4; and an ErbB3 VL domain comprising the consensus sequence of SEQ ID NO:6, and comprise PBAs comprising heavy and light chain aa sequences of Fig. Figs. 5A, 5B, 7 A and 7B.
  • PBAs comprise a heavy chain comprising an IgGl CR and one or more of the following aa sequences: an IGF-IR VH domain comprising a consensus sequence of SEQ ID NO: l ; an IGF-I R VL domain comprising a consensus sequence of SEQ ID NO:3; an ErbB3 VH domain comprising the consensus sequence of SEQ ID NO:5; and an ErbB3 VL domain comprising the consensus sequence of SEQ ID NO:7, and comprise PBAs comprising heavy and light chain aa sequences of Fig.Figs. 5 A and 5B, but excluding 16 heavy and light chains.
  • PBAs that comprise a carboxy terminus that would otherwise end with a lysine or an arginine may have their carboxy terminal aa clipped by a carboxypeptidase.
  • a protein would otherwise have "VEIK" at its carboxy terminus
  • 1 , 2, 3, 4 5 or more aas may be added to the carboxy terminus to prevent removal of the lysine.
  • these additional aa may originate from the CL domain.
  • aa "RT” may be added at the carboxy terminus (see, e.g., P1-G1 -P4; SEQ ID NO:268).
  • Anti-IGF-lR ErbB3 PBAs may comprise a heavy chain comprising an aa sequence selected from the group consisting of heavy chain fusions (hybrids): SF-G1-C8 (i.e., 16F; SEQ ID NO:210); SF-G1 -P1 (SEQ ID NO:212); SF-G1 -M1.3 (SEQ ID NO:214); SF-G1 -M27 (SEQ ID NO:216); SF-G1 -P6 (SEQ ID NO:218); SF-G 1-B69 (SEQ ID NO:220); P4-G 1-C8 (SEQ ID NO:222); P4-G1-P1 (SEQ ID NO:224); P4-G1-M1.3 (SEQ ID NO:226); P4-G1-M27 (SEQ ID NO:228); P4-G1-P6 (SEQ ID NO:230); P4-G1-B69 (SEQ ID NO:232); M
  • Anti-IGF-lR/ErbB3 PBAs may comprise a light chain comprising an aa sequence selected from the group consisting of Kappa light chains: SF (SEQ ID NO:202); P4 (SEQ ID NO.-204); M78 (SEQ ID NO:206); and M57 (SEQ ID NO:208).
  • Anti-ErbB3/IGF-lR PBAs may comprise a heavy chain comprising an aa sequence selected from the group consisting of heavy chain fusions (hybrids): P1-G1-P4 (SEQ ID NO:268); P1-G1-M57 (SEQ ID NO:270); P1-G1-M78 (SEQ ID NO:272); M27-G1-P4 (SEQ ID NO:274); M27-G1-M57 (SEQ ID NO:276); M27-G1-M78 (SEQ ID NO:278); M7-G1-P4 (SEQ ID NO:280); M7-G1-M57 ((SEQ ID NO:282); M7-G1-M78 (SEQ ID NO:284); B72-G1-P4 (SEQ ID NO:286); B72-G1-M57 (SEQ ID NO:288); B72-G1-M78 (SEQ ID NO:290); B60-G1
  • Anti-ErbB 3/IGF- 1 R PBAs may comprise a light chain comprising an aa sequence selected from the group consisting of lambda light chains: PI (SEQ ID NO:258), M27 (SEQ ID NO:260), M7 (SEQ ID NO:262), B72 (SEQ ID NO:264), and B60 (SEQ ID NO:266).
  • a heavy chain may be paired with a light chain that comprises a VL domain of the same module as the VH domain of the heavy chain.
  • heavy chains and light chains may also be mixed and matched, provided that the binding sites retain high affinity binding to their target.
  • Exemplary IGF-lR+ErbB3 PBAs comprising IgGl CRs
  • IGF-lR+ErbB3 PBAs comprising IgGl CRs
  • Table 5 Exemplary IGF-lR+ErbB3 PBAs comprising IgGl CRs
  • B60-G1-M57 (SEQ ID NO:294 and SEQ ID B60-G1-M78 (SEQ ED NO:296 and SEQ ED NO:266) NO:266).
  • P33M-G1 -M1.3 (SEQ ID NO:378 and SEQ ID P33 -G1-C8 (SEQ ED NO:379 and SEQ ID NO: 380) NO:380)
  • P4M-G1-P6L (SEQ ID NO:389 and SEQ ID P33M-G1-P6L (SEQ ID NO:390 and SEQ ID NO:381) NO:380)
  • a PBA comprises two identical heavy chains and two identical light chains, wherein the sequence of each of the heavy chains comprises, consists essentially of, or consists of SEQ ID NO:210 or 300, and wherein the sequence of each of the light chains domains comprise, consist essentially of, or consist of SEQ ID NO:202 or 298.
  • PBAs may also comprise a heavy chain and/or a light chain that comprise an aa sequence that differs from SEQ ID NO:202 or 298 or SEQ ID NO:210 or 300, respectively, in exactly or in at most 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 50, 100, 200, or 300 aas, provided that the PBA has the desired biological characteristic(s), as further described herein.
  • a PBA comprises an aa sequence that differs from SEQ ID NO:210 or 300 by the addition of a lysine (K) at the end of the CH3 domain, i.e., creating the sequence ... SLSLSPGKGGGGS.... (SEQ ID NO:301).
  • a PBA may also comprise an aa sequence that differs from SEQ ID NO:210 or 300 by comprising one or more of the following aa substitutions in the CH3 domain: S239D, N297Q, S298A ,T299A, T299C, T299K, A330L, I332E, E333A, K334A, E356D, M358L, N434A, N343K (EU numbering; see Fig. 7A).
  • PBAs may also comprise two identical heavy chains and two identical light chains, wherein the sequence of each of the heavy chains and of each of the light chains comprises, consists essentially of, or consists of a sequence of Fig. 5A or 5B (i.e., any even SEQ ID- numbered sequence selected from SEQ ID NOs:202-296).
  • PBAs may also comprise a heavy chain and/or a light chain comprising an aa sequence that differs from a sequence in Fig. 5A or 5B in exactly or in at most 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 50, 100, 200, or 300 aas, provided that the PBA has the desired biological characteristic(s), as further described herein.
  • a PBA may comprise an aa sequence that differs from an aa sequence of Fig. 5A or 5B, by the addition (or deletion) of a lysine at the end of a CH3 domain, and/or by comprising one or more of the following aa substitutions in the CH3 domain: S239D, N297Q, S298A ,T299A, T299C, T299K, A330L, I332E, E333A, K334A, E356D, M358L, N434A, N343K (see Fig. 7A).
  • One or more aa differences may be present in one or both of the two VH domains or in one or both of the two VL domains, e.g. , in one or more CDR or in one or more framework region (FR).
  • One or more aa differences may also be present in one or more of the immunoglobulin CR domains, e.g., in the CHI domain, the CL domain, the hinge, the CH2 domain and/or the CH3 domain.
  • Particular aa changes that may be made to an immunoglobulin CR e.g., to change one or more characteristics of an immunoglobulin, are further described herein.
  • Aa changes may also be present in the linker that connects the C-terminus of the CH3 domain to the N-terminus of the scFv and/or the scFv linker that connects the C-terminus of the VH domain of the scFv to the N-terminus of the VL domain of the scFv. Exemplary modifications that may be made to a connecting linker and an scFv linker are discussed further herein.
  • PBAs may also be used:
  • PBAs comprising a heavy chain and/or a light chain comprising an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the aa sequence of the heavy chain domain having SEQ ID NO:210 or 300 and/or the light chain domain having SEQ ID NO:202 or 298 (SEQ ID NOs of 16F), wherein the PBAs have the desired biological characteristic(s);
  • PBAs that are biosimilars or bioequivalents of a PBA consisting of two heavy chain domains, each of which consists of SEQ ED NO:210 or 300 and two light chain domains, each of which consists of SEQ ID NO:202 or 298;
  • PBAs comprising one or more domains, e.g., VH domain, VL domain, CDR domain, FR domain, CHI domain, CL domain, hinge, CH2 domain, CH3 domain, linker, scFv VH domain, scFv linker, and scFv VL domain comprising an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the aa sequence of the corresponding domain(s) in SEQ ID NO:202, 210, 298 or 300;
  • PBAs comprising a heavy chain domain and/or a light chain domain comprising an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the aa sequence of a heavy chain domain of Fig. 5A or 5B and/or a light chain domain of Fig. 5A or 5B, wherein the PBAs have the desired biological characteristic(s);
  • PBAs that are biosimilars or bioequivalents of a PBA consisting of two heavy chain domains, each of which comprises an aa sequence of Fig. 5A or 5B and two light chain domains, each of which comprises an aa sequence of Fig. 5A or 5B;
  • PBAs comprising one or more domains, e.g., VH domain, VL domain, CDR domain, FR domain, CHI domain, CL domain, hinge domain, CH2 domain, CH3 domain, linker domain, scFv VH domain, scFv linker domain, and scFv VL domain comprising an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the aa sequence of the corresponding domain(s) in any one of the aa sequences of Fig. 5 A or 5B.
  • domains e.g., VH domain, VL domain, CDR domain, FR domain, CHI domain, CL domain, hinge domain, CH2 domain, CH3 domain, linker domain, scFv VH domain, scFv linker domain, and scFv VL domain comprising an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%,
  • a PBA comprises an aa sequence that differs from an aa sequence (such as an aa of Fig.Figs. 5 or 6) set forth herein
  • the PBA is not 16F (i.e., does not comprise two heavy chains consisting of SEQ ID NO:210 and two light chains consisting of SEQ ID NO:202).
  • a PBA comprises two heavy-light chain pairs that associate with each other, wherein each heavy-light chain pair comprises an anti-IGF-lR binding site and an anti-ErbB3 binding site, and wherein the heavy-light chain pairs differ from each other.
  • the heavy-light chain pairs may differ in one or more aas (e.g., in exactly or in at most 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, or up to 100 aas).
  • a first heavy-light chain pair may comprise a heavy chain CR and a second heavy-light chain pair may comprise a second heavy CR, wherein the first and the second heavy chain CRs have aa differences that favor their association with each other (e.g. , "knobs and holes").
  • a polyvalent protein comprises more than four binding sites.
  • a hexavalent binding protein may comprise an IgG-(scFv) 2 , i.e., a protein comprising two binding sites that are part of the IgG, one scFvs is attached to the C-terminus of the each of the CH3 domains of the IgG, and further comprising either another Fab or scFv, linked, e.g., through a linker, to the N-terminus of the IgG protein or to the C-terminus of each of the scFvs.
  • An octavalent binding protein may comprise the same structure as a hexavalent binding protein, further comprising two additional binding sites.
  • a PBA may comprise one binding site that is derived from a binding protein or antibody that is known in the art, such as those further described herein.
  • a PBA may comprise one or more CDRs from an anti-IGF-lR antibody selected from the group consisting of CP-751 ,871 ; IMC-A12; ANTI-IGF-1R Ab# A; BIDB-G1 1 ; and C06, whose heavy and light chain aa sequences are of Fig. 37.
  • an anti-IGF-lR binding site for use in a PBA may comprise a VHCDR3 and/or VLCDR3 domain and optionally the VHCDR1 , VLCDR1, VHCDR2 and/or VLCDR2 of any one of SEQ ID NOs:321-335.
  • a PBA comprises an anti-IGF-lR binding site comprising 1 , 2, 3, 4, 5, or 6 CDRs comprising an aa sequence that differs from the corresponding one of one of SEQ ID NOs: 321-335 by 1, 2 or 3 aa additions, deletions or substitutions, provided that the binding site binds specifically to its target (antigen).
  • a PBA comprises an anti-IGF- 1R binding site comprising 1 , 2, 3, 4, 5 or 6 CDRs comprising an aa sequence that is at least 70%, 80%, 90% or 95% identical or similar to the corresponding CDR of one of SEQ ID NO: 1
  • a PBA comprises a VH and/or a VL chain comprising an aa sequence of any one of SEQ ID NOs:321 -335.
  • a PBA comprises a VH and/or VL chain that comprises an aa sequence that differs from any one of SEQ ID NOs:321-335 in at most 1 , 2, 3, 4, 5, 10, 15, 20, 25 or 30 aa deletions, additions or substitutions, or which is at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to a sequence in SEQ ID NOs:321-335, provided that the binding site binds specifically to its target.
  • a PBA comprises a binding site comprising a light chain and/or a heavy chain comprising an aa sequence of SEQ ID NOs:321-335, or which differs from it in at most 1 , 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90 or 100 aa deletions, additions or substitutions, or which is at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to a sequence in SEQ ID NOs:321-335, provided that the binding site retains specific binding to its target.
  • a PBA may comprise (i) a VH domain and a VL domain; (ii) a heavy chain and a light chain; or (iii) an scFv comprising the VH and VL chains, from an antibody selected from the group of antibodies consisting of CP-751 ,871 ; IMC-A12; ANTI-IGF-IR Ab# A; BIIB-Gl l ; and C06.
  • Such a PBA may comprise an anti-ErbB3 binding site that is described herein.
  • a PBA may comprise one or more CDRs from a anti-ErbB3 antibody, e.g., anti-ErbB3
  • an anti-ErbB3 binding site for use in a PBA may comprise a VHCDR3 and/or VLCDR3 domain and optionally a VHCDR1 , VLCDR1 , VHCDR2 and/or VLCDR2 of any one of SEQ ID NOs: 336-353.
  • a PBA comprises an anti-ErbB3 binding site comprising 1 , 2, 3, 4, 5, or 6 CDRs comprising an aa sequence that differs from the corresponding one of one of SEQ ID NOs:336- 353 by 1 , 2 or 3 aa additions, deletions or substitutions, provided that the binding site binds specifically to its target.
  • a PBA comprises an anti-ErbB3 binding site comprising 1 , 2, 3, 4, 5 or 6 CDRS comprising an aa sequence that is at least 70%, 80%, 90% or 95% identical or similar to the corresponding CDR of one of SEQ ID NOs:336-353.
  • a PBA comprises a VH and/or a VL chain comprising an aa sequence of any one of SEQ ID NOs:336-353.
  • a PBA comprises a VH and/or VL chain that comprises an aa sequence that differs from any one of SEQ ID NOs:336-353 in at most 1 , 2, 3, 4, 5, 10, 15, 20, 25 or 30 aa deletions, additions or substitutions, provided that the binding site retains specific binding to its target, or which is at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to a sequence in SEQ ID NOs:336-353.
  • a PBA comprises a binding site comprising a light chain and/or a heavy chain comprising an aa sequence of SEQ ID NOs:336-353, or which differs from it in at most 1 , 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90 or 100 aa deletions, additions or substitutions, or which is at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to a sequence in SEQ ID NOs:336- 353, provided that the binding site binds specifically to its target,.
  • a PBA may comprise (i) a VH domain and a VL domain; (ii) a heavy chain and a light chain; or (iii) an scFv comprising the VH and VL chains, from an antibody selected from the group of antibodies consisting of anti-ErbB3 Ab# A; H3 (US Pat No 7,332,585), MM Ab#3; MM Ab#14; MM Ab#17 and MM Ab#19.
  • anti-ErbB3 binding sites or portions thereof, such as CDRs, V domains or chains
  • anti-ErbB3 antibodies 1 B4C3 catalog # sc-23865, Santa Cruz Biotechnology
  • 2D1D12 U3 Pharma AG
  • hybridoma cell lines DSM ACC 2527 or DSM ACC 2517 (deposited at DSMZ)
  • AV-203 SEQ ID NO: 190 (heavy chain)
  • SEQ ID NO:206 light chain
  • PBAs may comprise an anti-IGF-l R binding site that is described herein.
  • PBAs may also comprise a binding site that binds to the same epitope on human IGF-1R or human ErbB3 as the binding moieties provided herein, e.g., it may compete with binding moieties having sequences as of Fig.Figs. 5A and 5B.
  • Binding moieties encompassed herein may also compete for binding to antigen with a binding moiety described herein, e.g., it may compete with binding moieties having sequences as of Fig.Figs. 5A and 5B.
  • a binding protein comprising a binding moiety that competes with a binding moiety described herein for binding to a target antigen or epitope may be a binding moiety that is capable of displacing the binding moiety described herein when added to an ELISA before or after the binding moiety described herein.
  • PBAs provided herein do not include PBAs that are of PCT US2010/052712, in other embodiments PBAs provided herein do not include variable domains of PBAs that are of PCT7US2010/052712.
  • a PBA comprises two heavy chains, wherein each comprises an immunoglobulin CR.
  • the polyvalent binding domain may also comprise two light chains, wherein each light chain comprises a CL domain.
  • the immunoglobulin CR may be from a human Ig, e.g., a human IgGl , IgG2, IgG3 or IgG4, or from more than one isotype of immunoglobulin.
  • one domain may be from an IgGl
  • other domains may be from other IgG isotypes.
  • a portion of one domain is from one IgG isotype and the other domains are from another IgG isotype.
  • a heavy chain immunoglobulin CR which may comprise one or more of a CHI domain, a hinge, a CH2 domain, a CH3 domain, arid a CH4 domain, may comprise or consist of an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to a heavy chain immunoglobulin CR in a naturally occurring or wild type constant domain of a particular IgG isotype, e.g. , IgGl , or a CR of one of the aa sequences set forth herein.
  • a CL domain may also comprise or consist of a an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to a CL domain in a naturally occurring or wild type kappa or lambda light chain or a CL domain in one of the aa sequences set forth herein.
  • a heavy chain immunoglobulin CR which may comprise one or more of a CHI domain, a hinge, a CH2 domain, a CH3 domain, and a CH4 domain, may comprise exactly or at most 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11-15, 16-20, 21-25, 26-30, 31-35, 36-40, 41-45, 46-50, 50-100 or more aa substitutions, additions and/or deletions relative to the same heavy chain immunoglobulin CR in a naturally occurring or wild type constant domain of a particular IgG isotype, e.g. , IgGl , or relative to a heavy chain immunoglobulin CR set forth herein, e.g., in Fig.Figs. 5-7.
  • a CL domain may comprise exactly or at most 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1-15, 16-20, 21 -25, 26-30, 31-35, 36-40, 41 -45, 46-50, 50-100 or more aa substitutions, additions and/or deletions relative to a CL domain in a naturally occurring or wild type kappa or lambda light chain or a CL domain set forth herein.
  • Each domain of a CR i.e., a CHI domain, hinge, CH2 domain, CH3 domain and CL domain may comprise one or more (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more) aa substitutions, additions and/or deletions relative to a naturally occurring or wild-type constant domain of a particular IgG isotype, e.g. , IgG l, or a constant domain set forth herein.
  • Each domain of a CR i.e., a CHI domain, hinge, CH2 domain, CH3 domain and CL domain may comprise an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the same domain in a naturally occurring or wild type constant domain of a particular IgG isotype, e.g., IgGl, or a domain set forth herein.
  • Aa substitutions, additions or deletions may be spatially positioned relative to each other by an interval of at least 1 aa position or more, for example, at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 aa positions or more.
  • engineered aas are spatially positioned apart from each other by an interval of at least 5, 10, 15, 20, or 25 aa positions or more.
  • PBAs comprise a CR, e.g., an Fc region or domain thereof, comprising an aa sequence set forth herein.
  • PBAs comprise a CR, e.g., an Fc region or domain thereof, comprising an aa sequence set forth herein, wherein 1 or more aas have been deleted, added or substituted, or comprising an aa sequence that is at least about 80%, 90%, 95%, 97%, 98% or 99% identical to a sequence set forth herein.
  • aas 356 and 358 in the CH3 domain of SEQ ID NO:300 or any other aa sequence in Fig.Figs. 5 and 6 may be substituted, e.g., E356D and M358L, to mirror the wild type IgGl CH3 sequence. Any constant domain variant that represents any haplotype is also encompassed herein.
  • the effect of certain aa changes to a constant domain can be determined as further described herein or as known in the art.
  • Replacements of aa residues in the Fc portion to alter antibody effector function are known in the art (US Patent Nos. 5,648,260 and 5,624,821).
  • the Fc portion of an antibody mediates several important effector functions e.g., cytokine induction, ADCC, phagocytosis, complement dependent cytotoxicity (CDC) and half-life/ clearance rate of antibody and antigen- antibody complexes. In some cases these effector functions are desirable for a therapeutic antibody but in other cases might be unnecessary or even deleterious, depending on the therapeutic objectives.
  • Neonatal Fc receptors are the critical components determining the circulating half-life of antibodies.
  • at least one aa residue is replaced in the CR of the antibody, for example the Fc region of the antibody, such that effector functions of the antibody are altered.
  • the dimerization of two identical heavy chains of an immunoglobulin is mediated by the dimerization of CH3 domains and is stabilized by the disulfide bonds within the hinge region.
  • a PB A retains one or more of, and preferably all of the following attributes: antibody-dependent cellular cytotoxicity (ADCC) and antibody-dependent cellular phagocytosis (ADCP) that in humans are determined by interactions with activating FcyRI, FcyRIIa/c, FcyRIIIa and inhibitory FcyRIIb receptors; complement-dependent cytotoxicity (CDC) that is triggered by antibody binding to the components of the complement system; and long half-life that is mediated via active recycling by the neonatal Fc receptor (FcRn). All of these functions can be tuned to optimize the effectiveness of an anti-cancer therapy and are preferably retained in a PBA.
  • ADCC antibody-dependent cellular cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • CDC complement-dependent cytotoxicity
  • FcRn neonatal Fc receptor
  • a constant immunoglobulin region comprises an aa substitution, deletion or addition at an aa position that is within the " 15 Angstrom Contact Zone" of an Fc.
