WO2012130874A1 - Bispecific anti-cxcr7 immunoglobulin single variable domains - Google Patents

Bispecific anti-cxcr7 immunoglobulin single variable domains Download PDF

Info

Publication number
WO2012130874A1
WO2012130874A1 PCT/EP2012/055499 EP2012055499W WO2012130874A1 WO 2012130874 A1 WO2012130874 A1 WO 2012130874A1 EP 2012055499 W EP2012055499 W EP 2012055499W WO 2012130874 A1 WO2012130874 A1 WO 2012130874A1
Authority
WO
WIPO (PCT)
Prior art keywords
single variable
immunoglobulin single
seq
amino acid
variable domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2012/055499
Other languages
English (en)
French (fr)
Inventor
Francis Descamps
David Andre Baptist Detaille
Maarten Van Roy
Regorius Leurs
Maria Gonzalez Pajuelo
Pascal Merchiers
Martin Smit
Catelijne Stortelers
Philippe Van Rompaey
Peter Vanlandschoot
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ablynx NV
Original Assignee
Ablynx NV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN201280026571.1A priority Critical patent/CN103917560B/zh
Priority to AU2012234284A priority patent/AU2012234284B2/en
Priority to EP12713656.2A priority patent/EP2691418A1/en
Priority to CA2831415A priority patent/CA2831415A1/en
Priority to US14/008,011 priority patent/US20150158948A9/en
Priority to JP2014501588A priority patent/JP6181040B2/ja
Application filed by Ablynx NV filed Critical Ablynx NV
Publication of WO2012130874A1 publication Critical patent/WO2012130874A1/en
Priority to US13/650,600 priority patent/US9512236B2/en
Priority to US13/937,718 priority patent/US9994639B2/en
Anticipated expiration legal-status Critical
Priority to US15/969,938 priority patent/US20180355048A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin

Definitions

  • the present invention relates to biological materials and methods related to CXCR7 including polypeptides, nucleic acids encoding such polypeptides; methods for preparing such polypeptides; host cells expressing or capable of expressing such polypeptides; compositions including pharmaceutical compositions that comprise such polypeptides, such as for prophylactic, therapeutic or diagnostic purposes.
  • CXC 7 employed along with CXCR4 blockage may be useful for the treatment of SDF-l-dependent tumor progression and metastasis (RB Maksym et al., 2009, The role of stromal-derived factor-1 - CXCR7 axis in development of cancer, European journal of Pharmacology, 625 (1-3), pages 31-40) and ii) that some small molecular inhibitors, such as CCX733 or CCX266, siRNA and blocking antibodies (clones Mab 11G8, Mab 9C4 see e.g., U520070167443; clone 358426 (R&D Systems); Mab 8F11 (Biolegend)), may be useful for therapeutic interference with CXCR4-mediated activation of integrins (TN Hartmann et ai., 2008, A crosstalk between intracellular CXCR7 and CXCR4 involved in rapid CXCL12-triggered integrin activation but not in chemok
  • compounds (CCX733, CCX754) which can selectively block binding of CXCL11 and CXCL12 to CXCR7, function like chemokine iigands with respect to homodimerization, i.e., they enha nce CXCR7 homodimerization by 2.5 to 3.5 fold with significant increases (P ⁇ 0.05) first detected at 10 and 100 nM (KE Luker et al., 2009, Imaging chemokine receptor dimerization with firefly luciferase comp!ementation, FASEB journal, 23, pages 823-834).
  • CXCR7 has been attributed a potential role in tumour development because its expression provides cells with a growth and survival advantage. It was recently demonstrated that CXCR7 promotes the growth of breast and lung tumours and enhances lung metastases (Proc. Natl. Acad. Sci. USA 2007 104:15735-15740). Moreover, CXCR7 expression is correlated with tumour aggressiveness in prostate cancer (J.Bioi.Chem 2008 283:4283-4294). Administration of a small molecule antagonist to CXCR7 resulted in impediment of tumour growth in animal models, vaiidating CXCR7 as target for development of novel cancer therapeutics (J. Exp. ed. 2006 203:2201-2213).