  • the 15 Angstrom Zone includes residues located at EU positions 243 to 261 , 275 to 280, 282-293, 302 to 319, 336 to 348, 367, 369, 372 to 389, 391 , 393, 408, and 424-440 of a full-length, wild-type Fc moiety.
  • a binding protein (e.g., a PBA, an anti-IgG-lR binding site and an anti-ErbB3 binding site) comprises an aa change (e.g., an aa substitution, addition or deletion) in an Fc domain that alters one or more antigen-independent effector functions of the domain, e.g. , the circulating half-life of a protein comprising the domain.
  • aa change e.g., an aa substitution, addition or deletion
  • Exemplary antibodies exhibit either increased or decreased binding to FcRn when compared to antibodies lacking such aa changes and, therefore, have an increased or decreased half-life in serum, respectively.
  • a binding protein with altered FcRn binding comprises at least one Fc domain having one or more aa changes within the "FcRn binding loop" of an Fc domain.
  • the FcRn binding loop is comprised of aa residues 280-299 (EU) of a wild-type, full-length, Fc.
  • a binding protein having altered FcRn binding affinity comprises at least one Fc domain having one or more aa substitutions within the 15 A FcRn "contact zone.”
  • the term 15 A FcRn "contact zone” includes residues at the following positions of a wild-type, full-length Fc domain: 243-261 , 275-280, 282- 293, 302-319, 336-348, 367, 369, 372-389, 391 , 393, 408, 424, 425-440 (EU).
  • a binding protein having altered FcRn binding affinity comprises at least one Fc domain (e.g, one or two Fc moieties) having one or more aa changes at an aa position corresponding to any one of the following EU positions: 256, 277-281 , 283-288, 303-309, 313, 338, 342, 376, 381 , 384, 385, 387, 434 (e.g., N434A or N434K), and 438.
  • Exemplary aa changes that alter FcRn binding activity are disclosed in International PCT Publication No. WO05/047327.
  • a binding protein comprises an Fc variant comprising an aa change that alters the antigen-dependent effector functions of the polypeptide, in particular ADCC or complement activation, e.g., as compared to a wild type Fc region.
  • said antibodies exhibit altered binding to an Fc gamma receptor (e.g., CD 16).
  • Fc gamma receptor e.g., CD 16
  • Such antibodies exhibit either increased or decreased binding to FcyRs when compared to wild type polypeptides and, therefore, mediate enhanced or reduced effector function, respectively.
  • Fc variants with improved affinity for FcyRs are anticipated to enhance effector function, and such proteins may have useful applications in methods of treating mammals where target molecule destruction is desired, e.g., in tumor therapy.
  • a binding protein comprises at least one altered antigen-dependent effector function selected from the group consisting of opsonization, phagocytosis, complement dependent cytotoxicity, antigen- dependent cellular cytotoxicity (ADCC), or effector cell modulation as compared to a binding protein comprising a wild type Fc region.
  • a binding protein exhibits altered binding to an activating FcyR (e.g., FcyRI, FcyRIIa, or FcyRIIIa).
  • a binding protein exhibits altered binding affinity to an inhibitory FcyR (e.g., FcyRIIb).
  • a binding protein having increased FcyR binding affinity comprises at least one Fc domain having an aa change at an aa position corresponding to one or more of the following positions: 239, 268, 298, 332, 334, and 378 (EU).
  • a binding protein having decreased FcyR binding affinity comprises at least one Fc domain having an aa substitution at an aa position corresponding to one or more of the following positions: 234, 236, 239, 241 , 251 , 252, 261 , 265, 268, 293, 294, 296, 298, 299, 301 , 326, 328, 332, 334, 338, 376, 378, and 435 (EU).
  • a binding protein having increased complement binding affinity comprises an Fc domain having an aa change at an aa position corresponding to one or more of the following positions: 251 , 334, 378, and 435 (EU).
  • a binding protein having decreased complement binding affinity comprises an Fc domain having an aa substitution at an aa position corresponding to one or more of the following positions: 239, 294, 296, 301 , 328, 333, and 376 (EU).
  • Exemplary aa changes that alter FcyR or complement binding activity are disclosed in International PCT Publication No. WO05/063815.
  • a binding protein may comprise one or more of the following specific Fc region substitutions: S239D, S239E, M252T, H268D, H268E, I332D, I332E, N434A, and N434K (EU).
  • a binding protein may also comprise an aa substitution that alters the glycosylation of the binding protein.
  • an immunoglobulin CR of a binding protein may comprise an Fc domain having a mutation leading to reduced glycosylation (e.g., N- or O-linked glycosylation) or may comprise an altered glycoform of the wild-type Fc domain (e.g., a low fucose or fucose-free glycan).
  • An "engineered glycoform” refers to a carbohydrate composition that is covalently attached to an Fc region, wherein said carbohydrate composition differs chemically from that of a parent Fc region. Engineered glycoforms may be useful for a variety of purposes, including but not limited to enhancing or reducing effector function.
  • Engineered glycoforms may be generated by a variety of methods known in the art (US 6,602, 684; US Pat Pub No. 2010-0255013; US Pat Pub No. 20030003097; WO 00/61739A1 ; WO 01/29246A1 ; WO 02/31 140A1 ; WO 02/30954A1) ; (PotelligentTM technology (Biowa, Inc., Princeton, NJ); and GlycoMAbTM glycosylation engineering technology (Glycart Biotechnology AG, Zurich, Switzerland).
  • an aa change e.g. , an aa substitution results in an Fc region comprising reduced glycosylation of the N-linked glycan normally found at aa position 297 (EU).
  • the Fc region may also comprise a low fucose or fucose free glycan at aa position 297 (EU).
  • the binding protein has an aa substitution near or within a glycosylation motif, for example, an N-linked glycosylation motif that contains the aa sequence NXT or NXS.
  • a binding protein comprises an aa substitution at an aa position corresponding to 297 or 299 of Fc (EU). Exemplary aa substitutions that reduce or alter glycosylation are disclosed in International PCT Publication No. WO05/018572 and US Pat Pub No. 2007011 1281.
  • a binding protein comprises at least one Fc domain having one or more engineered cysteine residues or analog thereof that are located at the solvent-exposed surface.
  • the engineered cysteine residue or analog thereof does not interfere with the desired biological activity of the binding protein.
  • the alteration does not interfere with the ability of the Fc to bind to Fc receptors (e.g., FcyRI, FcyRII, or FcyRIII) or complement proteins (e.g., Clq), or to trigger immune effector function (e.g., antibody-dependent cytotoxicity (ADCC), phagocytosis, or complement-dependent cytotoxicity (CDCC)).
  • ADCC antibody-dependent cytotoxicity
  • phagocytosis phagocytosis
  • CDC complement-dependent cytotoxicity
  • the antibodies comprise an Fc domain comprising at least one engineered free cysteine residue or analog thereof that is substantially free of disulfide bonding with a second cysteine residue.
  • the antibodies may comprise an Fc domain having engineered cysteine residues or analogs thereof at one or more of the following positions in the CH3 domain: 349-371, 390, 392, 394-423, 441-446, and 446b (EU).
  • the antibodies may comprise an Fc variant having engineered cysteine residues or analogs thereof at any one of the following positions: 350, 355, 359, 360, 361 , 389, 413, 415, 418, 422, 441 , 443, and EU position 446b.
  • Desired effector functions may also be obtained by choosing an Fc from a particular immunoglobulin class or subclass, or by combining particular regions from particular immoglobulin classes or subclasses, e.g. , IgGl, IgG2, etc.
  • an effectorless Fc may be constructed by combining the hinge and CH2 domain of IgG4 and the CH3 domain of IgGl .
  • Fab-arm exchange in proteins comprising an IgG4 hinge may be reduced by the substitution S228P in the hinge.
  • An immunoglobulin CR may also be modified by making changes, e.g., in the CH3 domains, referred to in the art as "knobs-into-holes" and described, e.g., in U.S. Pat. No.
  • Linkers may be used to connect two domains or regions together, e.g., a variable domain to a constant domain, a variable domain to a variable domain and a constant domain to a constant domain.
  • a linker connecting the VH domain of an scFv to the VL domain of the scFv is referred to as an "scFv linker.”
  • a linker connecting an scFv to a constant domain, e.g. , a CH3 domain, is referred to as a "connecting linker.”
  • Linkers are preferably of sufficient length to allow the proper folding of the domains or regions being connected.
  • a linker may be 1-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90 or at least 90-100 aas long.
  • a linker is biologically inert, e.g. , mostly incapable of inducing a biological response, e.g., an immune response.
  • a polypeptide linker may comprise or consist of a Gly-Ser linker.
  • Gly-Ser linker refers to a peptide that consists of glycine and serine residues.
  • An exemplary Gly-Ser linker comprises an aa sequence having the formula (Gly 4 Ser) exert (SEQ ID NO:395), wherein n is a positive integer (e.g. , 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, or 20).
  • a connecting linker comprises or consists of (Gly 4 Ser) 3 (SEQ ID NO:396) or (Gly 4 Ser) 4 (SEQ ID NO:397) or (Gly 4 Ser) 5 (SEQ ID NO:398).
  • an scFv linker comprises or consists of (Gly Ser) 3 or (Gly 4 Ser) 4 (SEQ ID NO: 397) or (Gly 4 Ser) 5 (SEQ ID NO: 398).
  • a linker may also comprise one or more additional aas located N-terminally or C-terminally to the (Gly 4 Ser) contend sequence.
  • an scFv linker may comprise 3 aas, e.g. , AST located N-terminally to the (Gly 4 Ser) n (SEQ ID NO:399) sequence (see, e.g., in the heavy chain sequence of 16F of Fig. 7 and as SEQ ID NO:300. In that sequence, the scFv linker consists of the aa sequence AST (Gly 4 Ser) 3 (SEQ ID NO:400).
  • a PBA inhibits growth of tumor cells in vitro.
  • an anti-ErbB3/anti-IGF-lR IgG2(scfv)2 PBA inhibited proliferation of two different tumor cell lines in 2D cultures, whereas either binding site alone did not significantly inhibit their proliferation.
  • PBAs inhibit in vitro tumor cell proliferation more potently (e.g., as measured by percent inhibition over a 6 day culture, e.g. , the culture described in Example 3(C)), than either of the binding sites alone.
  • Proliferation by a PBA may be inhibited by at least 10%, 20%, 30%, 40%, 50%, 60%, 70&, 80%, 90% or more, relative to proliferation of the cells in the absence of the PBA.
  • a PBA inhibits in vivo tumor cell proliferation. As shown in
  • an anti-ErbB3/anti-IGF- lR IgG2(scfv)2 PBA inhibited proliferation of two different tumor cell lines in a mouse model of cancer to a higher degree relative to that by the individual binding sites.
  • PBAs inhibit in vivo tumor cell proliferation more potently (e.g. , as measured by comparing tumor size at the end of the experiment, e.g., that described in Example 3(D)), than either of the binding sites alone.
  • Tumor growth by a PBA may be inhibited by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more, relative to tumor growth in the absence of the PBA.
  • Compared to either of the binding sites alone refers to a comparison with one or the other of the binding sites of a PBA, when that binding site comprises the same VRs as the those of the binding site in the PBA, and is, e.g., in the form of an antibody, e.g. , an IgGl antibody (as shown, e.g. , in the Examples).
  • an antibody e.g. , an IgGl antibody (as shown, e.g. , in the Examples).
  • a PBA inhibits signal transduction mediated through either or both of IGF-IR and ErbB3.
  • IGF-IR and ErbB3 As shown in Examples 3(B), 4 and 5(C), various PBAs inhibited signal transduction through IGF-IR and ErbB3, as measured by inhibition of phosphorylation of IGF-IR, ErbB3 and AKT.
  • PBAs can inhibit signal transduction to a similar or higher degree or extent relative to a prior art anti-IGF-lR antibody (ANTI-IGF- 1 R Ab# A - SEQ ID NO:327 for the HC and SEQ ID NO:328 for the LC) or anti-ErbB3 antibody (anti-ErbB3 Ab# A - SEQ ID NO:336 for HC and 337 for LC) or a combination thereof.
  • the percent reduction of levels of any one or combination of two or three of pIGF-lR, pErbB3 and pAKT is comparable to (e.g., within 1%, 5%, or 10%), greater than
  • the inhibition of phosphorylation (e.g., % inhibition) at the end of the experiment, e.g. , as described in the Examples, is comparable to, or higher, or lower than, that of a prior art anti- IGF-IR or anti-ErbB3 antibody or combination thereof.
  • a PBA inhibits phosphorylation of IGF-IR, ErbB3 and/or AKT by at least 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 98%, 99% or more, relative to phosphorylation in the absence of the PBA, when determined, e.g., at the end of the experiment, e.g. , as of the Examples.
  • Preferred PBAs inhibit IGF-IR and/or ErbB3 signal transduction, e.g., measured by inhibition of
  • Inhibition of a) ligand mediated phosphorylation of ErbB3, and b) IGF-1 - or IGF-2- mediated phosphorylation of IGF- IR respectively can be demonstrated by the ability of a PBA to reproducibly decrease the level of phosphorylation of a) ErbB3 induced by an ErbB family ligand (e.g., heregulin), b) IGF-IR induced by an IGF-IR ligand (i.e., IGF-1 or IGF-2), or c) AKT induced by an IGF-IR ligand or an ErbB3 ligand, each relative to the phosphorylation in control cells that are not contacted with the PBA.
  • an ErbB3 ligand e.g., heregulin
  • IGF-IR induced by an IGF-IR ligand
  • AKT induced by an IGF-IR ligand or an ErbB3 ligand
  • the cell which expresses ErbB3 and/or IGF- IR can be a naturally occurring cell or a cell of a cell line or can be recombinantly produced by introducing nucleic acid encoding ErbB3 and/or IGF-I R into a host cell.
  • the PBA inhibits an ErbB family ligand mediated phosphorylation of ErbB3 by at least about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, or more, as determined, for example, by Western blotting followed by probing with an anti-phosphotyrosine antibody as described in the Examples infra.
  • the PBA inhibits IGF- 1- or IGF-2-mediated phosphorylation of IGF-IR by at least about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, or more, as determined, for example, by Western blotting followed by probing with an anti-phosphotyrosine antibody as described in the Examples infra.
  • PBAs may suppress heregulin-induced pAKT signaling in a cell, e.g., a cancer eel, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100%.
  • PBAs may suppress IGF-1 -induced pAKT signaling in a cell, e.g., a cancer cell, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100%.
  • PBAs may suppress insulin-induced pAKT signaling in a cell, e.g., a cancer cell, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100%.
  • PBAs may suppress the IGF-2 -induced pAKT signaling in a cell, e.g., a cancer cell, by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%%, 97%, 98%, 99% or 100%. Inhibition of pAKT signaling may be determined as further described herein, e.g., in the Examples.
  • PBAs may inhibit ligand induced phosphorylation of IGF-IR by at least 70% or 80%, ligand induced phosphorylation of ErbB3 by at least 70% or 80% and optionally ligand induced phosphorylation of AKT by at least 30% or 40%. PBAs may also inhibit ligand induced phosphorylation of IGF-IR by at least 85%, ligand induced phosphorylation of ErbB3 by at least 85% and optionally ligand induced phosphorylation of AKT by at least 75%.
  • PBAs inhibit ligand induced phosphorylation of IGF-IR by at least 50% and ligand induced phosphorylation of ErbB3 by at least 90%, and optionally ligand induced phosphorylation of AKT by at least 30%, 40%, 50%, 60%, 70%, 80% or 90%.
  • PBAs may also be defined by the EC50 (i.e. the concentration of PBA at which 50% of maximum inhibition is obtained) of their inhibition of phosphorylation of one or more of IGF- 1 R, ErbB3 and AKT, which EC50s may be determined as further described herein.
  • PBAs disclosed herein may inhibit phosphorylation of IGF-IR with an EC50 of 10 "9 M, 10 I0 M or lower. They may inhibit phosphorylation of ErbB3 with an EC50 of 10 '9 M, 10 "10 M or lower. They may inhibit phosphorylation of AKT with an EC50 of 10 '7 M, 10 ⁇ 8 M, 10 "9 M, 10 " '°M or lower.
  • Some PBAs disclosed herein inhibit phosphorylation of IGF-IR by at least 80% or 85% with an EC50 of 10 "9 , 10 " '° M or lower; inhibit phosphorylation of ErbB3 by at least 80% or 85% with an EC50 of 10 "9 M, 10 "10 M or lower; and optionally inhibit
  • phosphorylation of AKT by at least 55% or 65% or 75% with an EC50 of 10 "7 M, 10 "8 M, 10 “9 M, 10 " '° M or lower. In some cases, essentially complete blockage of either or both of phosphorylation of IGF-1R and phosphorylation of ErbB3 will be obtainable with a PBA herein disclosed.
  • a PBA provided herein binds to cells expressing one or both of its targets (i.e., antigen(s) bound by the PBA) with an EC50 of from about 0.02nM or lower to about 10 nM, or with a Kd of about 10 s M, 10 '9 M, 10 "10 M, 10 " “ M, or 10 "12 M, or lower; each as measured, e.g., by flow cytometry using such cells expressing one or both of the target antigens of the PBA.
  • targets i.e., antigen(s) bound by the PBA
  • a PBA provided herein binds to its target(s) (e.g., either or both of human IGF-1 R and human ErbB3) with a Kd of about 10 "6 M, 10 "7 M, 10 '8 M, 10 '9 M, 10 " '° M, 10 "11 M, or 10 "12 M, or lower, as measured, e.g., by or by surface Plasmon resonance using a BIAcore apparatus.
  • a Kd of about 10 "6 M, 10 "7 M, 10 '8 M, 10 '9 M, 10 " '° M, 10 "11 M, or 10 "12 M, or lower, as measured, e.g., by or by surface Plasmon resonance using a BIAcore apparatus.
  • Example 5(A) shows that several other PBAs bind to BxPC-3 cells with an EC50 of about 2-5 nM.
  • Example 5(B) shows that several PBAs bind to ErbB3 with an EC50 of about 0.2-0.4 nM.
  • Other PBAs bind to BxPC-3 cells with an EC50 ranging from 0.02nM (e.g., P4-G1-P6) to about 1 nM or to about 2 nM.
  • a PBA binds an antigen (e.g., either ErbB3 or IGF-1R) with a dissociation constant (Kd) of 50 nM or less (i.e., a binding affinity at least as high as that indicated by a Kd of 50 nM) (e.g., a Kd of 40 nM or 30 nM or 20 nM or 10 nM or 1 nm, or 100 pM or 10 pM or 1 pM or less).
  • Kd dissociation constant
  • a PBA binds an antigen (either ErbB3 or IGF-1R) with Kd of 8 nM or better (e.g.
  • the binding protein, binding moiety or binding site binds an antigen (e.g.
  • Kd dissociation constant
  • PBAs may inhibit the binding of a ligand to IGF-1R and/or ErbB3.
  • PBAs may inhibit binding of a ligand to IGF-1R and/or ErbB3 by at least 70%, 80%, 90%, 95%, 97%, 98% or 99%, as measured, e.g., on cells or in vitro.
  • Certain PBAs inhibit the level of binding of a ligand to IGF-1R and/or ErbB3 when the ligand is added before or after the PBA.
  • a solution comprising PBAs at a concentration of 0.3, 0.5, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15 mg/ml or more (or ranges of concentrations between any of these two numbers) comprises more than 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% of PBAs in unaggregated form (referred to in this context as monomers) as determined e.g., by Size Exclusion Chromatography (SEC) e.g., following, a stability test as described below.
  • SEC Size Exclusion Chromatography
  • the percentage of monomers may be determined in a solution after one of the following stability tests: a) incubation at 4 °C for 1 , 2, 3, 4, 5, or 6 days, or 1, 2, 3 or more weeks; b) incubation at room temperature for 1 , 2, 3, 4, 5, or 6 days, or 1 , 2, 3 or more weeks; c) incubation at 37 °C for 1 , 2, 3, 4, 5, or 6 days, or 1 , 2, 3 or more weeks; d) 1 , 2, 3, 4 or 5 cycles of freeze/thaw, and e) agitation, e.g. , gentle agitation on the orbital shaker at room temperature, e.g., for 1 , 2, 3, 4, 5 or more hours.
  • a PBA exhibits a stability after 1 , 2, 3, 4 or 5 days of incubation in serum at 37°C of at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99%, relative to its stability at day 0, where the stability of a protein is determined by, e.g., measuring its ability to bind to one or more of its target antigens after incubation, as determined, e.g., by ELISA (see, e.g., Example 7).
  • a PBA has a melting temperature (Tm) as determined e.g. , by Differential Scanning Fluorimetry (DSF) of at least 50°C, 55°C, 60°C, 61 °C, 62°C, 63°C, 64°C, 65°C, 66°C, 67°C, 68°C, 69°C or 70°C, as described in the Examples.
  • Tm melting temperature
  • DSF Differential Scanning Fluorimetry
  • a PBA effectively inhibits signal transduction through IGF-1R and/or ErbB3 when the ligand is present at a high or a low concentration.
  • a PBA suppresses basal signaling, e.g., suppresses the level of pAKT present in a cell in the absence of ligand induction.
  • a PBA may also down-regulate IGF-1R and/or ErbB3, e.g., phosphorylated and/or non phoshorylated receptor, on the cell surface, e.g., by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more, relative to a cell that was not exposed to the PBA.
  • a PBA may also inhibit insulin signaling in cells, e.g. , by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more, relative to a cell that was not exposed to the PBA.
  • PBAs may have a stability of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 days in mouse or human serum.
  • PBAs may have a half-life of at least 10 hours, 20 hours, 30 hours, 40 hours, 45 hours, 50 hours, 60 hours, 70 hours, 80 hours, 90 hours, 100 hours, 1 10 hours, 115 hours or more in Cynomolgus monkeys when injected with either 5 or 25 mg/kg mice.
  • a PBA has a half-life that is statistically significantly longer, e.g., at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 100% (i.e., 2 fold), 150% or 200% longer, in an organism that is a mouse or a cynomolgus monkey than the half-life of another polyvalent bispecific ab in the same organism, binding to the same epitopes, wherein the orientation of antigen binding specificities is reversed between of the fab and of the scfv.
  • a PBA represses the protein level of mTOR or the level of phospho-mTOR, or reduces or inhibits mTOR activation (i.e., reduces levels of pmTOR), e.g., by about 50%, by 2 fold, 3 fold, 4 fold, 5 fold, or more relative to a monospecific anti-IGF-lR antibody that binds to the same epitope on IGF-1R as the PBA does.
  • PBAs may have a combination of two or more of the characteristics set forth herein.
  • a PBA may inhibit ligand induced phosphorylation of IGF-1R by at least 80% and ligand induced phosphorylation of ErbB3 by at least 80%, and also exhibit one or more of the following characteristics: (i) a Tm, as determined by DSF, of at least 60°C or 65°C; (ii) be at least 80%, 90% or 95% monomeric in PBS at 10 mg/mL after 5 days at at room temperature; (iii) and have a stability of at least 70%, 80% or 90% after 5 days of incubation in serum at 37°C.
  • PBAs have a Tm of at least 60°C and serum stability of at least 90%.
  • PBAs (i) inhibit growth of tumor cells, e.g., by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more; (ii) inhibit signal transduction mediated through IGF-1R and/or ErbB3, e.g., by at least 70%, 80%, 90% or more, (iii) are stable, e.g.
  • Tm as determined by DSF, of at least 50°C, 55°C, 60°C, 65°C or more; e.g., to a similar extent or more efficiently or potently than either binding entity alone or together.
  • Standard assays may be used for determining the biological activity and characteristics of anti-IGF-lR+anti-ErbB3 PBAs.
  • Exemplary assays for the following tests are provided herein in the Examples: (a) assays for determining the binding affinity or Kd of a binding site to its target; (b) assays for determining the ability of a binding protein to bind to a cell; (c) essays for determining the ability of a binding protein to inhibit signal transduction, by measuring inhibition of phosphorylation of IGF-1R, ErbB3 or AKT; (d) assays for determining the ability of a PBA to inhibit cell proliferation in vitro; (e) assays for determining the effect of a PBA on tumor cells in vivo; and (f) assays for determining the stability of a PBA.
  • monovalent and bivalent monospecific antibodies that are either 1) bivalent IgG antibodies that can be made by co-expression of at least one nucleic acid molecule encoding the heavy chain and at least one nucleic acid molecule, which may be the same as or different from the molecule encoding the heavy chain, that encodes the light chain of the antibody, or 2) monovalent single chain Fv (scFv) antibodies that can be made by expression of at least one nucleic acid molecule encoding the scFv; each expressed in a suitable expression system, as described herein, including commercially available expression systems and others that are well known in the art. These antibodies may be monoclonal.
  • an IGF-1R binding protein comprises a heavy chain and a light chain that associate with each other to form a binding moiety, e.g. , an antibody, or an antigen binding domain thereof.
  • a binding moiety e.g. , an antibody, or an antigen binding domain thereof.
  • the description provided herein applies to anti-IGF-lR antibodies, but also to anti-IGF-lR binding moieties that are comprised in PBAs. Conversely, the description of anti- IGF-1R binding moieties applies to anti-IGF-lR antibodies or to antigen binding sites thereof.
  • an anti-IGF-lR binding protein comprises 1, 2, 3, 4, 5, or 6 CDRs selected from the group consisting of a VHCDR1 aa sequence that is encompassed in the consensus sequence of SEQ ID NO:302, a VHCDR2 aa sequence that is encompassed in the consensus sequence of SEQ ED NO:303, a VHCDR3 aa sequence that is encompassed in the consensus sequence of SEQ ID NO:304, the VLCDR1 aa sequence of SEQ ED NO:305, a
  • an anti-IGF-lR binding protein may comprise 1, 2, 3, 4, 5, or 6 CDRs selected from the group consisting of a VHCDR1, VHCDR2 and VHCDR3 aa sequences in one of the aa sequences of Fig. 1, e.g. , any one of SEQ ED NOs:8-31 , and a VLCDR1 , VLCDR2 and VLCDR3 aa sequence in one of the aa sequences of Fig.
  • an anti-IGF-lR binding protein comprises a VH domain comprising 1 , 2, or 3, 4, 5, or 6 CDRs selected from the group consisting of a VHCDR1, VHCDR2 or VHCDR3 aa sequence of SEQ ED NO: 1 1 and a VLCDR1 , VLCDR2 and VLCDR3 aa sequence of SEQ ED NO:35 (CDRs of 16F).
  • an anti-IGF-lR binding protein comprises a VH domain comprising 1 , 2, 3, 4, 5, or 6 CDRs selected from the group consisting of a VHCDR1 , VHCDR2 and VHCDR3 aa sequences of a sequence in Fig. 1, e.g., SEQ ED NOs:8-10 and 12-31, and a VLCDR1 , VLCDR2 and VLCDR3 aa sequence that is of a sequence in Fig. 2, e.g., SEQ ED NOs:32-34 and 36-133.
  • an anti-IGF-lR binding protein comprises a VH domain comprising an aa sequence that is encompassed by the consensus sequence of SEQ ED NO: 1 and /or a VL domain comprising an aa sequence that is encompassed by the consensus sequence of SEQ ED NO:2.
  • VH aa sequences are those of Fig. 1 , e.g. , SEQ ED NOs:8-31.
  • an anti-IGF-lR binding protein comprises a VH aa sequence comprising SEQ ED NO: 1 1 and/or a VL aa sequence comprising SEQ ED NO:35 (variable domains of 16F).
  • an anti-IGF-lR binding protein comprises a VH domain comprising an aa sequence that is encompassed by the consensus sequence of SEQ ED NO: 1 and /or a VL domain comprising an aa sequence that is encompassed by the consensus sequence of SEQ ED NO:3.
  • VH aa sequences are those set forth as SEQ ED NOs:8-10 and 12-31.
  • VL aa sequences are those set forth as SEQ ED NOs:32-34 and 36-133.
  • anti-IGF-lR antibodies that bind specifically to IGF-1R, wherein the VH domain comprises an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the aa sequence of a VH aa sequence of Fig. 1 , e.g. , SEQ ED NOs:8-31 , and/or wherein the VL domain comprises an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the aa sequence of a VL aa sequence of Fig. 2, e.g. , SEQ ID NOs:32-133.
  • the VH sequence of SEQ ID NO: 1 1 and/or VL sequence of SEQ ID NO: 35 is excluded.
  • anti-IGF-lR antibodies that bind specifically to IGF-IR, wherein the VH domain comprises an aa sequence that differs in 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or in 1 -5, 6- 10, 1 1 - 15, 16-20, 21 -25, 26-30, 31 -35, 36-40, 41 -45, 46-50 or 50- 100 aa substitutions, additions or deletions from, an aa sequence of Fig.
  • VL domain comprises an aa sequence that differs in 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or in 1-5, 6-10, 1 1 -15, 16-20, 21-25, 26-30, 31-35, 36-40, 4145, 46-50 or 50-100 aa aa substitutions, additions or deletions from, an aa sequence of Fig. 2, e.g. , SEQ ID NOs:32-133.
  • the VH sequence of SEQ ED NO: 1 1 and/or VL sequence of SEQ ID NO:35 is excluded.
  • Anti-IGF-lR antibodies may have the structure of an antibody, e.g., a full length antibody, or an antigen binding fragment thereof.
  • an anti-IGF-lR binding protein may comprise a heavy chain and a light chain, wherein the heavy chain comprises a in N- to C- terminal order: a VH domain, a CHI domain, a hinge, a CH2 domain, a CH3 domain, and optionally a CH4 domain, and wherein the light comprises in N- to C-terminal order: a VL domain and a CL domain.
  • the constant domains are preferably human and may be from IgGl , IgG2, IgG3, IgG4 or a combination thereof.
  • the constant domains may be naturally occurring sequences or mutated sequences, wherein one or more aa substitution, addition or deletion has been made to the naturally occurring sequence(s).
  • An anti-IGF-lR binding protein may comprise a heavy chain comprising an aa sequence selected from the group consisting of SF heavy chain (SEQ ID NO:358); P4 heavy chain (SEQ ID NO:359); M78 heavy chain (SEQ ID NO:360) and M57 heavy chain (SEQ ID NO:361) (Fig. 6A).
  • An anti-IGF-l R binding protein may also comprise a light chain comprising an aa sequence selected from the group consisting of SF kappa light chain (SEQ ID NO:202); P4 kappa light chain (SEQ ID NO:204); M78 kappa light chain (SEQ ID NO:206); and M57 kappa light chain (SEQ ID NO:208) (Fig. 5A).
  • An anti-IGF-lR binding protein may comprise a heavy chain comprising an aa sequence selected from the group consisting of SF heavy chain (SEQ ID NO:358); P4 heavy chain (SEQ ID N0.359); M78 heavy chain (SEQ ID NO.360) and M57 heavy chain (SEQ ID NO:361) and a light chain comprising an aa sequence selected from the group consisting of SF kappa light chain (SEQ ID NO:202); P4 kappa light chain (SEQ ID NO:204); M78 kappa light chain (SEQ ID NO:206); and M57 kappa light chain (SEQ ID NO:208).
  • IGF-IR antibodies comprise a heavy chain and a light chain having aa sequences having the same name, e.g., an SF heavy chain and an SF light chain, a P4 heavy chain and a P4 light chain, a M78 heavy chain and a M78 light chain, and a M57 heavy chain and a M57 light chain.
  • heavy and light chains may also be mixed and matched.
  • an M57 heavy chain can be paired with a M7 light chain
  • a P4 heavy chain can be paired with an M57 light chain.
  • anti-IGF-l R IgG antibodies SF (heavy chain SEQ ID NO:358, kappa light chain SEQ ID NO:202); P4 (heavy chain SEQ ID NO:359, kappa light chain SEQ ID NO:204) M78 (heavy chain SEQ ID NO:360, kappa light chain SEQ ID NO:206) and M57 (heavy chain SEQ ID NO:361 , kappa light chain SEQ ID NO:208); all of the IgG l isotype.
  • an anti-IGF-lR binding protein comprises a heavy chain comprising an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to an aa sequence of SEQ ID NOs:358, 359, 360 and 361 and/or a light chain comprising an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to an aa sequence of SEQ ID NOs:202, 204, 206 and 208.
  • an IGF-1R binding protein comprises a heavy chain comprising an aa sequence that that differs in 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or in 1-5, 6- 10, 1 1-15, 16-20, 21-25, 26-30, 31-35, 36-40, 41-45, 46-50 or 50-100 aa substitutions, additions or deletions from an aa sequence of SEQ ID NOs:358, 359, 360 and 361 and/or a light chain comprises an aa sequence that differs in 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or in 1-5, 6-10, 11-15, 16-20, 21 -25, 26-30, 31-35, 36- 40, 41-45, 46-50 or 50-100 aa substitutions, additions or deletions from an aa sequence selected from the group consisting of SEQ ID NOs:202, 204, 206 and 208.
  • Anti-ErbB3 proteins may ligand-inhibit phosphorylation of ErbB3, proliferation of tumor cells and/or inhibition of tumor growth in vivo.
  • the anti-IGF-lR binding moieties may comprise, or be linked to, 1 , 2, 3, 4 or more other binding sites, which may be in the form of a Fab, an scFv or other form of binding site.
  • an anti-IGF-l R binding protein may comprise an anti-ErbB3 binding site, e.g., an anti- ErbB3 scFv.
  • an ErbB3 binding protein comprises a heavy chain and a light chain that associate with each other and form a binding protein, e.g. , an antibody, or an antigen binding domain thereof.
  • a binding protein e.g. , an antibody, or an antigen binding domain thereof.
  • the description provided below applies to anti-ErbB3 antibodies, but also to anti-ErbB3 binding sites that are comprised in PBAs. Conversely, the description of anti- ErbB3 binding sites applies to anti-ErbB3 antibodies or antigen binding sites thereof.
  • an anti-ErbB3 binding protein comprises 1 , 2, 3, 4, 5, or 6 CDRs selected from the group consisting of the VHCDR1 aa sequence of SEQ ID NO: 309, a VHCDR2 aa sequence that is encompassed in the consensus sequence of SEQ ID NO:310, a VHCDR3 aa sequence that is encompassed in the consensus sequence of SEQ ID NO:31 1 , the VLCDRl aa sequence that is of SEQ ID NO: 312, the VLCDR2 aa sequence that is of SEQ ID NO:313, and a VLCDR3 aa sequence that is encompassed in the consensus sequence of SEQ ID NO:314 (or 315).
  • an anti-ErbB3 binding protein may comprise 1, 2, 3, 4, 5, or 6 CDRs selected from the group consisting of a VHCDR1 , VHCDR2 and VHCDR3 aa sequence of a sequence in Fig. 3, e.g., in any one of SEQ ID NOs: 134-165, and a VLCDRl , VLCDR2 and VLCDR3 aa sequence of a sequence in Fig. 4, e.g., in SEQ ID NOs: 166-200.
  • an anti-ErbB3 binding protein comprises a VH domain comprising 1 , 2, or 3, 4, 5, or 6 CDRs selected from the group consisting of a VHCDR1 , VHCDR2 or VHCDR3 aa sequence of SEQ ID NO: 143 and a VLCDRl, VLCDR2 and VLCDR3 aa sequence of SEQ ID NO: 175 (CDRs of 16F).
  • an anti-ErbB3 binding protein comprises a VH domain comprising 1 , 2, 3, 4, 5, or 6 CDRs selected from the group consisting of a VHCDR1 , VHCDR2 or VHCDR3 aa sequence of Fig.
  • an anti-ErbB3 binding protein comprises a VH domain comprising an aa sequence that is encompassed by the consensus sequence of SEQ ID NO:4 and /or a VL domain comprising an aa sequence that is encompassed by the consensus sequence of SEQ ID NO:6.
  • Exemplary VH aa sequences are those of Fig. 3, e.g., SEQ ED NOs: 134-165.
  • Exemplary VL aa sequences are those of Table 4, e.g., SEQ ID NO: 166-200.
  • an anti-ErbB3 binding protein comprises a VH aa sequence comprising SEQ ID NO: 143 and/or a VL aa sequence comprising SEQ ID NO: 175 (variable domains of 16F).
  • an anti-ErbB3 binding protein comprises a VH domain comprising an aa sequence that is encompassed by the consensus sequence of SEQ ID NO:5 and /or a VL domain comprising an aa sequence that is encompassed by the consensus sequence of SEQ ID NO:7.
  • VH aa sequences are those set forth as SEQ ID NOs: 134-142 and
  • VL aa sequences are those set forth as SEQ ID NOs: 166-174 and 176-200.
  • anti-ErbB3 antibodies that bind specifically to ErbB3, wherein the VH domain comprises an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the aa sequence of a VH aa sequence of Fig. 3, e.g., SEQ ID NOs: 134- 165, and/or wherein the VL domain comprises an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to the aa sequence of a VL aa sequence of Fig. 4, e.g. , SEQ ID NOs: 166-200.
  • the VH sequence of SEQ ID NO: 143 and/or VL sequence of SEQ ED NO: 175 is excluded.
  • anti-ErbB3 antibodies that bind specifically to ErbB3, wherein the VH domain comprises an aa sequence that differs in 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or less of from 1-5, 6-10, 1 1-15, 16-20, 21-25, 26-30, 31-35, 36-40, 41-45, 46-50 or 50-100 aa substitutions, additions or deletions from, the aa sequence of Fig.
  • VL domain comprises an aa sequence that differs in 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or less of from 1-5, 6-10, 1 1-15, 16-20, 21-25, 26-30, 31-35, 36-40, 41-45, 46-50 or 50-100 aa substitutions, additions or deletions from, the aa sequence of Fig. 4, e.g. , SEQ ID NOs: 166-200.
  • the VH sequence of SEQ ID NO: 143 and/or VL sequence of SEQ ED NO: 175 is excluded.
  • Anti-ErbB3 antibodies may have the structure of an antibody, e.g., a holo-antibody (full length antibody) or an antigen binding fragment thereof.
  • an anti-ErbB3 binding protein may comprise a heavy chain and a light chain, wherein the heavy chain comprises a in N- to C-terminal order: a VH domain, a CHI domain, a hinge, a CH2 domain, a CH3 domain, and optionally a CH4 domain, and wherein the light comprises in N- to C-terminal order: a VL domain and a CL domain.
  • the constant domains are preferably human and may be from IgGl , IgG2, IgG3, IgG4 or a combination thereof.
  • the constant domains may be naturally occurring sequences or mutated sequences, wherein one or more aa substitution, addition or deletion has been made to the naturally occurring sequence(s).
  • An anti-ErbB3 binding protein may comprise a heavy chain comprising an aa sequence selected from the group consisting of PI heavy chain (SEQ ED NO:362); M27 heavy chain (SEQ ID NO:363); M7 heavy chain (SEQ ED NO:364) B72 heavy chain (SEQ ED NO:365) and B60 (SEQ ED NO:366) (Fig. 5B).
  • An anti-ErbB3 binding protein may also comprise a light chain comprising an aa sequence selected from the group consisting of PI lambda light chain (SEQ ED NO:258); M27 lambda light chain (SEQ ED NO:260); M7 lambda light chain (SEQ ED NO:262); B72 lambda light chain (SEQ ED NO:264) and B60 lambda light chain (SEQ ED NO:266) (Fig. 5B).
  • An anti-ErbB3 binding protein may comprise a heavy chain comprising an aa sequence selected from the group consisting of PI heavy chain (SEQ ED NO:362); M27 heavy chain (SEQ ED NO:363); M7 heavy chain (SEQ ED NO:364) B72 heavy chain (SEQ ED NO:365) and B60 (SEQ ED NO: 366) and a light chain comprising an aa sequence selected from the group consisting of PI lambda light chain (SEQ ED NO:258); M27 lambda light chain (SEQ ED NO:260); M7 lambda light chain (SEQ ED NO:262); B72 lambda light chain (SEQ ID NO:264) and B60 lambda light chain (SEQ ED NO:266).
  • PI heavy chain SEQ ED NO:362
  • M27 heavy chain SEQ ED NO:363
  • M7 heavy chain SEQ ED NO:364
  • B72 heavy chain SEQ ED NO:365
  • IGF-1R antibodies comprise a heavy chain and a light chain having aa sequences having the same name, e.g. , an PI heavy chain and an PI light chain, a M27 heavy chain and a M27 light chain, a M7 heavy chain and M7 light chain, a B72 heavy chain and a B72 light chain, and a B60 heavy chain and a B60 light chain.
  • heavy and light chains may also be mixed and matched.
  • an M57 heavy chain can be paired with a M7 light chain
  • a P4 heavy chain can be paired with an M57 light chain.
  • anti-ErbB3 antibodies PI (heavy chain SEQ ID NO:362, lambda light chain SEQ ID NO:258); M27 (heavy chain SEQ ID NO:363, lambda light chain SEQ ID NO:260); M7 (heavy chain SEQ ID NO:364, lambda light chain SEQ ID NO:262); B72 (heavy chain SEQ ID NO:365, lambda light chain SEQ ID NO:264); and B60 (heavy chain SEQ ID NO:366, lambda light chain SEQ ID NO:266); all of the IgGl isotype.
  • an anti-ErbB3 binding protein comprises a heavy chain comprising an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to an aa sequence of SEQ ID NOs:362,363, 364, 365 and 366 and/or a light chain comprising an aa sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical to an aa sequence of SEQ ID NOs:258, 260, 262, 264 and 266.
  • an ErbB3 binding protein comprises a heavy chain comprising an aa sequence that that differs in 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or in 1 -5, 6-10, 1 1-15, 16-20, 21 -25, 26-30, 31-35, 36-40, 41-45, 46-50 or 50-100 aa substitutions, additions or deletions from an aa sequence of SEQ ID NOs:362,363, 364, 365 and 366 and/or a hght chain comprises an aa sequence that differs in 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or in 1 -5, 6-10, 11-15, 16-20, 21 -25, 26-30, 31-35, 36-40, 41 -45, 46-50 or 50-100 aa substitutions, additions or deletions from an aa sequence selected from the group consisting of SEQ ID NOs:258, 260, 262, 264 and 266.
  • Anti-ErbB3 proteins may ligand-inhibit phosphorylation of ErbB3, proliferation of tumor cells and/or inhibition of tumor growth in vivo.
  • the anti-ErbB3 binding moieties may comprise, or be linked to, 1 , 2, 3, 4 or more other binding sites, which may be in the form of a Fab, an scFv or other form of binding site.
  • an anti-ErbB3 may be determined with assays, e.g., those described herein for PBAs.
  • Anti-ErbB3 proteins may ligand-inhibit phosphorylation of ErbB3, proliferation of tumor cells and/or inhibition of tumor growth in vivo.
  • the anti-ErbB3 binding moieties may comprise, or be linked to, 1 , 2, 3, 4 or more other binding sites, which may be in the form of a Fab, an scFv or other form of binding site.
  • an anti-ErbB3 may be determined with assays, e.g., those
  • binding protein may comprise an anti-IGF-lR binding site, e.g., an anti-IGF-lR scFv.
  • scFvs e.g. , isolated monoclonal scFvs.
  • Exemplary scFvs are anti- IGF-1R scFvs and anti-ErbB3 scFvs.
  • Exemplary scFvs are polypeptides comprising a VH domain and a VL domain that are linked together by an scFv linker. The VH and VL chains of an scFv are joined together by an scFv linker that is interposed between the VH and VL chains.
  • scFv linkers may consist of a contiguous aa sequence of 10-30 aa, such as 15 to 20 aa.
  • Exemplary scFv linkers are Gly-Ser linkers (SEQ ID NO:399),
  • scFv linkers comprise (Gly 4 Ser) 3 (SEQ ID NO:396) or (Gly 4 Ser) 4 (SEQ ID NO:397).
  • Other preferred scFv linkers comprise 1-5 aa in addition to (Gly 4 Ser) 3 (SEQ ID NO: 396) or (Gly 4 Ser) 4 (SEQ ID NO:397), e.g., AST, and may comprise the following aa sequence: AST(GlytrainingSer) 3 (SEQ ID NO:400) or AST(Gly 4 Ser) 4 (SEQ ID NO:402).
  • An anti-IGF-lR scFv antibody may comprise a VH domain comprising a set of three VHCDRs comprising VHCDRl , VHCDR2 and VHCDR3, and a VL domain comprising a set of three VLCDRs comprising VLCDRl , VLCDR2 and VLCDR3, said CDRs comprising the aa sequences of SEQ ID NOs:302, 303 or 304, 305, 306 or 307 (or 308), respectively, and wherein each CDR further comprises an amino terminus and a carboxy terminus, wherein the CDRs of each set of CDRs are arranged in the variable domain in a linear amino to carboxy order of CDR1 , CDR2 and CDR3, and wherein X aa in SEQ ID NOs:302, 304, 305, 306, 307 (or 308) represent variable aa, which may be any aa located in the corresponding position in Fig.