  • Head and neck cancers are among the most prevalent tumors in the world. Despite advances in the treatment of head and neck tumors, the survival of patients with these cancers has not markedly improved over the past several decades because of the inability to control and poor understanding of the regional and distant spread of this disease. Head and neck cancers consistently rank among the six most frequently diagnosed cancers in the world. Cancers of the oral cavity and pharynx alone account for some 300,000 new cases worldwide and little under 200,000 deaths annually. Over 90% of head and neck cancers are squamous cell carcinomas of the upper aerodigestive tract, including the oral cavity, pharynx, larynx, and paranasal sinuses. In addition, epithelial head and neck tumors can arise in the salivary and thyroid glands. Despite advances in our understanding and advances in the prevention and treatment of head and neck cancers, the survival of patients with head and neck cancers has not significantly improved over the past several decades.
  • WO2006/116319 and WO2008/048519 both note that the production of antibodies to G-protein coupled receptors (GPCRs) has been notoriously difficult. Indeed, the generation of a conventional anti-CXCR7 antibody has been described only in a limited number of cases, e.g., in WO2006/116319 for conventional antibodies 11G8, 6E10 and in Zabe! et al. for conventional antibody 8F1I (Zabel et a!., 2009, Elucidation of CXCR7 mediated signalling events and inhibition of CXCR4 mediated tumor cell transendotheiial migration by CXCR7 Iigands. J Immunol.; 183 (5):3204-ll).
  • Sma ll molecules are known for side effects a nd unwanted effects.
  • the small molecule CCX771 blocks CXCL12 binding (cf. Carbajal et al; 2010 " M igration of engrafted neura l stem cells is med iated by CXCL12 signa ling through CXCR4 in a viral model of multiple sclerosis Proc Natl Acad Sci USA.
  • VUF11403 behaves as a n agonist in the ⁇ -a rrestin assay.
  • nti-CXCR7 drug on the market or in the clinic.
  • CXCR7 is expressed on many human tumour ceils but not on most healthy cells. In our tumour model systems we found that reduction or inhibition of CXCR7 by immunoglobulin single varia ble domains reduces or abolishes tumou r formation in vivo.
  • Immunoglobulin sequences such as antibodies and antigen binding fragments derived there from (e.g., immunoglobulin single varia ble domains) are used to specifically target their respective antigens in research and thera Bennettic a pplications.
  • the generation of immunoglobulin single variable domains such as e. g., VH Hs may invoive the immunization of an experimental a nima l such as a Llama, construction of phage libra ries from immune tissue, selection of phage displaying antige n binding immunoglobulin single variable doma ins and screening of said domains and engineered constructs thereof for the desired specificities (WO 94/04678) .
  • im munoglobulin single va riable domains such as e.g., dAbs can be generated by selecting phage d isplaying antigen binding immunoglobulin single va riable domains directly from naive or synthetic libraries and subsequent screening of said domains a nd engineered constructs thereof for the desired specificities (Ward et al, Binding activities of a repertoire of single immunoglobulin variable domains secreted from Escherichia coli, Nature, 1989, Oct 12; 341 (6242): 544-6); Holt et al ., Trends BiotechnoL, 2003, 21(ll):484-490; as well as for example WO 06/030220, WO 06/003388 and other published patent applications of Domantis Ltd.).
  • the present invention relates to polypeptides that comprise or essentially consist of i) a first building block consisting essentially of one or more immunoglobulin single variable domain(s), wherein said immunoglobulin single variable domain(s) is (are) directed against CXCR7 and in particular against human CXCR7; and ii) a second building block consisting essentially of one or more (preferably one) immunoglobulin single variable domain(s), wherein said immunoglobulin single variable domain(s) is (are) directed against serum albumin and in particular against human serum albumin (and even more preferably wherein said immunoglobulin single variable domain is AitaS (as herein defined)).