  • Anti-IGF-l R scFvs may comprise a VHCDRl , VHCDR2 and VHCDR3 of a VH domain consisting of an aa sequence of the group of VH aa sequences in Fig. 1 , e.g., consisting of SEQ ID NOs:8-31 , and/or a VLCDRl, VLCDR2 and VLCDR3 of a VL domain consisting of an aa sequence of the group of VL aa sequences in Fig. 2, e.g. , consisting of SEQ ID NOs:32-133.
  • an anti-IGF-lR scFv does not comprise all six CDRs of 16F or does not comprise either the VH domain of 16F and/or the VL domain of 16F.
  • an scFv comprises VH and VL aa sequences that differ from those in 16F in at least one aa.
  • Anti-IGF-lR scFv antibodies may comprise a VH domain comprising the aa sequence of SEQ ID NO: l and/or a VL domain comprising the aa sequence set forth SEQ ID NO:2 (or 3), wherein the X aas in SEQ ID NOs: 1, 2 and 3 are variable aa which may be any aa at the corresponding position in Fig. 1 (for the VH domain) and Fig. 2 (for the VL domain).
  • Anti-IGF- lR scFv antibodies may comprise a VH domain comprising an aa sequence of Fig.
  • a VL domain comprising an aa sequence of Fig. 2, e.g. , selected from the group consisting of SEQ ID NOs:32-133.
  • Exemplary anti-IGF-lR scFvs comprise a VH domain consisting of, or at least comprising the VHCDRl , VHCDR2 and VHCDR3 aa sequences of, an aa sequence selected from the group of VH aa sequences consisting of SEQ ID Nos:8, 9, 10 and 1 1 (the location of these CDRs is shown in Fig. 1).
  • Anti-IGF-lR scFvs may also comprise a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence selected from the group of VL aa sequences consisting of SEQ ID Nos:32, 33, 34 and 35 (the location of these CDRs is shown in Fig. 2).
  • anti-IGF-lR scFvs comprise a VH domain consisting of, or at least comprising the VHCDR l, VHCDR2 and VHCDR3 aa sequences of, an aa sequence selected from the group of VH aa sequences consisting of SEQ ID Nos:8, 9, 10 and 1 1 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence selected from the group of VL aa sequences consisting of SEQ ID Nos:32, 33, 34 and 35.
  • an anti-IGF-lR scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDRl , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No:8 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No:32 (M57 module).
  • an anti-IGF-lR scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDRl , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No:9 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No: 33 (module M78).
  • an anti-IGF-lR scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDRl , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 10 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No:34 (module P4).
  • an anti-IGF-lR scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDRl , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 8 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No:33 (module M57/M78).
  • VH domain comprising the VH domain consisting of, or at least comprising the VHCDRl , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 8 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No:33 (module M57/M78).
  • an anti-IGF-lR scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDRl , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 10 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No:32 (module P4/M57).
  • An anti-ErbB3 scFv antibody may comprise a VH domain comprising a set of three
  • VHCDRs comprising VHCDRl , VHCDR2 and VHCDR3, and a VL domain comprising a set of three VLCDRs comprising VLCDRl, VLCDR2 and VLCDR3, said CDRs comprising the aa sequences of SEQ ID NOs:309, 310 or 31 1 , 312, 313 or 314 (or 315), respectively, and wherein each CDR further comprises an amino terminus and a carboxy terminus, wherein the CDRs of each set of CDRs are arranged in the variable domain in a linear amino to carboxy order of CDR1 , CDR2 and CDR3, and wherein X aa in 309, 310 or 311 , 312, 313 or 314 (or 315) represent variable aa, which may be any aa located in the corresponding position in Fig.
  • Anti- ErbB3 scFvs may comprise a VHCDRl , VHCDR2 and VHCDR3 of a VH domain consisting of an aa sequence of the group of VH aa sequences in Fig. 3, e.g., consisting of SEQ ID NOs: 134-165 and/or a VLCDRl , VLCDR2 and VLCDR3 of a VL domain consisting of an aa sequence of the group of VL aa sequences in Fig. 4, e.g. , consisting of SEQ ID NOs: 166-200.
  • an anti-ErbB3 scFv does not comprise all six CDRs of 16F or does not comprise either the VH domain of 16F and/or the VL domain of 16F.
  • an scFv comprises VH and VL aa sequences that differ from those in 16F in at least one aa.
  • Anti-ErbB3 scFv antibodies may comprise a VH domain comprising the aa sequence of SEQ ID NO:4 (or 5) and/or a VL domain comprising the aa sequence set forth SEQ ID NO:6 (or 7), wherein the X aas in SEQ ID NOs:4, 5, 6 and 7 are variable aa which may be any aa at the corresponding position in Fig.
  • Anti- ErbB3 scFv antibodies may comprise a VH domain comprising an aa sequence in Fig. 3, e.g., selected from the group consisting of SEQ ED NOs: 134-165, and/or a VL domain comprising an aa sequence in Fig. 4, e.g., selected from the group consisting of SEQ ID NOs: 166-200.
  • Exemplary anti- ErbB3 scFvs comprise a VH domain consisting of, or at least comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of, an aa sequence selected from the group of VH aa sequences consisting of SEQ ID Nos: 134-143 (the location of these CDRs is shown in Fig. 3).
  • Anti-ErbB3 scFvs may also comprise a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence selected from the group of VL aa sequences consisting of SEQ ID Nos: 166-175 (the location of these CDRs is shown in Fig. 4).
  • anti-ErbB3 scFvs comprise a VH domain consisting of, or at least comprising the VHCDR1, VHCDR2 and VHCDR3 aa sequences of, an aa sequence selected from the group of VH aa sequences consisting of SEQ ID Nos: 134-143 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence selected from the group of VL aa sequences consisting of SEQ ID Nos: 166-175.
  • an anti-ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR1 ,
  • an anti-ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 135 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No: 167 (B72).
  • an anti-ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 136 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No: 168 (module M27).
  • an anti- ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR1, VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 137 and a VL domain consisting of, or at least comprising the VLCDRl, VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No: 169 (M7 module).
  • an anti-ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 138 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No: 170 (PI module).
  • an anti-ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR 1 , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 139 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No: 171 (M27 module).
  • an anti-ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR 1 , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 140 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No: 172 (B69 module).
  • an anti-ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR 1 , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 141 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No: 173 (P6 module).
  • an anti-ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR 1 , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 142 and a VL domain consisting of, or at least comprising the VLCDRl, VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No: 174 (Ml .3 module).
  • an anti-ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR1 , VHCDR2 and VHCDR3 aa sequences of, SEQ ID No: 143 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ID No: 175 (C8 module).
  • an anti-ErbB3 scFv comprises a VH domain comprising the VH domain consisting of, or at least comprising the VHCDR 1 , VHCDR2 and VHCDR3 aa sequences of, SEQ ED No: 136 and a VL domain consisting of, or at least comprising the VLCDRl , VLCDR2 and VLCDR3 aa sequences of, an aa sequence consisting of SEQ ED No: 169 (M27/M7 module).
  • Exemplary scFvs are anti-IGF-lR scFv antibodies P4 (SEQ ED NO:367), M57(SEQ ID NO:368), M78, (SEQ ED NO:369), and M76 (SEQ ED NO:382); as well as anti-ErbB3 scFv antibodies C8 (SEQ ED NO:370), PI (SEQ ED NO:371), Ml .3 (SEQ ED NO:372), M27 (SEQ ID NO:373), P6 (SEQ ED NO:374), B69 (SEQ ID NO:375) and P6L (SEQ ED NO:383).
  • scFvs may also comprise a CDR, a variable domain or their full length aa that differs from a CDR, variable domain, or full length scFv, respectively, set forth herein in one or more aa additions, deletions or substitutions, while retaining their binding properties.
  • a CDR may differ in 1 or 2 aa from a CDR sequence provided herein;
  • a variable domain may differ in 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 aa from a variable domain sequence provided herein;
  • an scFv may differ in 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40 or 50 aa from an scFv, respectively, provided herein.
  • An scFv may also comprise a CDR, a variable domain or its full length aa sequence that is at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to a sequence of a CDR, variable domain or full length scFv sequence provided herein.
  • an scFv comprises an aa sequence that is at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to an aa sequence selected from the group of scFv sequences consisting of SEQ ID NO:367, 368, 369, 370, 372, 373, 374, and 375.
  • scFvs comprise 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10 aas at the amino terminus or carboxy terminus of the VL domain.
  • carboxy terminus of an scFv of interest would be an aa that can be clipped off by an enzyme, such as a carboxypeptidase (e.g., a lysine or an arginine)
  • one or more aa may be added to prevent the aa from being clipped.
  • the aa "RT" from the CL domain may be added to the carboxy terminus "VEIK" in anti-IGF-lR scFvs, as shown, e.g. , in SEQ ID NOs:367-369.
  • nucleic acids e.g., DNA or RNA
  • exemplary nucleotide sequences provided herein are those encoding the aa sequences of Fig.Figs. 1-7, such as the nucleotide sequences of the Appendix, or portions thereof, such as portions that encode 1 , 2, 3, 4 or 5 domains.
  • Nucleotide sequences that are at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to a nucleotide sequence encoding an aa sequence set forth herein, e.g., the nucleotide sequences set forth herein are also encompassed.
  • nucleotide sequences may encode a protein set forth herein or may encode a protein that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98% or 99% identical or similar to a protein set forth herein or a portion thereof (e.g., a domain), such as an aa sequence of any one of Fig.Figs. 1-7.
  • a nucleotide sequence encoding the heavy chain of 16F with a leader sequence (aa sequence SEQ ID NO: 300) is set forth as SEQ ID NO: 299.
  • a nucleotide sequence encoding the light chain of 16F with a leader sequence (aa sequence SEQ ID NO:298) is set forth as SEQ ID NO:297.
  • a nucleic acid encodes the heavy and/or the light chain of an antibody that comprises a leader sequence (or signal peptide).
  • a leader sequence is that shown in Fig. 7 for 16F.
  • antibodies e.g., those shown in Fig.Figs. 5 and 6, linked to a leader sequence, such as that shown in Fig. 7, and nucleic acids encoding such.
  • a nucleic acid is linked to a sequence that enhances or promotes the expression of the nucleotide sequence in a cell to produce a protein.
  • Such nucleic acids may be encompassed within a vector, e.g., an expression vector.
  • a signal sequence e.g. , the one of Fig. 7A, which signal sequence is frequently deleted to form a mature protein.
  • cells e.g. , a host cell comprising a nucleic acid or a vector provided herein.
  • the antibodies described herein may be produced by recombinant means. Methods for recombinant production are widely known in the state of the art and comprise protein expression in prokaryotic and eukaryotic cells with subsequent isolation of the antibody and usually purification to a pharmaceutically acceptable purity.
  • Methods for recombinant production are widely known in the state of the art and comprise protein expression in prokaryotic and eukaryotic cells with subsequent isolation of the antibody and usually purification to a pharmaceutically acceptable purity.
  • nucleic acids encoding the respective polypeptides e.g. , light and heavy chains, are inserted into expression vectors by standard methods.
  • Expression is performed in appropriate prokaryotic or eukaryotic host cells like CHO cells, NSO cells, SP2/0 cells, HEK293 cells, COS cells, PER.C6 cells, yeast, or E.coli cells, and the binding protein is recovered from the cells (supernatant or cells after lysis).
  • prokaryotic or eukaryotic host cells like CHO cells, NSO cells, SP2/0 cells, HEK293 cells, COS cells, PER.C6 cells, yeast, or E.coli cells
  • the binding protein is recovered from the cells (supernatant or cells after lysis).
  • General methods for recombinant production of antibodies are well-known in the art.
  • the antibodies may be suitably separated from the culture medium by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
  • DNA and RNA encoding the antibodies are readily isolated and sequenced using conventional procedures.
  • the hybridoma cells can serve as a source of such DNA and RNA.
  • the DNA may be inserted into expression vectors, which are then transfected into host cells such as HEK 293 cells, CHO cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of recombinant antibodies in the host cells.
  • Aa sequence variants ⁇ e.g., mutants) of the antibodies may be prepared by introducing appropriate nucleotide changes into the antibody DNA, or by nucleotide synthesis.
  • “Host cell” denotes any kind of cellular system which can be engineered to generate the antibodies described herein.
  • HEK293 cells and CHO cells are used as host cells, in another CHO or NSO cells are used.
  • control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
  • Eukaryotic cells are known to utilize promoters, enhancers and polyadenylation signals.
  • a nucleic acid is "operably linked" when it is placed in a functional relationship with another nucleic acid sequence.
  • DNA for a pre-sequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a pre-protein that participates in the secretion of the polypeptide;
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • "operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory , leader, contiguous and in reading frame. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
  • Purification of antibodies may be performed in order to eliminate cellular components or other contaminants, e.g., other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis, and others well known in the art.
  • affinity chromatography with microbial proteins e.g., protein A or protein G affinity chromatography
  • ion exchange chromatography e.g., cation exchange (carboxymethyl resins), anion exchange (amino ethyl resins) and mixed- mode exchange
  • thiophilic adsorption e.g., with beta-mercaptoethanol and other SH ligands
  • hydrophobic interaction or aromatic adsorption chromatography e.g., with phenyl-sepharose, aza-arenophilic resins, or m-aminophenylboronic acid
  • metal chelate affinity chromatography e.g., with Ni(II)- and Cu(II)-affinity material
  • size exclusion chromatography e.g., and electrophoretical methods (such as gel electrophoresis, capillary electrophoresis).
  • an anti-IGF- lR+anti-ErbB3 PBA an anti-IGF-lR antibody and an anti-ErbB3 antibody
  • the antibodies disclosed herein can be used for treating a disease or disorder associated with ErbB3 and/or IGF-IR dependent signaling, including a variety of cancers.
  • a method for inhibiting proliferation of a tumor cell expressing IGF-IR and ErbB3 comprising contacting the tumor cell with an anti-IGF-lR+anti- ErbB3 bispecific (optionally polyvalent) antibody, such that proliferation of the tumor cell is inhibited, slowed down, or stopped or such that the tumor cell dies.
  • a method for treating a subject having a proliferative disease comprises administering to a subject in need thereof a therapeutically effective amount of one or more antibodies described herein, such as an anti-IGF-lR+anti-ErbB3 bispecific antibody.
  • a method for (or a bispecific antibody e.g., in a medicament for) treating a tumor expressing IGF-1R and ErbB3 in a patient comprising administering an effective amount of an antibody as described herein (e.g., effective to slow or stop tumor growth, or to shrink a tumor or to slow or stop tumor invasiveness or tumor metastasis).
  • an antibody as described herein e.g., effective to slow or stop tumor growth, or to shrink a tumor or to slow or stop tumor invasiveness or tumor metastasis.
  • Any tumor expressing IGF-1R and ErbB3 may be treated, including tumors of the following cancers: lung cancer, sarcoma, colorectal cancer, pancreatic cancer, prostate cancer, renal cell carcinoma, head and neck squamous cell carcinoma (HNSCC), melanoma and breast cancer.
  • HNSCC head and neck squamous cell carcinoma
  • tumors include: non-small cell lung cancer, Ewing's sarcoma, tamoxifen-resistant estrogen-receptor-positive breast cancer, trastuzumab-resistant or lapatinib-resistant HER2-positive metastatic breast cancer, gefitinib-resistant or erlotinib- resistant lung cancer, cetuximab-resistant or panitumumab-resistant colorectal cancer, cetuximab-resistant head and neck squamous cell carcinoma (HNSCC), and erlotinib-resistant pancreatic cancer.
  • non-small cell lung cancer Ewing's sarcoma
  • tamoxifen-resistant estrogen-receptor-positive breast cancer trastuzumab-resistant or lapatinib-resistant HER2-positive metastatic breast cancer
  • gefitinib-resistant or erlotinib- resistant lung cancer cetuximab-resistant or panitumumab-resistant colorectal cancer
  • kits comprising one or more antibodies disclosed herein.
  • the kits may include a label indicating the intended use of the contents of the kit and optionally including instructions for use of the kit in treating a disease or disorder associated with ErbB3 and/or IGF- 1R dependent signaling, e.g., treating a tumor.
  • the term label includes any writing, marketing materials or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
  • a method of treating a tumor herein provided can further comprise administering a second anti-cancer agent in combination with the antibody.
  • novel pharmaceutical compositions comprising an antibody disclosed herein, together with a second anti-cancer agent, typically a biologic agent, together with at least one pharmaceutically acceptable carrier or excipient.
  • compositions for treatment of a tumor in a patient, as well as methods of use of each such composition to treat a tumor in a patient.
  • the compositions provided herein contain one or more of the antibodies disclosed herein, formulated together with a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
  • the carrier is suitable for intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g. , by injection or infusion).
  • the antibody may be coated in a material to protect it from the action of acids and other natural conditions that may inactivate proteins.
  • Pharmaceutical compositions may be administered alone or in combination therapy, i.e., combined with other agents.
  • the combination therapy can include an antibody of the present disclosure with at least one additional therapeutic agent, such as an anti-cancer agent.
  • Pharmaceutical compositions can also be administered in conjunction with another anti-cancer treatment modality, such as radiation therapy and/or surgery.
  • composition of the present disclosure can be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results.
  • the antibody may be administered to a patient in an appropriate carrier, for example, in liposomes, or a diluent.
  • suitable diluents include saline and aqueous buffer solutions.
  • Liposomes include water-in-oil-in-water CGF emulsions as well as conventional liposomes.
  • Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any excipient, diluent or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions provided herein is contemplated.
  • Supplementary active compounds e.g., additional anti-cancer agents
  • compositions typically must be sterile and stable under the conditions of manufacture and storage.
  • the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • Saline solutions and aqueous dextrose and glycerol solutions can be employed as liquid carriers, particularly for injectable solutions.
  • the composition if desired, can also contain minor amounts of wetting or solubility enhancing agents, stabilizers, preservatives, or pH buffering agents.
  • isotonic agents for example, sodium chloride, sugars, polyalcohols such as mannitol, sorbitol, glycerol, propylene glycol, and liquid polyethylene glycol in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • HRG refers to the isoform of heregulin known as heregulin 1 beta 1 (sometimes referred to as HRG1 -B, HRG- ⁇ , neuregulin 1, NRG1 , neuregulin 1 beta 1 , NRGl-bl , or HRG ECD) e.g. , R&D Systems, 377-HB-050/CF.
  • IGF-1 refers to insulin-like growth factor 1 , e.g., R&D Systems, 291-GI-050/CF.