  • the invention also relates to nucleic acids encoding such polypeptides; to methods for preparing such polypeptides; to host cells expressing or capable of expressing such polypeptides; to compositions, and in particular to pharmaceutical compositions that comprise such polypeptides, nucleic acids and/or host ceils; and to uses of such polypeptides, nucleic acids, host cells and/or compositions for prophylactic, therapeutic or diagnostic purposes.
  • Figure 1 shows an SDF-1 competition experiment using FACS.
  • Figure 2 shows an Mab 11G8 competition experiment using FACS.
  • FIG. 3 shows an immunohistochemical analysis of CXCR7 expression in primary tumor sections.
  • Figure 4 shows profiling of CXCR7 mRNA in head and neck cancer cell lines 11B, 22A, 22 B, FaDu, OE and 93-VU-147 by PCR.
  • Figure 5 shows a [ 125 !]-CXCL12 competition experiment on head and neck cancer cell lines 11B, 22A, 22 B, FaDu, OE and 93-VU-147 with !igand CXCL11, CXCL12, Nanobody 09A04 and negative controls: no competitor (designated by indicating total binding (TB)); and CXCL10 (indicating a-specific competition).
  • Figure 6 shows in vivo CXCR7 Nanobody therapy with 22A transplants in nude mice: "-" negative control (PBS); polypeptide constructs clone 060, clone 083, clone 085 and clone 093.
  • Figure 7 shows tumour volumes after 50 days of treatment with in vivo CXCR7 Nanobody therapy with 22A transplants in nude m ice : "-" negative control (PBS); polypeptide constructs clone 085 a nd clone 093.
  • Figure 8 shows inhibition of SDF-1 bind ing to HEK293T hCXCR7 in the presence of 2mg/ml HSA.
  • ISVD immunoglobulin single variable domain
  • the immunoglobulin single variable domains further are light chain va riable doma in sequences (e. g., a Vt-sequence), or heavy cha in variable domain sequences (e.g., a V H -sequence ⁇ ; more specifically, they can be heavy chain variable domai n sequences that a re derived from a conventiona l four-cha in antibody or heavy cha in variable domain sequences that are derived from a heavy chain antibody.
  • light chain va riable doma in sequences e. a Vt-sequence
  • heavy cha in variable domain sequences e.g., a V H -sequence ⁇
  • they can be heavy chain variable domai n sequences that a re derived from a conventiona l four-cha in antibody or heavy cha in variable domain sequences that are derived from a heavy chain antibody.
  • the immunoglobulin single varia ble domains can be domain antibodies, or imm unoglobulin sequences that are suitable for use as domain antibodies, single domain antibodies, or im munoglobulin seq uences that are suita ble for use as single domain antibodies, "dAbs", or immunoglobulin sequences that are suitable for use as dAbs, or Nanobodies, including but not limited to V HH sequences.
  • the invention includes imm unoglobulin sequences of different origin, comprising mouse, rat, rabbit, donkey, human a nd camelid imm unoglobulin sequences.
  • the immunoglobulin single va riable domain includes fully human, humanized, otherwise sequence optimized or chimeric immunoglobulin sequences.
  • the immunoglobulin single variable domain and structu re of an immunoglobulin single variable domain ca n be considered - without however being limited thereto - to be comprised of four fra mework regions or "FR's", which are referred to in the a rt a nd herein as "Framework region 1" or “FRl”; as “Framework region 2" or “FR2”; as “Fra mework region 3" or “FR3”; and as “Framework region 4" or “FR4", respectively; which framework regions a re interrupted by three complementary determining regions or "CDR's", which a re referred to in the art as "Complementarity Determining Region l"or “CDR1"; as “Complementarity Determining Region 2" or “CDR2”; and as “Complementarity Determining Region 3" or “CDR3", respectively.
  • FR's fra mework regions
  • Nanobody is also as defined in WO 08/020079, and as described therein generally refers to an immunoglobulin heavy chain variable domain that has the functional and/or structural characteristics of a V HH domain (e.g., a V H domain from the "heavy-chain only” antibodies that occur in Camelids), and as such may in particular be a (native) V HH , a humanized V HH or a camelized V H/ such as a camelized human V H .
  • V HH domain e.g., a V H domain from the "heavy-chain only” antibodies that occur in Camelids
  • Amino acid residues will be indicated according to the standard three-letter or one-letter amino acid code. Reference is made to Table A-2 on page 48 of the International application WO 08/020079 of Abiynx N.V. entitled "Immunoglobulin single variable domains directed against IL- 6R and polypeptides comprising the same for the treatment of diseases and disorders associated with 11-6 mediated signalling" .
  • the percentage of "sequence identity" between a first nucleotide sequence and a second nucleotide sequence may be calculated or determined as described in paragraph e) on page 49 of WO 08/020079 (incorporated herein by reference), such as by dividing [the number of nucleotides in the first nucleotide sequence that are identical to the nucleotides at the corresponding positions in the second nucleotide sequence] by [the total number of nucleotides in the firs nucleotide sequence) and multiplying by [100%], in which each deletion, insertion, substitution or addition of a nucleotide in the second nucleotide sequence - compared to the first nucleotide sequence - is considered as a difference at a single nucleotide (position); or using a suitable computer algorithm or technique, again as described in paragraph e) on pages 49 of WO 08/020079 (incorporated herein by reference).
  • the percentage of "sequence identity" between a first amino acid sequence and a second amino acid sequence may be calculated or determined as described in paragraph f) on pages 49 and 50 of WO 08/020079 (incorporated herein by reference), such as by dividing [the number of amino acid residues in the first amino acid sequence that are identical to the amino acid residues at the corresponding positions in the second amino acid sequence] by [the total number of amino acid residues in the first amino acid sequence] and multiplying by [100%], in which each deletion, insertion, substitution or addition of an amino acid residue in the second amino acid sequence - compared to the first amino acid sequence - is considered as a difference at a single amino acid residue (position), i.e. as an "amino acid difference" as defined herein; or using a suitable com puter
  • Any amino acid substitutions applied to the polypeptides described herein may also be based on the analysis of the frequencies of amino acid variations between homologous proteins of different species developed by Schulz et al., Principles of Protein Structure, Springer-Verlag, 1978, on the analyses of structure forming potentials developed by Chou and Fasman, Biochemistry 13: 211, 1974 and Adv. Enzymol., 47: 45-149, 1978, and on the analysis of hydrophobicity patterns in proteins developed by Eisenberg et al., Proc. Natl. Acad Sci. USA 81: 140-144, 1984; Kyte & Doolittle; J Molec. Biol. 157: 105-132, 198 1, and Goldman et al., Ann. Rev.
  • Immunoglobulin single variable domains and nucleic acid sequences are said to be "exactly the same” if they have 100% sequence identity (as defined herein) over their entire length.
  • amino acid difference refers to an insertion, deletion or substitution of a single amino acid residue o a position of the first sequence, compared to the second sequence; it being understood that two immunoglobulin single variable domains can contain one, two or more such amino acid differences.
  • nucleotide sequence or amino acid sequence is said to "comprise” another nucleotide sequence or amino acid sequence, respectively, or to "essentially consist of” another nucleotide sequence or amino acid sequence, this has the meaning given in paragraph i) on pages 51-52 of WO 08/020079.
  • domain and “binding domain” have the meanings given to it in paragraph k) on page 53 of WO 08/020079.
  • antigenic determinant and “epitope”, which may also be used interchangeably herein, have the meanings given to it in paragraph I) on page 53 of WO 08/020079.