  • mouse anti-human-IGF-lR monoclonal antibody mAb391 (IgGl, R & D Systems MAB391) is used as an anti-IGF-lR IgG antibody control.
  • Example 1 Rational engineering of antibody therapeutics targeting multiple signaling pathways
  • the ErbB pathway has long been the focus of cancer research due to the high expression of the ErbB receptors in specific cancer types: HER2/ErbB2 is gene amplified in some breast cancers, and EGFR/ErbBl is highly expressed in colon cancers and NSCLC.
  • HER2/ErbB2 is gene amplified in some breast cancers
  • EGFR/ErbBl is highly expressed in colon cancers and NSCLC.
  • monoclonal antibody agents e.g., cetuximab and trastuzumab
  • small molecule tyrosine kinase inhibitors e.g., , erlotinib, , lapatinib.
  • the complexity of the ErbB network combined with the ability to measure the abundance and activation state of key components, lends the network to computational modeling.
  • computational modeling a number of biological phenomena can be well described, such as the dimerization-dependence of receptor trafficking, control of signal amplification through feedback loops and ligand-dependence of signal propagation.
  • a network model was built to describe the activation of the PI3K/AKT pathway in response to the ligands betacellulin and heregulin, which selectively activate EGFR/ErbB l or ErbB3 heterodimers, respectively.
  • the mechanistic model represented the processes of: ligand binding; receptor dimerization; receptor trafficking and signal propagation, with a series of reactions defined by mass-action kinetics.
  • mechanistic models In order to make reliable predictions, mechanistic models have to be first trained using temporal and dose-dependent experiments that capture key dynamic events, specifically the activation of the ErbB receptors and PI3K AKT pathway. Network components with the greatest influence were identified by sensitivity analysis, where each component of the network is subtly perturbed and the relative contribution to the downstream output is assessed (Fig. 9B).
  • mechanistic modeling can be also used to determine optimal therapeutic design characteristics.
  • optimization simulations of a therapeutic monoclonal antibody explored several design characteristics, such as binding to ErbB3, preventing heregulin binding, and blockade of dimerization, with a special focus on blocking ligand-induced EGFR/ErbB3 dimerization.
  • Simulation was used to determine the affinity required to achieve maximal inhibition of AKT phosphorylation through simulation of inhibitors within a range of dissociation rate constants. From this simulation, a 1 nanomolar affinity was predicted to be sufficient for maximal inhibitor potency, with higher affinity inhibitors displaying only limited improvement (Fig. 9C).
  • a bispecific antibody designed to inhibit two cell surface growth factor receptors (IGF-1R. ERBB3) with a single binding moiety directed towards each target
  • bispecific proteins bind their targets in a manner dependent on the affinity for each target, avidity-enhanced crosslinking ability and the relative abundance of each target; the added complexity of a bispecific interacting with a biological system creates an even greater opportunity to utilize mechanistic modeling to guide engineering efforts.
  • Designing a bispecific optimized for potent inhibition also requires knowledge of the affinity of competing ligands and dimerization partners, if such exist, as well as the relative strength of each target in activating common downstream signaling cascades and subsequent cell growth and survival mechanisms.
  • the desirable apparent Kd can be achieved through multiple rounds of affinity and avidity improvements, and the simulation model can guide engineering efforts towards the most suitable molecular format and streamlined optimization route. Simulation can be used to explore the performance of a bispecific protein concept for permutations of target affinity, avidity and target expression levels.
  • IgG-like bispecific antibodies have two binding moieties towards each target and therefore exhibit same-target avidity in addition to cross-target avidity, improving the effective binding affinity for each target.
  • Simulation of the IgG-like bispecific antibody that has monovalent binding affinities equal to the bivalent bispecific protein shows that this format is less dependent on cross-target avidity for performance:
  • the region of optimal potency is broader than the monovalent bispecific. Therefore, if the goal is to treat a broad patient population the model prediction would be to use an IgG-like bispecific design.
  • affinity maturation of antibody function in improving the region of optimal potency can also be examined through simulation. Simulating downstream target inhibition across the receptor space by a non-optimal tetravalent bispecific identifies areas of poor inhibition, particularly when IGF- 1 R is more highly expressed. Increasing the monovalent binding affinity of the bispecific towards IGF- IR by 10-fold through lowering the dissociation rate predicts the improvement affinity maturation would achieve. The downstream target is inhibited significantly more potently both where the IGF-IR is more highly expressed and where the ErbB3is more highly expressed indicating that affinity maturation towards one target is enhancing the potency towards the second target through cross-target avidity.
  • IgG-like bispecific therapeutic protein that showed potent inhibition of growth-factor induced signaling and tumor inhibition in xenograft models validating the design criteria.
  • This protein comprised an IgG antibody framework directed at IGF-1R and two C-terminally fused scFv modules directed at ErbB3, but was not suitable for downstream development, as it contained unstabilized scFv modules that do not have sufficient intrinsic stability.
  • yeast surface display and micro scale biophysical characterization was used.
  • Structure-guided scFv variants were designed where stability enhancing mutations were introduced, motifs conferring potential CMC liabilities were mutated, atypical framework aas were removed or replaced, and variation in low diversity portions of the CDRs was introduced. Since yeast cells have eukaryotic posttranslational modification and polypeptide export machinery, surface expression levels that were reported to predict thermal stability and soluble secretion efficiency were monitored. In addition a thermal challenge "cook-and-bind" protocol was developed.
  • scFvs fused to the yeast surface were challenged and clones were selected based on the residual affinity measured by a flow cytometry (Fig. 1 IB).
  • Thermostable scFv modules that showed over 10-fold improvement in Kd on the yeast surface were produced as soluble proteins and those showing improved antigen binding, inhibition of growth factor signaling, and acceptable stability were selected.
  • These optimized scFv modules were C-terminally fused to the IGF-R1 antibody.
  • the resulting IgG-like proteins were expressed in a transient expression system, purified using protein A chromatography, and profiled using biophysical, biochemical, and cell signaling assays.
  • biophysical, biochemical, and cell signaling assays were found to be most informative at the 1 to 5 microgram scale.
  • Micro-scale triage composed of differential scanning fluorescence profiling and thermal inactivation assays allow the selection of bispecifics with improved serum and aggregation stabilities.
  • Differential scanning fluorescence profiling and thermal inactivation assays give complementary information on the rate of unfolding and the rate of aggregation for the least stable protein domain.
  • ELI-7 anti-ErbB3-anti-IGF-lR IgG2 tetravalent bispecific proteins
  • ELI-7, ILE-10 and ILE-12 have the structure IgG2(scFv) 2 .
  • ELI-7 is an anti-ErbB3/anti-IGF-lR IgG2 tetravalent bispecific protein comprising an anti-ErbB3 IgG2 antibody, to which an anti-IGF-lR scFv is linked to each of the C-termini of the heavy chains of the IgG2 protein.
  • ILE-10 and ILE-12 are anti-IGF-lR/anti-ErbB3 IgG2 tetravalent bispecific proteins comprising an anti-IGF-lR IgG2 antibody, to which an anti-ErbB3 scFv is linked to each of the C-termini of the heavy chains of the IgG2 protein.
  • ILE-10 and ILE- 12 differ only in the sequence of the ErbB3 scFv.
  • ILE-10 and ELI-7 comprise the same anti- IGF-1 R and anti-ErbB3 VH sequences, and differ in that ILE-10 has an IGF-1 R Fab and an ErbB3 scFv (“ILE") and ELI-7 has the opposite configuration (“ELI").
  • the control antibodies are monospecific and each comprises a binding site homologous to ones found in the bispecific antibodies.
  • Heavy chain of ELI-7 SEQ ID NO:316.
  • Light chain of ELI-7 SEQ ID NO:317.
  • Heavy chain of ILE-10 SEQ ID NO:318.
  • Heavy chain of ILE-12 SEQ ID NO:319.
  • Light chain of ILE-10 and IL-12 SEQ ID NO:320.
  • fusion proteins The nucleic acids encoding the proteins (referred to as "fusion proteins") are cloned as single proteins into the expression plasmids using standard recombinant DNA techniques.
  • An expression vector employed is pMP 10 (SELEXIS).
  • Expression plasmids are linearized, purified using QIAquick® purification kit (QIAGEN), and co-transfected into CHO cells using LipofectamineTM LTX (Invitrogen). Transfected cells are recovered with F12Hams medium containing 10% FBS for 2 days without selection pressure, then with selection pressure for 4 days. After 4 days, they are changed into serum-free medium (Hyclone) containing glutamine with selection pressure. After a week, cells are checked for expression and scaled up to desired volume.
  • All proteins are purified using a combination of three chromatography steps: protein A affinity, cation exchange and anion exchange. Each is carried out in accordance with the manufacturer's instructions.
  • the protein A affinity step is used to selectively and efficiently bind the fusion proteins out of harvested cell culture fluids (HCCF). This removes >95% of product impurities in a single step with high yields and high throughput.
  • the portion of desired molecular form for fusion proteins after this step was in the range of 60 to 98 percent.
  • MABSELECT from GE is used as the Protein A affinity resin.
  • SPFF sulphopropyl fast flow
  • agarose based resin is used as the cation exchange resin in the second
  • Example 3 Binding and biological activity of anti-ErbB3+anti-IGF-lR IgG tetravalent bispecific proteins
  • This Example shows that an anti-IGF-lR + anti-ErbB3 IgG tetravalent bispecific protein (ELI-7) binds with high affinity to IGF-IR and to ErbB3 (as also shown for two similar proteins ILE-10 and ILE-12), potently inhibits 1) signal transduction from the IGF-IR and ErbB3 receptors, 2) AKT phosphorylation, and 3) tumor cell proliferation in vitro and in vivo. Results were obtained essentially as follows. A) Binding of ELI-7, ILE-10 and ILE-12 to IGF-1R and ErbB3
  • IgG-bispecifics i.e. ELI-7, DLE-lO, ILE-12 bound to both cell types, in some cases with greater binding at low concentrations, indicating avid binding and the ability to bind to each receptor.
  • the IgG-bispecifics had a similar Kd to the equivalent monoclonal antibody component.
  • ELI-7 and ILE-7 to antagonize IGF-1R and ErbB3 and inhibit activation (phosphorylation) of downstream components, IGF-1R, ErbB3 and Akt; phosphorylation is examined.
  • 3.5x 10 4 BxPC-3 cells are pre-incubated for 1 hour with an antibody at 0.3 ⁇ , followed by 9 subsequent 3-fold dilutions to give a 10-point curve.
  • Cells are treated with IGF-1 at 80 ng/ml and heregulin at 20 ng/ml for 15 minutes.
  • Phosphorylation of IGF-1R to yield phospho-IGF-lR is measured by ELISA (R & D Systems; Cat.# DYC1770) to evaluate the ability of the agents to inhibit pIGF-lR formation.
  • Phosphorylation of ErbB3 is measured by ELISA (R & D Systems; Cat.#DYC1769) to evaluate the ability of the agents to inhibit pErbB3 formation.
  • Phosphorylation of AKT is measured by ELISA using the following antibodies: anti-AKT, clone SKB l (Millipore, Cat.#05-591); biotinylated anti-phospho-AKT (Ser 73 -specific; Cell Signaling Technology Cat.#5102).
  • ILE-7 is a trivalent protein having the same binding sites as ELI-7 and described in PCT/US2010/052712.
  • Figs. 15A-15C show the results that were obtained essentially as described above for CLE-7 and ELI-7. The results that were obtained are also summarized in the table below.
  • ELI-7 The effect of ELI-7 on tumor cell proliferation is examined in vitro using a CTG assay, which is a luminescence-based assay that measures the amount of cellular ATP present (Promega; Cat.# PR-G7572), indicated as Relative Light Units (RLU).
  • 500 cells per well of DU145 cells are incubated for 6 days in medium with 80 ng/ml IGF-1 and 20 ng/ml HRG and containing a 3-fold dilution of inhibitors starting at 2uM.
  • the control consists of DU145 cells incubated without growth factors or antibodies.
  • This example shows that ELI-7 inhibits tumor growth in mouse models of cancer in two different models.
  • mice 600ug of ELI-7 or 500ug of each HSA-linked trivalent control protein (ILE-3, ELE-7, and ILE-9; described in PCT US2010/052712) was injected via tail vein into each mouse (4 mice per inhibitor and time point). Blood was drawn at various time points thereafter (mice were first sacrificed and then blood was drawn by cardiac puncture). Time points for ELI-7 are: 0.5, 4, 24, 72, 120, 168 and 240 hours. Time points for trivalent control proteins are: 0.5, 4, 8, 24, 28, 72, and 120 hours.
  • ELI-7 blood concentration is measured using an anti-human IgG ELISA kit (Bethyl labs Cat.# E80-104) according to the manufacturer's instructions.
  • concentration in the blood is measured using an ELISA kit that detects IGF-IR and ErbB3 binding specifically, plates are coated with His-tagged human IGF-IR, incubated with the trivalent proteins or ELI-7, then detected with a human ErbB3-Fc (R&D Systems) and an anti- Fc-HRP detection reagent.
  • Pharmacokinetic properties (half-life and Cmax) for each protein are calculated using a one-compartment model. The following results were obtained:
  • ELI-7 The effect of ELI-7 on human pancreatic cancer xenograft tumor growth in mouse models was then assessed by injecting 5 x 10 6 BxPC-3 cells (resuspended in a 1 : 1 mixture of PBS and growth factor-reduced matrigel; BD Biosciences Cat.# 354230) into the subcutaneous space in the flank of each mouse. Tumors were allowed to develop for 7 - 10 days (until they reached a volume of approximately 100-200 mm 3 ), and then tumor size was measured for each mouse (pi/6 x length x width 2 , where width is the smallest measurement). Mice were then size- matched and then randomly assigned into treatment groups.
  • ELI-7 a trivalent control protein (ILE-7), an anti-ErbB3 antibody, an anti-IGF-lR antibody or a PBS control was then injected every 3 days until the completion of the study.
  • ELI-7 significantly inhibited the xenograft tumor growth of BxPC-3 tumors compared to the PBS control: final tumor volume was 77% lower in ELI-7 treated tumors compared to the PBS control (p values determined by student's T- test). Day 0 refers to the first day of dosing.
  • ELI-7 The effect of ELI-7 on human prostate cancer xenograft tumor growth in a mouse model was assessed by injecting 5 x 10* DU145 cells (resuspended in a 1 : 1 mixture of PBS and growth factor-reduced matrigel; BD Biosciences Cat.# 354230) into the subcutaneous space in the flank of each mouse. Tumors were allowed to develop for 7 - 10 days (until each reached a volume of approximately 100-200 mm 3 ), and then tumor size was measured for each mouse (pi/6 x length x width 2 , where width is the smallest measurement). Mice were then tumor-size-matched and then randomly assigned into the treatment groups.
  • ELI-7 a trivalent control protein (ILE-7), an anti- ErbB3 antibody, an anti-IGF-lR antibody or a PBS control was then injected every 3 days until the completion of the study.
  • Figs. 20A and 20B show that ELI-7 significantly inhibited xenograft tumor growth of DU145 cells, whereas the control anti-IGF-lR and anti-ErbB3 antibodies did not: the final tumor volume was 50% lower in ELI-7 treated tumors compared to the PBS control (p values determined by student's T-test). Day 0 refers to the first day of dosing.
  • BxPC-3 cell receptor levels are varied by shRNA-mediated knockdown of IGF-1R or ErbB3 in BxPC-3 cells using the pLKO. l PURO vector (Sigma).
  • the shRNA sequences are provided in PCT US2010/052712. ErbB3 and IGF-1R levels are then measured by quantitative FACS and the mean receptor levels are calculated from the resulting distribution (see Table 1 1 for relative expression levels).
  • ELI-7 To determine the potency of ELI-7, cells are serum-starved and pretreated with ELI-7 for 1 hour at 37°C, followed by a 15-minute stimulation with 20ng/ml HRG + 80ng/ml IGF1. Signal inhibition is assessed by ELISA for pAKT.
  • ELI-7 displayed similar potency across the BxPC-3 cells lines with modified receptor levels as indicated by their IC50 values and overlapping confidence intervals (see Table 11), indicating that ELI-7 has broad activity against a range of receptor profiles (Fig. 21).
  • Table 1 1 Relative receptor levels and pAkt IC50 values for four BxPC-3 cell lines: Engineered % of control pAkt IC50 95% Confidence Sigma-Aldrich BxPC-3 cell line receptor level Interval Catalog #
  • Example 4 Biological activity of an anti-IGF-lR/anti-ErbB3 tetravalent bispecific protein with enhanced activities (16F) relative to ELI-7
  • the proof of concept protein (ELI-7) described in Examples 2 and 3 was further improved to increase its binding affinity to IGF-1R and ErbB3, biological activity, stability and solubility; as described in Example 1.
  • the following changes were made: (i) the orientation was switched from anti-ErbB3 as the IgG component to anti-IGF-lR as the IgG component; (ii) an anti-ErbB3 binding moiety binding to a different epitope was used; (iii) its CDR3 VH region was affinity matured; (iv) the anti-IGF-lR IgG component was mutated to stabilize it (stabilizing mutations) and (v) its backbone was switched from IgG2 to IgGl .
  • the resulting protein is 16F, whose aa sequences are of Fig. 7.
  • the potency of inhibition of signal transduction through ErbB3 and through inhibition of AKT phosphorylation is measured essentially as described in Example 3 for 16F, ELI-7 and a combination of ANTI-IGF-1R Ab# A (ganitumab; SEQ ID 327 + SEQ ID 328) and anti-ErbB3 Ab# A (SEQ ID 336 + SEQ ID 337). These measurements are carried out in BxPC-3 cells in the presence of HRG and IGF1. The results that were obtained essentially as described above,
  • 16F is more thermal and serum stable than ELI-7.
  • 16F is less prone to aggregation: (i) 16F is stable at 19 mg/ml in PBS at 4°C, with only about 2% aggregation in 33 days; (ii) no significant change in % monomers was observed after 3 freeze thaw cycles; (iii) no significant change in % monomers was observed after shaking at 4°C for one day; and (iv) no significant change in % monomers was observed on incubation at 37°C for 6 days.
  • the effectiveness of 16F (SF-G1-C8) in inhibiting the phosphorylation IGF-1R, ErbB3 or AKT was compared to that of the Anti-IGF-lR Ab#B (cixutumumab; SEQ ID 324 + SEQ ID 325), Anti-ErbB3 Ab# A (SEQ ID 336 + SEQ ID 337) or Anti-IGF-lR Ab#B + Anti-ErbB3 Ab# A in two different cell lines (BxPC-3 and DU145).
  • BxPC-3 and DU145 cells are maintained in RPMI-1640 medium supplemented with 10% fetal bovine serum, Penicillin Streptomycin and L-glutamine.
  • 3.5 x 10 4 cells are plated in complete medium in 96-well tissue culture plates. The following day, complete medium is replaced with serum-free medium, and cells are incubated overnight at 37°C.
  • Cells are pretreated for 1 hour with the indicated doses of antibody, and then stimulated for 15 minutes with lOOng/ml IGF-1 (Calbiochem) and 30ng/ml HRG (R&D Systems). Cells are washed with PBS and lysed in MPer buffer supplemented with protease and phosphatase inhibitors.
  • ELISAs for phospho-IGF-l R (pIGF-lR) and phospho-ErbB3 (pErbB3) are preformed according to the manufacturer's protocols (R&D Systems).
  • An ELISA for phospho-AKT is preformed according to the manufacturer's protocols (R&D Systems).
  • An ELISA for phospho-AKT is preformed according to the manufacturer's protocols (R&D Systems).
  • pAKT is performed with the following reagents: anti-AKT capture antibody (Millipore), anti- pAKT (Ser473) detection antibody (Cell Signaling), and streptavidin-HRP (R&D Systems).
  • anti-AKT capture antibody Millipore
  • anti-pAKT Ser473 detection antibody
  • streptavidin-HRP R&D Systems
  • SUPERSIGNAL ELISA PICO chemiluminescent substrate (Pierce) is added and plates read on a PerkinElmer EnVision® plate reader. Luminescence values are plotted and IC50 values calculated using Graphpad Prism 5 software.
  • Table 13 IC50 values for inhibitor treatments presented in Fig. 23.
  • Table 14 IC50 values for inhibitor treatments presented in Fig. 24.
  • Example 5 Binding and biological activity of additional anti-IGF-lR/anti-ErbB3 IgG tetravalent bispecific antibodies comprising the SF module
  • Each of these PBAs was assembled by combining three modules, essentially as shown in Figure 8.
  • Each PBA comprises a pair of heavy chain fusion polypeptides (each comprising at least a part of each of the three modules), each member of the heavy chain pair being bound to the other and each further being bound to one of a pair of light chains.
  • the three modules assembled into each PBA are:
  • an N-terminal (amino terminal) Fab variable domain module comprising both (essentially identical) light chains and the N-termini of both heavy chains;
  • HC IgG CR module interposed between the N-terminal Fab variable domain module and the scFv module.
  • the heavy chains being fusion polypeptides comprise the heavy chain portion of the N- terminal Fab module, an IgG CR module and the C-terminal scFv module.
  • each PBA that was built comprises a fusion protein comprising a pair of essentially identical heavy chain polypeptides, each comprising a combination, in N-terminal to C-terminal (amino to carboxy) order, of each Fab module named in the left column with an IgGl CR (Gl) and with any one scFv module named in the right column of the same Table.
  • the aa sequences of the heavy and light chains of these additional PBAs are of Fig. 5A (anti-IGF-lR+anti-ErbB3) and Fig. 5B (anti-ErbB3 and anti-IGF-lR).
  • Table 15 Anti-IGF-lR-anti-ErbB3 proteins
  • BxPC-3 cells bind ErbB3, inhibit IGF-1R, ErbB3 and AKT phosphorylation, and are stable. Results obtained with the other proteins are of Example 6.
  • Binding of SF-G1 -P1 , SF-G1-P6, SF-G 1 -M27, SF-G1-B69, SF-G1 -M 1.3 and SF-G 1 -C8 (16F) to BxPC-3 was measured essentially as follows.
  • BxPC-3 cells are maintained in RPMI-1640 medium supplemented with 10% fetal bovine serum, Penicillin/Streptomycin and L-glutamine. Medium was removed and the BxPC-3 cells were washed with PBS. Trypsin is added until the cells detached from the plate, and then neutralized with medium + 10% serum. The cells are spun down and resuspended in FACS buffer (IX PBS + 2% Serum + 0.1 % Azide ). Aggregates are broken down into single cells by pipetting up and down and putting the cells through a cell strainer. The cells are spun down and resuspended in FACS buffer at a density of 2 x 10 6 cells / ml. In a 96 well conical bottom plate, 50ul of cell suspension is aliquotted per well to give 10 5 cells / well.
  • FACS buffer IX PBS + 2% Serum + 0.1 % Azide
  • Antibodies are diluted to luM in FACS buffer, and 10 3-fold dilutions are done, with a final well consisting of FACS buffer only (no primary antibody). 50ul of antibodies are added to 50ul of cells so that the highest final antibody concentration is 500nM in the first well. Cells and antibodies are incubated at room temperature with gentle agitation for 2 hrs. The plates are spun at 1 ,500 RPM for 5 min, and the supernatant is removed. Pellets are washed three times in FACS buffer. After the final wash the FACS buffer is removed, and 50ul of ant-Fc-DyLight 649 secondary antibody (Abeam) added at 1 : 100 in FACS buffer.
  • Table 17 EC50 values for bispecific antibody binding presented in Fig. 25.
  • 96-well REACTI-BIND plates (Pierce) are coated with 50ul of ErbB3-His (ErbB3 with a C-terminal hexa-histidine tag - 2ug/ml in PBS) ("hexa-histidine” disclosed as SEQ ID NO:403) and incubated overnight at 4°C. The next day plates are washed with PBS + 0.05% Tween-20 (PBS-T) and blocked for lhr. at room temperature with lOOul of Protein-Free Blocking Buffer (Pierce). Plates are washed with PBS-T and 50ul of each bispecific antibody is added in duplicate.
  • PBS-T PBS + 0.05% Tween-20
  • PBS-T Protein-Free Blocking Buffer
  • Concentrations start at 500nM (in PBS-T) and include ten additional two-fold dilutions and one blank (PBS-T only). Plates are incubated at room temperature for two hours and then washed with PBS-T. 50ul of anti-Fc-HRP (Jackson Labs) is added at 1 :40,000 in PBS- T, and plates are incubated in the dark for lhr. at room temperature. Plates are again washed with PBS-T and lOOul of TMB substrate (Thermo Scientific, TMB and peroxide solution mixed 1 : 1) added.
  • the plates are incubated for 5-15 minutes at room temperature until a blue color develops, and the reaction is stopped with lOOul of STOP solution (Cell Signaling Technology).
  • STOP solution Cell Signaling Technology
  • the absorbance was read at 450nm on a PerkinElmer Envision plate reader, and binding curves were generated with GraphPad PRISM, using a log (agonist) vs response (three parameter) non- linear regression curve fit.
  • Table 18 EC50 values for bispecific antibody binding presented in Fig. 26.
  • BxPC-3 cells are maintained in RPMI-1640 media supplemented with 10% fetal bovine serum, Penicillin/Streptomycin and L-glutamine.
  • 3.5 x 10 4 cells are plated in complete medium in 96-well tissue culture plates. The following day, complete medium is replaced with serum- free medium, and cells incubated overnight at 37°C.
  • Cells are pretreated for 1 hour with the indicated doses of drug, and then stimulated for 15 minutes with lOOng/ml IGFl (Calbiochem) and 30ng/ml HRG (R&D Systems). Cells are washed with PBS and lysed in MPer buffer ("Mammalian Protein Extraction Reagent" Pierce Thermo Scientific) supplemented with protease and phosphatase inhibitors.
  • ELISAs for phospho-IGFIR phospho-ErbB3 (pErbB3) and phospho-AKT (pAKT) are preformed as described in Example 4, above.
  • Relative luminescence units RLU were plotted and IC50 values calculated using Graphpad Prism 5 software.
  • SF-G1 -P1 SF-G1-P6, SF-G1- 27, SF-G1-B69, SF-G1 -M1.3 are stable in serum, are thermally stable, and are stable at low pH.
  • the proteins are incubated in mouse serum (Sigma) at a final concentration of 2.5uM for either 0 hr or 72 hrs at 37°C.
  • the samples are then assayed using the colorimetric ELISA binding assay described above, and binding curves are generated with GraphPad Prism. Absorbance values are normalized to 0 hr at the inflection point of each curve to determine the percent binding retained after 72 hrs in serum at 37°C.
  • EC90 values were calculated for each PB A using the binding curves generated in the ELISA binding experiment described above.
  • Each PBA is prepared at 5X its EC90 value in PBS and transferred to PCR plates (Bio-Rad) at 50ul per well. The plates are spun down and placed in the ICYCLER IQ gradient PCR machine (Biorad) to heat the antibodies for 1 hr from 47-72°C. Aliquots of each antibody are also kept at 25°C and 37°C for 1 hr. The plates are then spun down at 2,000 RPM for 5 minutes, and supematants are diluted five-fold in PBS-T to their EC90 concentration. The samples are then assayed using the colorimetric ELISA binding assay described above, and absorbances are normalized to 25°C. Binding curves were generated with GraphPad Prism to determine T 50 values.
  • Table 20 T 50 values for each bispecific antibody incubated at 25-72°C for 1 hr
  • the temperature at which the PBAs unfold was determined by Differential Scanning Fluorimetry (DSF).
  • DSF assay is performed in the IQ5 Real Time Detection System (Bio Rad). 20 ⁇ 1 solutions of 15uM bispecific antibody, lx Sypro Orange (Invitrogen Life).
  • Table 21 T m values for each bispecific antibody, as determined by DSF
  • SF-G1 -C8 stock solution is diluted into 0.1 M acetic acid (pH 3.0) and incubated for 1 hour. The solution is then neutralized with 1 Tris Base, dialyzed against PBS and concentrated. The dialysate is tested by SEC (Size Exclusion Chromatography) and colorimetric ELISA against a sample of SF-G1 -C8 neutralized immediately after protein A purification. SEC is performed using Agilent 1 100 Series HPLC system. 50ug of SF-G1-C8 is injected on a TSK Super SW3000 gel column (Tosoh Biosciences, P N 18675). PBS is used as running and equilibration buffer at a flow rate of 0.35 ml/min. The ELISA is performed as described above, coating the plates with either recombinant IGFIR-His or ErbB3-His.
  • SF-G1-C8 For determining the stability of SF-G1 -C8 for an extended time at 4°C, SF-G1-C8 (19mg/ml) was incubated in PBS at 4°C for either 1 , 6 or 33 days and subjected to SEC. Percent monomer was determined by SEC as described above. The results indicate that SF-G1-C8 displays 98% stability after 33 days at 4°C.
  • Binding of PBAs to BxPC-3 cells is determined as follows. BxPC-3 cells are maintained in RPMI-1640 media supplemented with 10% fetal bovine serum, Penicillin/Streptomycin and L-glutamine. Medium is removed and the BxPC-3 cells are washed with PBS. Trypsin is added until the cells detached from the plate, and is then neutralized with media + 10% serum. The cells are spun down and resuspended in FACS buffer (IX PBS + 2% Serum + 0.1 % azide). Aggregates are broken down into single cells by pipetting up and down and putting the cells through a cell strainer.
  • FACS buffer IX PBS + 2% Serum + 0.1 % azide
  • the cells are spun down and resuspended in FACS buffer at a density of 1 x 10 6 cells / ml. In a 96 well conical bottom plate, 50ul of cell suspension is aliquotted per well to give 5 x 10 4 cells / well.
  • PBAs are diluted to 2uM in FACS buffer, and 10 3-fold dilutions are done, with a final well consisting of FACS buffer only (no primary antibody).
  • 50ul of the serially diluted antibodies are added to 50ul of cells so that the highest final antibody concentration is l uM in the first well.
  • Cells and antibodies are incubated at room temperature with gentle agitation for 2 hrs. The plates are spun at 1 ,500 RPM for 5 min, and the supernatant removed. Pellets are washed three times in FACS buffer. After the final wash the FACS buffer is removed, and 50ul of anti-Fc-DyLight 649 secondary antibody (Abeam) is added at 1 : 100 in FACS buffer.
  • Abeam anti-Fc-DyLight 649 secondary antibody
  • Inhibition of cell signaling by PBAs is determined essentially as follows. BxPC-3 cells are maintained in RPMI-1640 media supplemented with 10% fetal bovine serum,
  • Penicillin/Streptomycin and L-glutamine 3.5 x 10 4 cells are plated in complete medium in 96- well tissue culture plates. The following day, complete medium is replaced with serum-free medium, and cells are incubated overnight at 37°C. Cells are pretreated for 1 hour with the indicated doses of drug, and then stimulated for 15 minutes with lOOng/ml IGFl (Calbiochem) and 30ng/ml HRG (R&D Systems). Cells are washed with PBS and lysed in MPer buffer supplemented with protease and phosphatase inhibitors.
  • ELISAs for phospho-IGFIR phospho-ErbB3 (pErbB3) and phospho-AKT (pAKT) are performed as described in Example 4, above.
  • ILE-10 14F or 14f)
  • ELI-7 5F or 5f » both of which are described above, are used as reference proteins.
  • Table 23 IC50 values and percent inhibition values for inhibitor treatments shown in Figs. 30, 31 and 32
  • the level of inhibition of ligand-induced signal transduction by the PBAs was compared to that obtained with prior art anti-IGF-lR (anti-ErbB3 Ab# A - SEQ ID NO:336 for HC and 337 for LC) and prior art anti-ErbB3 (ANTI-IGF-1R Ab# A - SEQ ID NO:327 for the HC and SEQ ID NO:328 for the LC) antibodies.
  • prior art anti-IGF-lR anti-ErbB3 Ab# A - SEQ ID NO:336 for HC and 337 for LC
  • prior art anti-ErbB3 ANTI-IGF-1R Ab# A - SEQ ID NO:327 for the HC and SEQ ID NO:328 for the LC
  • Serum stability results indicate that the PBAs display some differences in serum stability. The lowest stability was about 65% and the hightest stability was about 100%. Those that have a number of about 1 (or above) are considered to have about 100% stability.
  • M27/M7 refers to a binding site having an M27 heavy chain and an M7 light chain.
  • Example 9 Potent inhibition of dual IGFl- and HRG-stimulated signaling by anti- EGFlR-anti+ErbB3 BPAs
  • IGFl and HRG-stimulated signal transduction in DU145 and BxPC-3 cells IGFl and HRG-stimulated signal transduction in DU145 and BxPC-3 cells.
  • Results were obtained essentially as follows. 35,000 BxPC-3 cells are plated in 10% , serum overnight at 37 °C. The following day, cells are starved in media containing 0.5% serum and incubated overnight at 37 °C. Cells were pretreated for one hour with the indicated concentrations of Ab, and then stimulated for 15 minutes with 30ng/ml HRGlbl-ECD + lOOng/ml IGFl .
  • control anti-IGFIR and anti- ErbB3 mAb are ANTI-IGF-1R Ab# A and anti-ErbB3 Ab# A, respectively.
  • Cells are lysed in M-Per buffer (+ protease/phosphatase inhibitors) and run on ELISA for pAKT.
  • pAKT ELISA assay plates are coated with anti-AKT (Millipore), blocked with PBS+2%BSA, incubated with lysates and standards, and detected with a biotinylated anti-pAKT (Ser473) and streptavidin-HRP.
  • ELISA pico chemiluminescent substrate is added and plates are read on a Perkin-Elmer Envision plate reader. All IC50 curves and calculated values are generated in Graphpad Prism.
  • Results were obtained essentially as follows. BxPC-3 cells are infected with lentivirus expressing a control hairpin, or with shRNA specific to IGFIR or ErbB3 (Sigma) that reduces expression of these proteins by about 50%. Knockdown is confirmed by FACS and Western blot analysis. Cells are plated and treated as described in Example 9. Levels of pAKT are determined as described in Example 9. The results, (Fig.
  • PBAs M7-G1-M78, P4-G1 -M1.3, P4- G1-C8 and SF-G1-C8 potently inhibit signal transduction induced by IGF-1 and HRG in BxPC- 3 cells having high or lower levels (50% reduced levels) of IGF1R or ErbB3, as determined by measuring phosphorylated AKT (pAKT).
  • BPAs are indicated with “Gl” in Table 27.
  • M7-M78 refers to "M7-G1-M78.”
  • Example 11 Anti-EGFlR+anti-ErbB3 PBAs are potent inhibitors of low dose or high dose IGFl- or HRG-induced signaling
  • BxPC-3 cells are plated in 10% serum overnight at 37 °C. The following day, cells are starved in media containing 0.5% serum and incubated overnight at 37 °C. Cells are pretreated for one hour with the indicated concentrations of PBA, and then stimulated for 15 minutes with either low (40ng/ml) or high (400ng/ml) IGFl , or low (20ng/ml) or high (200ng/ml) HRGlbl -ECD.
  • ELISA for pErbB3, pIGFIR, and tIGFIR are from commercial sources (R & D Systems).
  • pAKT ELISA assay plates are coated with anti-AKT (Millipore), blocked with PBS+2%BSA, incubated with lysates and standards, and detected with a biotinylated anti-pAKT (Ser473) and streptavidin- HRP.
  • ELISA pico chemiluminescent substrate is added and plates are read on a Perkin-Elmer Envision plate reader. All IC50 curves and calculated values are generated in Graphpad Prism. The results, (Figs.
  • PBAs M7-G1-M78, P4-G1 - M1.3, P4-G1-C8 and SF-G 1-C8 potently inhibit signal transduction induced by higher or lower levels of IGF-1 and HRG in BxPC-3 cells, as determined by measuring pAKT (pAKT), pIGF- 1 R and pErbB3 levels.
  • Results were obtained essentially as follows. 35,000 BxPC-3 cells are plated in 10% serum overnight at 37°C. The following day, cells are starved in media containing 0.5% serum and incubated overnight at 37°C. Cells are pretreated for either 15 minutes or 24 hours in the presence of the indicated concentration of Ab, but in the absence of ligand stimulation. Cells are lysed in M-Per buffer (+ protease/phosphatase inhibitors) and run on ELISA for pAKT, as described in Example 9.
  • Results were obtained essentially as follows. 35,000 BxPC-3 cells are plated in 10% serum overnight at 37°C. The following day, cells are starved in media containing 0.5% serum and incubated overnight at 37°C. Cells are then incubated for 24 hours in media containing 0.5% serum and the indicated concentrations of antibody (starting at a high dose of 5E-07M with subsequent 3-fold dilutions). Cells are lysed and total IGF1R is measured by ELISA using a commercial kit from R&D Systems. Percent downregulation is calculated from Prism using the following formula: 100*((fit.max-min.observed)/(fit.max-no stimulation).
  • P4-G1-C8 reduce the level of IGF1R in A549 and BxPC-3 cells.
  • Example 14 Anti-EGFlR+anti-ErbB3 BPAs inhibit both IGF1 and IGF2 mediated signaling
  • results were obtained essentially as follows. 500,000 DU145 and Mia PaCa-2 cells per well are plated in 12-well plates overnight in 10% serum. On day 2 cells are serum starved overnight. On day 3 antibody pre-incubations are performed for 1 hr (250nM P4-G1-M1.3 or P4-G1-C8) and growth factors (IGF1 or IGF2 at lOOng/ml) are added for 15 minutes prior to lysis. All cells are washed with PBS and lysed in lOOul of MPer buffer supplemented with protease and phosphatase inhibitors.
  • B-Actin was used at 1 :5,000, Phospho-Akt at 1 :2,000, and all others at 1 : 1 ,000. The following day membranes are washed 3 x 5 minutes each with TBS-T and then incubated with anti-Rabbit IgG - DyLight800 (Cell Signaling) at 1 : 15,000 in 5% milk in TBS-T for 1 hour at room temperature. Membranes are then washed 3 x 5 minutes each with TBS-T and scanned using the Licor Odyssey system (Licor Biosciences). Integrated intensities are calculated and normalized to Beta-Actin levels. The results, (Fig. 45), show that BPAs P4-G1 -M1.3 and P4-G1-C8 inhibit AKT phosphorylation induced by either IGF1 or IGF2.
  • results were obtained essentially as follows. 500,000 DU145 cells per well are plated in 12-well plates overnight in 10% serum. On day 2 cells are serum starved overnight. On day 3 Ab pre-incubations are performed for 1 hr (500nM P4-G1-M1.3) and growth factors (IGF1 at lOOng/ml or Insulin at 5ug/ml) are added for 15 minutes prior to lysis. Lysates and Western blots are prepared as described in Example 14.
  • This Example shows that anti-EGFlR+anti-ErbB3 BPAs downregulate ErbB3 and IGF1R levels on cells that are either induced by IGF1 and HRG or not induced.
  • Example 17 Anti-EGFlR+anti-ErbB3 BPAs display stability in human, mouse and monkey serum
  • This Example shows that anti-EGFlR+anti-ErbB3 BPAs are stable in human, mouse and monkey serum.
  • results were obtained essentially as follows. PBAs are incubated in either pooled human serum (Innovative Research), mouse serum (Sigma) or Cynomolgous monkey serum (Innovative Research) at a final concentration of 2.5uM for either 0 days or 5 days at 37°C. The samples are then assayed using a colorimetric ELISA binding assay. 96-well Reacti-bind plates (Pierce, Fisher cat. No. PI-15041) are coated with 50ul of the protein corresponding to the antibody's scFv (either ErbB3-His or IGFIR-His (R&D Systems, cat. No.
  • Example 18 Anti-EGFlR+anti-ErbB3 BPAs display cross-reactivity with human, mouse, rat and monkey IGF1R and ErbB3
  • Results were obtained essentially as follows. 96-well Reacti-bind® plates (Pierce, Fisher cat. No. PI-15041) are coated with 50ul of species specific ErbB3-His or IGF-IR-His (R&D Systems, cat. No. 348-RB and 305-GR, respectively) at 2ug/ml in PBS and incubated overnight at 4°C. The next day plates are washed with PBS + 0.05% Tween-20 (PBS-T) and blocked for lhr. at room temperature with lOOul of Protein-Free Blocking Buffer (Pierce). Plates are washed with PBS-T and 50ul of each PBA is added in duplicate.
  • Concentrations start at 500nM (in PBS-T) and included ten additional two-fold dilutions and one blank (PBS-T only). Plates are incubated at room temperature for two hours and then washed with PBS-T. 50ul of anti-Fc-HRP (Jackson Labs) is added at 1 :40,000 in PBS-T, and plates are incubated in the dark for lhr. at room temperature. Plates are again washed with PBS-T and lOOul of TMB substrate (Thermo Scientific, TMB and peroxide solution mixed 1 : 1) is added.
  • This Example shows that anti-EGFlR+anti-ErbB3 BPAs block the binding of both IGF1 and IGF2 to IGF1R.
  • ELISA plates are coated with IGF1 R- His and blocked as described in Example 18. Following the blocking step, plates are washed and incubated with IGF1 (lOOng ml) or IGF2 (lOOng/ml) (EMD Chemicals) for 1 hour at room temperature. Plates are washed with PBS-T, and lOOul of each Ab is added in duplicate.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Oncology (AREA)
  • Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Cell Biology (AREA)
  • Endocrinology (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2012/034244 2011-04-19 2012-04-19 Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies Ceased WO2012145507A2 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
EP12773950.6A EP2699602B1 (en) 2011-04-19 2012-04-19 Bispecific anti-igf-1r and anti-erbb3 antibodies
CN201280028639.XA CN103703026B (zh) 2011-04-19 2012-04-19 单特异性和双特异性抗igf-1r和抗erbb3抗体
BR112013027021A BR112013027021A2 (pt) 2011-04-19 2012-04-19 anticorpos anti-igf-1r e anti-erbb3 monoespecíficos e biespecíficos
ES12773950.6T ES2625818T3 (es) 2011-04-19 2012-04-19 Anticuerpos biespecíficos anti-IGF-1R y anti-ErbB3
MX2013012201A MX336197B (es) 2011-04-19 2012-04-19 Anicuerpos anti-igf-1r y anti-erbb3 monoespecificos y biespecificos.
JP2014506549A JP5588086B2 (ja) 2011-04-19 2012-04-19 単一特異性および二重特異性抗IGF‐1R抗体および抗ErbB3抗体
KR1020147031817A KR20140138353A (ko) 2011-04-19 2012-04-19 단일특이적 및 이중특이적 항-igf-1r 및 항 erbb3 항체
MX2016000234A MX346486B (es) 2011-04-19 2012-04-19 Anticuerpos anti-igf-1r y anti-erbb3 monoespecificos y biespecificos.
HRP20170713TT HRP20170713T1 (hr) 2011-04-19 2012-04-19 Bispecifično anti-igf-1r i anti-erbb3 antitijelo
KR1020137030562A KR101517320B1 (ko) 2011-04-19 2012-04-19 단일특이적 및 이중특이적 항-igf-1r 및 항 erbb3 항체
SI201230955A SI2699602T1 (sl) 2011-04-19 2012-04-19 Bispecifična protitelesa anti-igf-1r in anti-erbb3
CA2833643A CA2833643A1 (en) 2011-04-19 2012-04-19 Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies
DK12773950.6T DK2699602T3 (en) 2011-04-19 2012-04-19 BISPECIFIC ANTI-IGF-1R AND ANTI-ERBB3 ANTIBODIES
AU2012245491A AU2012245491C1 (en) 2011-04-19 2012-04-19 Monospecific and bispecific anti-IGF-1R and anti-ErbB3 antibodies
IL228957A IL228957A0 (en) 2011-04-19 2013-10-17 Monospecific and bispecific antibodies against r1 -igf against erbb3
AU2017216490A AU2017216490A1 (en) 2011-04-19 2017-08-16 Monospecific and bispecific anti-IGF-IR and anti-ErbB3 antibodies

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US201161477089P 2011-04-19 2011-04-19
US61/477,089 2011-04-19
US201161539297P 2011-09-26 2011-09-26
US61/539,297 2011-09-26
US201161558192P 2011-11-10 2011-11-10
US61/558,192 2011-11-10
US201261619244P 2012-04-02 2012-04-02
US61/619,244 2012-04-02

Publications (2)

Publication Number Publication Date
WO2012145507A2 true WO2012145507A2 (en) 2012-10-26
WO2012145507A3 WO2012145507A3 (en) 2013-11-07

Family

ID=47021510

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2012/034244 Ceased WO2012145507A2 (en) 2011-04-19 2012-04-19 Monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies

Country Status (20)

Country Link
US (4) US8476409B2 (OSRAM)
EP (2) EP3214096A3 (OSRAM)
JP (2) JP5588086B2 (OSRAM)
KR (2) KR20140138353A (OSRAM)
CN (2) CN103703026B (OSRAM)
AU (2) AU2012245491C1 (OSRAM)
BR (1) BR112013027021A2 (OSRAM)
CA (1) CA2833643A1 (OSRAM)
DK (1) DK2699602T3 (OSRAM)
ES (1) ES2625818T3 (OSRAM)
HK (1) HK1223383A1 (OSRAM)
HR (1) HRP20170713T1 (OSRAM)
HU (1) HUE034276T2 (OSRAM)
IL (1) IL228957A0 (OSRAM)
MX (2) MX346486B (OSRAM)
PL (1) PL2699602T3 (OSRAM)
PT (1) PT2699602T (OSRAM)
SI (1) SI2699602T1 (OSRAM)
TW (1) TWI631136B (OSRAM)
WO (1) WO2012145507A2 (OSRAM)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013152034A1 (en) * 2012-04-02 2013-10-10 Merrimack Pharmaceuticals, Inc. Dosage and administration of monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies
WO2015018306A1 (en) * 2013-08-06 2015-02-12 Bio-Thera Solutions, Ltd. Bispecific antibodies
WO2015130554A3 (en) * 2014-02-20 2016-10-20 Merrimack Pharmaceuticals, Inc. Dosage and administration of anti-igf-1r, anti-erbb3 bispecific antibodies, uses thereof and methods of treatment therewith
WO2016196377A1 (en) * 2015-05-29 2016-12-08 Merrimack Pharmaceuticals, Inc. Combination cancer therapies
US9518130B2 (en) 2010-03-11 2016-12-13 Merrimack Pharmaceuticals, Inc. Use of ERBB3 inhibitors in the treatment of triple negative and basal-like breast cancers
US9688761B2 (en) 2013-12-27 2017-06-27 Merrimack Pharmaceuticals, Inc. Biomarker profiles for predicting outcomes of cancer therapy with ERBB3 inhibitors and/or chemotherapies
WO2017127545A1 (en) 2016-01-19 2017-07-27 Merrimack Pharmaceuticals, Inc. Dosage and administration of combination therapies comprising istiratumab, uses and methods of treatment
US10184006B2 (en) 2015-06-04 2019-01-22 Merrimack Pharmaceuticals, Inc. Biomarkers for predicting outcomes of cancer therapy with ErbB3 inhibitors
EP3459971A1 (en) * 2017-09-22 2019-03-27 Shengbiao (Shanghai) Medical Equipment Technology Co., Ltd. Bispecific antibody simultaneously targeting human p185 and vascular endothelial growth factor and application thereof