  • an amino acid sequence (such as an antibody, a polypeptide of the invention, or generally an antigen binding protein or polypeptide or a fragment thereof) that can (specifically) bind to, that has affinity for and/or that has specificity for a specific antigenic determinant, epitope, antigen or protein (or for at least one part, fragment or epitope thereof) is said to be "against" or "directed against” said antigenic determinant, epitope, antigen or protein.
  • the term "specificity" has the meaning given to it in paragraph n) on pages 53-56 of WO 08/020079; and as mentioned therein refers to the number of different types of antigens or antigenic determinants to which a particular antigen-binding molecule or antigen-binding protein (such as a polypeptide of the invention) molecule can bind.
  • the specificity of an antigen- binding protein can be determined based on affinity and/or avidity, as described on pages 53-56 of WO 08/020079 (incorporated herein by reference), which also describes some preferred techniques for measuring binding between an antigen-binding molecule (such as a polypeptide of the invention) and the pertinent antigen.
  • antigen-binding proteins such as the immunoglobulin single variable domains, and/or polypeptides of the invention
  • K D dissociation constant
  • K A association constant
  • a monovalent immunoglobulin single variable domain of the invention will bind to the desired antigen with an affinity less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM .
  • Specific binding of an antigen-binding protein to an antigen or antigenic determinant can be determined in any suitable manner known per se, including, for example, Scatchard analysis and/or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known per se in the art; as well as the other techniques mentioned herein.
  • the dissociation constant may be the actual or apparent dissociation constant. Methods for determining the dissociation constant will be clear to the skilled person, and for example include the techniques mentioned on pages 53-56 of WO 08/020079.
  • the half-life of an amino acid sequence, compound or polypeptide of the invention can generally be defined as described in paragraph o) on page 57 of WO 08/020079 and as mentioned therein refers to the time taken for the serum concentration of the amino acid sequence, compound or polypeptide to be reduced by 50%, in vivo, for example due to degradation of the sequence or compound and/or clearance or sequestration of the sequence or compound by natural mechanisms.
  • the in vivo ha If- life of an amino acid sequence, compound or polypeptide of the invention can be determined in any manner known per se, such as by pharmacokinetic analysis. Suitable techniques will be clear to the person skilled in the art, and may for example generally be as described in paragraph o) on page 57 of WO 08/020079.
  • the half-life can be expressed using parameters such as the tl/2-alpha, tl/2-beta and the area under the curve (AUC).
  • AUC area under the curve
  • interaction site on the target or antigen means a site, epitope, antigenic determinant, part, domain or stretch of amino acid residues on the target or antigen that is a site for binding to a ligand, receptor or other binding partner, a catalytic site, a cleavage site, a site for allosteric interaction, a site involved in multimerization (such as homomerization or heterodimerization) of the target or antigen; or any other site, epitope, antigenic determinant, part, domain or stretch of amino acid residues on the target or antigen that is involved in a biological action or mechanism of the target or antigen.
  • an "interaction site” can be any site, epitope, antigenic determinant, part, domain or stretch of amino acid residues on the target or antigen to which an amino acid sequence or polypeptide of the invention can bind such that the target or antigen (and/or any pathway, interaction, signalling, biological mechanism or biologica l effect in which the target or antigen is involved) is modulated (as defined herein).
  • An immunoglobulin single variable domain or polypeptide is said to be "specific for" a first target or antigen compared to a second target or antigen when is binds to the first antigen with a affinity/avidity (as described above, and suitably expressed as a K D value, K A value, K off rate and/or K on rate) that is at least 10 times, such as at least 100 times, and preferably at least 1000 times, and up to 10.000 times or more better than the affi ity with which said amino acid sequence or polypeptide binds to the second target or polypeptide.
  • a affinity/avidity as described above, and suitably expressed as a K D value, K A value, K off rate and/or K on rate
  • the first antigen may bind to the target or antigen with a K D value that is at least 10 times less, such as at least 100 times less, and preferably at least 1000 times less, such as 10.000 times less or even less than that, than the K 0 with which said amino acid sequence or polypeptide binds to the second target or polypeptide.