Families Citing this family (38)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SG178789A1 (en) 2007-02-16 2012-03-29 Merrimack Pharmaceuticals Inc Antibodies against erbb3 and uses thereof
WO2011047180A1 (en) * 2009-10-14 2011-04-21 Merrimack Pharmaceuticals, Inc. Bispecific binding agents targeting igf-1r and erbb3 signalling and uses thereof
BR112013027021A2 (pt) * 2011-04-19 2016-11-29 Merrimack Pharmaceuticals Inc anticorpos anti-igf-1r e anti-erbb3 monoespecíficos e biespecíficos
US9717724B2 (en) 2012-06-13 2017-08-01 Ipsen Biopharm Ltd. Methods for treating pancreatic cancer using combination therapies
AU2013202947B2 (en) 2012-06-13 2016-06-02 Ipsen Biopharm Ltd. Methods for treating pancreatic cancer using combination therapies comprising liposomal irinotecan
KR20220018620A (ko) * 2014-04-25 2022-02-15 피에르 파브르 메디카먼트 Igf-1r 항체 및 암 치료를 위한 운반체를 어드레싱하는 그의 용도
US11318131B2 (en) 2015-05-18 2022-05-03 Ipsen Biopharm Ltd. Nanoliposomal irinotecan for use in treating small cell lung cancer
PL3337467T3 (pl) 2015-08-20 2021-06-14 Ipsen Biopharm Ltd. Terapia skojarzona z zastosowaniem liposomalnego irynotekanu i inhibitora parp do leczenia nowotworu
PL3337478T5 (pl) 2015-08-21 2026-05-04 Ipsen Biopharm Ltd. Kombinacja leków obejmująca liposomalny irynotekan, oksaliplatynę, 5-fluorouracyl i leukoworynę do leczenia nowotworu trzustki z przerzutami
AU2016340153B2 (en) 2015-10-16 2022-06-02 Ipsen Biopharm Ltd. Stabilizing camptothecin pharmaceutical compositions
CN108602890A (zh) 2015-12-11 2018-09-28 瑞泽恩制药公司 用于减少或预防对egfr和/或erbb3阻滞剂具有抗性的肿瘤生长的方法
WO2017136562A2 (en) * 2016-02-02 2017-08-10 Kadmon Corporation, Llc Bispecific binding proteins for pd-l1 and kdr
US10723857B1 (en) * 2016-04-15 2020-07-28 United States Of America As Represented By The Administrator Of National Aeronautics And Space Administration Polyimide aerogels with reduced shrinkage from isothermal aging
WO2018045256A1 (en) * 2016-09-02 2018-03-08 Merrimack Pharmaceuticals, Inc. Combination of an erbb3 inhibitor, topoisomerase i inhibitor, and an alkylating agent to treat cancer
JP6825284B2 (ja) * 2016-09-21 2021-02-03 カシオ計算機株式会社 イメージ作成装置、イメージ作成方法、及び、プログラム
EP3535026A1 (en) 2016-11-02 2019-09-11 Ipsen Biopharm Limited Treating gastric cancer using combination therapies comprising liposomal irinotecan, oxaliplatin, 5-fluoruracil (and leucovorin)
BR112019023071A2 (pt) * 2017-05-04 2020-06-09 Acceleron Pharma Inc proteínas de fusão do receptor tgf-beta do tipo ii e uso das mesmas
GB201804094D0 (en) * 2018-03-14 2018-04-25 Ultrahuman Thirteen Ltd ERBB3 Binding agents
US10654944B2 (en) 2018-04-10 2020-05-19 Y-Biologics Inc. Cell engaging binding molecules
JP7397874B2 (ja) 2018-08-30 2023-12-13 エイチシーダブリュー バイオロジックス インコーポレイテッド 多鎖キメラポリペプチドおよびその使用
CN120535649A (zh) 2018-08-30 2025-08-26 免疫生物公司 单链嵌合多肽和其用途
AU2019328575B2 (en) 2018-08-30 2024-07-11 Immunitybio, Inc. Single-chain and multi-chain chimeric polypeptides and uses thereof
WO2020257639A1 (en) 2019-06-21 2020-12-24 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
CA3152740A1 (en) 2019-08-28 2021-03-04 Horizon Therapeutics Ireland Dac Methods for the treatment of thyroid eye disease
AU2021220196A1 (en) 2020-02-11 2022-08-04 HCW Biologics, Inc. Methods of activating regulatory T cells
US12187763B2 (en) 2020-02-11 2025-01-07 Immunitybio, Inc. Chromatography resin and uses thereof
CA3169231A1 (en) 2020-02-11 2021-08-19 HCW Biologics, Inc. Methods of treating age-related and inflammatory diseases
CN113512116B (zh) * 2020-04-10 2022-09-20 苏州普乐康医药科技有限公司 一种抗igf-1r抗体及其应用
CN115836087A (zh) 2020-04-29 2023-03-21 Hcw生物科技公司 抗cd26蛋白及其用途
US12024545B2 (en) 2020-06-01 2024-07-02 HCW Biologics, Inc. Methods of treating aging-related disorders
WO2021247003A1 (en) 2020-06-01 2021-12-09 HCW Biologics, Inc. Methods of treating aging-related disorders
EP4157460A1 (en) 2020-06-01 2023-04-05 HCW Biologics, Inc. Methods of treating aging-related disorders
WO2023030311A1 (zh) * 2021-08-31 2023-03-09 上海医药集团股份有限公司 靶向Siglec15的抗原结合蛋白及其用途
WO2023168363A1 (en) 2022-03-02 2023-09-07 HCW Biologics, Inc. Method of treating pancreatic cancer
CN119384289A (zh) 2022-04-13 2025-01-28 免疫生物公司 用于治疗神经炎症性障碍的多链嵌合多肽
WO2026043909A1 (en) 2024-08-19 2026-02-26 HCW Biologics, Inc. Single-chain chimeric polypeptides and uses thereof
WO2026043906A1 (en) 2024-08-19 2026-02-26 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
CN120623322B (zh) * 2025-08-14 2025-12-05 成都蓉生药业有限责任公司 一种人IgG Fc变体、基因片段、表达载体、宿主细胞、IgG抗体及人IgG Fc变体制备方法和应用

Citations (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5480968A (en) 1989-12-01 1996-01-02 The United States Of America As Represented By The Department Of Health And Human Services Isolated polypeptide erbB-3, related to the epidermal growth factor receptor and antibody thereto
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5892019A (en) 1987-07-15 1999-04-06 The United States Of America, As Represented By The Department Of Health And Human Services Production of a single-gene-encoded immunoglobulin
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
WO2001029246A1 (fr) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Procede de production d'un polypeptide
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
WO2002030954A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Method of purifying antibody
US20030003097A1 (en) 2001-04-02 2003-01-02 Idec Pharmaceutical Corporation Recombinant antibodies coexpressed with GnTIII
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
WO2005018572A2 (en) 2003-08-22 2005-03-03 Biogen Idec Ma Inc. Improved antibodies having altered effector function and methods for making the same
WO2005047327A2 (en) 2003-11-12 2005-05-26 Biogen Idec Ma Inc. NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO
WO2005063815A2 (en) 2003-11-12 2005-07-14 Biogen Idec Ma Inc. Fcϝ receptor-binding polypeptide variants and methods related thereto
US7183076B2 (en) 1997-05-02 2007-02-27 Genentech, Inc. Method for making multispecific antibodies having heteromultimeric and common components
US20070111281A1 (en) 2005-05-09 2007-05-17 Glycart Biotechnology Ag Antigen binding molecules having modified Fc regions and altered binding to Fc receptors
US7332580B2 (en) 2002-04-05 2008-02-19 The Regents Of The University Of California Bispecific single chain Fv antibody molecules and methods of use thereof
US7332585B2 (en) 2002-04-05 2008-02-19 The Regents Of The California University Bispecific single chain Fv antibody molecules and methods of use thereof
US20100255013A1 (en) 2001-10-25 2010-10-07 Presta Leonard G Glycoprotein compositions
US7846440B2 (en) 2007-02-16 2010-12-07 Merrimack Pharmaceuticals, Inc. Antibodies against ErbB3 and uses thereof

Family Cites Families (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU727082B2 (en) 1996-03-27 2000-11-30 Genentech Inc. ErbB3 antibodies
PA8535501A1 (es) * 2001-01-05 2003-07-28 Pfizer Anticuerpos contra el receptor del factor de crecimiento similar a insulina
EP1283053A1 (en) 2001-08-09 2003-02-12 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Inhibitors of HER3 activity
CA2524305C (en) * 2003-05-01 2015-12-08 Imclone Systems Incorporated Fully human antibodies directed against the human insulin-like growth factor-1 receptor
CN103073639A (zh) * 2006-03-17 2013-05-01 比奥根艾迪克Ma公司 稳定的多肽组合物
EP2091975A4 (en) * 2006-11-21 2013-05-22 Univ California ANTIBODIES TO THE EGFR FAMILY, BICE-SPECIFIC ANTIBODIES TO THE EGFR FAMILY AND METHOD FOR THEIR USE
AU2008223541B2 (en) * 2007-03-02 2012-04-05 Amgen Inc. Methods and compositions for treating tumor diseases
JP2010538012A (ja) * 2007-08-28 2010-12-09 バイオジェン アイデック マサチューセッツ インコーポレイテッド Igf−1rの複数のエピトープに結合する組成物
BRPI0911652A2 (pt) 2008-04-11 2015-08-04 Merrimack Pharmaceuticals Inc Ligantes de albumina sérica humana e seus conjugados
WO2010019952A2 (en) 2008-08-15 2010-02-18 Merrimack Pharmaceuticals, Inc. Methods, systems and products for predicting response of tumor cells to a therapeutic agent and treating a patient according to the predicted response
WO2010127181A1 (en) 2009-04-29 2010-11-04 Trellis Bioscience, Inc. Improved antibodies immunoreactive with heregulin-coupled her3
AU2010252284A1 (en) * 2009-05-27 2011-11-17 F. Hoffmann-La Roche Ag Tri- or tetraspecific antibodies
TW201109438A (en) * 2009-07-29 2011-03-16 Abbott Lab Dual variable domain immunoglobulins and uses thereof
KR20120059568A (ko) 2009-08-21 2012-06-08 메리맥 파마슈티컬즈, 인크. Erbb3의 엑토도메인에 대한 항체 및 이의 용도
AR078254A1 (es) 2009-09-01 2011-10-26 Abbott Lab Inmunoglobulinas con dominio variable dual y usos de las mismas
WO2011047180A1 (en) * 2009-10-14 2011-04-21 Merrimack Pharmaceuticals, Inc. Bispecific binding agents targeting igf-1r and erbb3 signalling and uses thereof
PH12012501157A1 (en) 2009-12-22 2012-10-29 Roche Glycart Ag Anti-her3 antibodies and uses thereof
US8481687B2 (en) 2010-04-09 2013-07-09 Aveo Pharmaceuticals, Inc. Anti-ErbB3 antibodies
SG187908A1 (en) * 2010-08-20 2013-03-28 Novartis Ag Antibodies for epidermal growth factor receptor 3 (her3)
BR112013027021A2 (pt) * 2011-04-19 2016-11-29 Merrimack Pharmaceuticals Inc anticorpos anti-igf-1r e anti-erbb3 monoespecíficos e biespecíficos
EP2833915A1 (en) * 2012-04-02 2015-02-11 Merrimack Pharmaceuticals, Inc. Dosage and administration of monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies
EP3107578A2 (en) * 2014-02-20 2016-12-28 Merrimack Pharmaceuticals, Inc. Dosage and administration of anti-igf-1r, anti-erbb3 bispecific antibodies, uses thereof and methods of treatment therewith
US20170233491A1 (en) * 2016-01-19 2017-08-17 Merrimack Pharmaceuticals, Inc. Dosage and administration of combination therapies comprising istiratumab, uses and methods of treatment

Patent Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5892019A (en) 1987-07-15 1999-04-06 The United States Of America, As Represented By The Department Of Health And Human Services Production of a single-gene-encoded immunoglobulin
US5480968A (en) 1989-12-01 1996-01-02 The United States Of America As Represented By The Department Of Health And Human Services Isolated polypeptide erbB-3, related to the epidermal growth factor receptor and antibody thereto
US7183076B2 (en) 1997-05-02 2007-02-27 Genentech, Inc. Method for making multispecific antibodies having heteromultimeric and common components
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
WO2000061739A1 (fr) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle
WO2001029246A1 (fr) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Procede de production d'un polypeptide
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
WO2002030954A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Method of purifying antibody
US20030003097A1 (en) 2001-04-02 2003-01-02 Idec Pharmaceutical Corporation Recombinant antibodies coexpressed with GnTIII
US20100255013A1 (en) 2001-10-25 2010-10-07 Presta Leonard G Glycoprotein compositions
US7332580B2 (en) 2002-04-05 2008-02-19 The Regents Of The University Of California Bispecific single chain Fv antibody molecules and methods of use thereof
US7332585B2 (en) 2002-04-05 2008-02-19 The Regents Of The California University Bispecific single chain Fv antibody molecules and methods of use thereof
WO2005018572A2 (en) 2003-08-22 2005-03-03 Biogen Idec Ma Inc. Improved antibodies having altered effector function and methods for making the same
WO2005047327A2 (en) 2003-11-12 2005-05-26 Biogen Idec Ma Inc. NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO
WO2005063815A2 (en) 2003-11-12 2005-07-14 Biogen Idec Ma Inc. Fcϝ receptor-binding polypeptide variants and methods related thereto
US20070111281A1 (en) 2005-05-09 2007-05-17 Glycart Biotechnology Ag Antigen binding molecules having modified Fc regions and altered binding to Fc receptors
US7846440B2 (en) 2007-02-16 2010-12-07 Merrimack Pharmaceuticals, Inc. Antibodies against ErbB3 and uses thereof

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
CHOTHIA, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
KABAT ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 6609 - 6616
KABAT ET AL., SEQUENCES OF PROTEIN OF IMMUNOLOGICAL INTEREST, 1991
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, U.S. DEPT. HEALTH AND HUMAN SERVICES
MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9518130B2 (en) 2010-03-11 2016-12-13 Merrimack Pharmaceuticals, Inc. Use of ERBB3 inhibitors in the treatment of triple negative and basal-like breast cancers
WO2013152034A1 (en) * 2012-04-02 2013-10-10 Merrimack Pharmaceuticals, Inc. Dosage and administration of monospecific and bispecific anti-igf-1r and anti-erbb3 antibodies
WO2015018306A1 (en) * 2013-08-06 2015-02-12 Bio-Thera Solutions, Ltd. Bispecific antibodies
US9567403B2 (en) 2013-08-06 2017-02-14 Bio-Thera Solutions, Ltd. Bispecific antibodies which bind EGFR and VEGF
US10273304B2 (en) 2013-12-27 2019-04-30 Merrimack Pharmaceuticals, Inc. Biomarker profiles for predicting outcomes of cancer therapy with ERBB3 inhibitors and/or chemotherapies
US9688761B2 (en) 2013-12-27 2017-06-27 Merrimack Pharmaceuticals, Inc. Biomarker profiles for predicting outcomes of cancer therapy with ERBB3 inhibitors and/or chemotherapies
WO2015130554A3 (en) * 2014-02-20 2016-10-20 Merrimack Pharmaceuticals, Inc. Dosage and administration of anti-igf-1r, anti-erbb3 bispecific antibodies, uses thereof and methods of treatment therewith
WO2016196377A1 (en) * 2015-05-29 2016-12-08 Merrimack Pharmaceuticals, Inc. Combination cancer therapies
US10184006B2 (en) 2015-06-04 2019-01-22 Merrimack Pharmaceuticals, Inc. Biomarkers for predicting outcomes of cancer therapy with ErbB3 inhibitors
WO2017127545A1 (en) 2016-01-19 2017-07-27 Merrimack Pharmaceuticals, Inc. Dosage and administration of combination therapies comprising istiratumab, uses and methods of treatment
EP3459971A1 (en) * 2017-09-22 2019-03-27 Shengbiao (Shanghai) Medical Equipment Technology Co., Ltd. Bispecific antibody simultaneously targeting human p185 and vascular endothelial growth factor and application thereof
JP2019058160A (ja) * 2017-09-22 2019-04-18 Sun−Bio Medical Device株式会社 ヒトp185及び血管内皮増殖因子の両方を標的とする抗体及びその適用
US10973916B2 (en) 2017-09-22 2021-04-13 Sun-Bio Medical Device Co., Ltd. Bispecific antibody targeting human p185 and vascular endothelial growth factor and application thereof

Also Published As

Publication number Publication date
MX346486B (es) 2017-03-22
JP2014513950A (ja) 2014-06-19
IL228957A0 (en) 2013-12-31
US20160137738A1 (en) 2016-05-19
HUE034276T2 (en) 2018-02-28
HK1223383A1 (zh) 2017-07-28
EP3214096A3 (en) 2017-10-18
EP2699602B1 (en) 2017-03-01
US20120269812A1 (en) 2012-10-25
CN103703026B (zh) 2015-08-26
AU2017216490A1 (en) 2017-08-31
EP3214096A2 (en) 2017-09-06
CN105884900A (zh) 2016-08-24
HRP20170713T1 (hr) 2017-07-14
AU2012245491A1 (en) 2013-10-31
US9938346B2 (en) 2018-04-10
KR20140033050A (ko) 2014-03-17
EP2699602A2 (en) 2014-02-26
MX2013012201A (es) 2014-05-28
JP5588086B2 (ja) 2014-09-10
US20170051063A1 (en) 2017-02-23
JP2014158485A (ja) 2014-09-04
DK2699602T3 (en) 2017-06-06
BR112013027021A2 (pt) 2016-11-29
SI2699602T1 (sl) 2017-06-30
PT2699602T (pt) 2017-06-12
MX336197B (es) 2016-01-11
KR20140138353A (ko) 2014-12-03
AU2012245491C1 (en) 2017-12-21
TWI631136B (zh) 2018-08-01
ES2625818T3 (es) 2017-07-20
PL2699602T3 (pl) 2017-11-30
JP6214453B2 (ja) 2017-10-18
WO2012145507A3 (en) 2013-11-07
US8476409B2 (en) 2013-07-02
US20130236459A1 (en) 2013-09-12
KR101517320B1 (ko) 2015-05-28
CN103703026A (zh) 2014-04-02
US9527914B2 (en) 2016-12-27
US20160122438A9 (en) 2016-05-05
US9556274B2 (en) 2017-01-31
TW201302790A (zh) 2013-01-16
AU2012245491B2 (en) 2017-08-17
CA2833643A1 (en) 2012-10-26

Similar Documents

Publication Publication Date Title
AU2012245491B2 (en) Monospecific and bispecific anti-IGF-1R and anti-ErbB3 antibodies
EP2855531A1 (en) Multispecific antibodies
EP4421093A1 (en) Antigen-binding protein comprising two fc domains and use thereof
CN118355030A (zh) 抗EGFR抗体、抗cMET抗体、抗VEGF抗体、多特异性抗体及其用途
TW202506728A (zh) 活化素a受體樣1型(alk1)之雙特異性促效性抗體
JP2026513915A (ja) ヒンジが修飾された二重特異性抗体
HK1192889A (en) Bispecific anti-igf-1r and anti-erbb3 antibodies
HK1192889B (en) Bispecific anti-igf-1r and anti-erbb3 antibodies
WO2026080752A2 (en) De novo antibodies to activin a receptor like type 1 (alk1)
WO2026080757A2 (en) Activin receptor type ii a/b (actriia/b) antibodies
JP2026507191A (ja) Muc1抗体及び使用方法
WO2026080748A2 (en) Bone morphogenetic protein receptor type 2 (bmprii) antibodies
CA3239553A1 (en) Human mesothelin binders
EA052211B1 (ru) ВАРИАНТ Fc С ВЫСОКОЙ ТЕРМОСТАБИЛЬНОСТЬЮ И ОСЛАБЛЕННОЙ ЭФФЕКТОРНОЙ ФУНКЦИЕЙ

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12773950

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2014506549

Country of ref document: JP

Kind code of ref document: A

Ref document number: 2833643

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2013/012201

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2012245491

Country of ref document: AU

Date of ref document: 20120419

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20137030562

Country of ref document: KR

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2012773950

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2012773950

Country of ref document: EP

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013027021

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112013027021

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20131018