  • a K D value that is at least 10 times less, such as at least 100 times less, and preferably at least 1000 times less, such as 10.000 times less or even less than that, than the K 0 with which said amino acid sequence or polypeptide binds to the second target or polypeptide.
  • an immunoglobulin single variable domain or polypeptide is "specific for" a first target or antigen compared to a second target or antigen, it is directed against (as defined herein) said first target or antigen, but not directed against said second target or antigen.
  • cross-block means the ability of an immunoglobulin single variable domain or polypeptide to interfere with the binding directly or indirectly through allosteric modulation of other immunoglobulin single variable domains or polypeptides of the invention to a given target.
  • the extent to which an immunoglobulin single variable domain or polypeptide of the invention is able to interfere with the binding of another to target, and therefore whether it can be said to cross-block according to the invention, can be determined using competition binding assays.
  • One particula rly suita ble quantitative cross-blocking assay uses a FACS- or a n ELISA-based approach to measure competition between the labelled ⁇ e.g., His tagged or radioactive labelled) immunoglobulin single variable domain or polypeptide according to the invention and the other binding agent in terms of their binding to the ta rget.
  • the experimenta l part generally describes suitable FACS-, ELISA- or radioliga nd-displacement-based assays for determ ining whether a binding molecule cross-blocks or is capable of cross-blocking an immunoglobulin single variable domain or polypeptide according to the invention.
  • a cross-blocking am ino acid sequence or other binding agent according to the invention is for exam ple one which will bind to the target in the above cross-blocking assay such that, during the assay and in the presence of a second amino acid sequence or other bind ing agent of the invention, the recorded displacement of the immunoglobulin single variable domain or polypeptide according to the invention is between 60% and 100% (e.g., in E USA/ radioligand based competition assay) or between 80% to 100% ⁇ e.
  • cross-blocking agent may be another conventiona l monoclona l antibody such as IgG, classic monovalent antibody fragments (Fab, scFv)) a nd engineered va riants (diabodies, triabodies, mi nibodies, VHHs, dAbs, VHs, VLs) .
  • An am ino acid sequence such as e.g. an immunoglobulin single va riable doma in or polypeptide according to the invention is said to be "cross-reactive" for two different antigens or antigenic determinants (such as serum albumin from two different species of mamma l, such as human serum a lbumin and cyno serum albumin) if it is specific for (as defined herein) both these different antigens or antigenic determ inants.
  • two different antigens or antigenic determinants such as serum albumin from two different species of mamma l, such as human serum a lbumin and cyno serum albumin
  • FR1 of a n immunoglobulin single varia ble domain comprises the amino acid residues at positions 1-30
  • CDR1 of an immunoglobulin single variable doma in comprises the amino acid residues at positions 31-35
  • FR2 of an immunoglobulin single variable domain comprises the amino acids at positions 36-49
  • COR2 of an immunoglobulin single variable domain comprises the amino acid residues at positions 50-65
  • FR3 of an immunoglobulin single variable domain comprises the amino acid residues at positions 66-94
  • CDR3 of an immunoglobulin single variable domain comprises the amino acid residues at positions 95-102
  • FR4 of an immunoglobulin single variable domain comprises the amino acid residues at positions 103-113.
  • the polypeptides of the present invention can generally be used to modulate, and in particular inhibit and/or prevent, binding of CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) to CXCL12 (and/or CXCLll) and in particular human CXCL12 (NM_O006O9) and/or in particular human CXCLll (U66096), and thus to modulate, and in particular inhibit or prevent, the signalling that is mediated by CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) and/or CXCL12 (and/or CXCLll) and in particular human CXCL12 ( __000609) and/or in particular human CXCLll (U66096), to modulate the biological pathways in which CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) and/or CXCL12 (and/or CXCLll) and in particular human CXCL12 (NM_000609) and/or in particular human CXCLll (U66096) are involved, and
  • the polypeptides and compositions of the present invention ca be used for the diagnosis, prevention and treatment of diseases and disorders of the present invention (herein also “diseases and disorders of the present invention”) and include, but are not limited to cancer, e.g., carcinomas, gliomas, mesotheliomas, melanomas, lymphomas, leukemias, adenocarcinomas, breast cancer, ovarian cancer, cervical cancer, glioblastoma, leukemia, lymphoma, prostate cancer, a d Burkitt's lymphoma, head and neck cancer, colon cancer, colorectal cancer, non-small cell lung cancer, small cell lung cancer, cancer of the esophagus, stomach cancer, pancreatic cancer, hepatobiliary cancer, cancer of the gallbladder, cancer of the small intestine, rectal cancer, kidney cancer, bladder cancer, prostate cancer, penile cancer, urethral cancer, testicular cancer, cervical cancer, vaginal cancer, uter
  • ncers preferably head a nd neck cancer, as well as brain and neuronal dysfunction, such as Alzheimer's disease and multiple sclerosis; kid ney dysfunction, re nal a llograft rejection; nasa l polyposis; rheumatoid a rthritis; cardiac a llograft rejection; ca rdiac dysfunction; atherosclerosis; asthma; glomerulonephritis; co ntact dermatitis; inflammatory bowel disease; colitis; psoriasis; re perfusio n injury; as well as other d isorders and d iseases described herein.
  • Alzheimer's disease and multiple sclerosis kid ney dysfunction, re nal a llograft rejection; nasa l polyposis; rheumatoid a rthritis; cardiac a llograft rejection; ca rdiac dysfunction; atherosclerosis; asthma;
  • the polypeptides and compositions of the present invention ca n be used for the diagnosis, prevention a nd treatment of diseases involving CXCR7 mediated metastasis, chemotaxis, cell adhesion, trans endothelial migration, celi proliferation and/or survival .
  • said "diseases a nd disorders of the present invention” can be defined as diseases and disorders that can be diagnosed, prevented and/or treated, respectively, by suitably administering to a subject in need thereof (i.e., having the disease or disorder or at least one symptom thereof and/or at risk of attracting or developing the disease or disorder) of either a polypeptide or composition of the invention (a nd in pa rticular, of a pha rmaceutically active amount thereof) and/or of a known active principle active against CXC 7 and in particular human CXCR7 (SEQ ID NO; 1) or a biological pathway or mecha nism in which CXC 7 and in particular hu man CXCR7 (SEQ ID NO : 1) is involved (a nd in particular, of a pharmaceutically active amount thereof).
  • a polypeptide or composition of the invention a nd in pa rticular, of a pha rmaceutically active amount thereof
  • the polypeptides of the present invention ca n be used for the diagnosis, prevention and treatment of d iseases a nd d isorders of the present invention which a re cha racterized by excessive and/or unwanted CXCL12 a nd in particular human CXCL12 signalling mediated by CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) or by the pathway(s) in which CXCR7 and in particular human CXCR7 (SEQ ID NO : 1) is involved ⁇ e.g., CXCLl l/l-TAC - CXCR7 axis ⁇ .
  • diseases and disorders of the present invention will agai n be clear to the skilled person based on the disclosure herein.
  • the immunoglobulin single variable domains and polypeptides of the i nvention ca n for example be used to diagnose, prevent and/or to treat all diseases a nd disorders that are currently being diagnosed, prevented or treated with active principles that can modulate CXCR7 and in particular human CXCR7 (SEQ ID NO: l)-mediated signalling, such as those mentioned in the prior art cited herein. It is also e nvisaged that the polypeptides of the invention can be used to diagnose, prevent and/or to treat all diseases a nd disorders for which treatment with such active principles is currently being developed, has been proposed, or will be proposed or develo ped in future.
  • polypeptides of the present invention may be used for the diagnosis, prevention and treatment of other diseases and disorders than those for which these known active principles are being used or will be proposed or developed; and/or that the polypeptides of the present invention may provide new methods and regimens for treating the diseases and disorders described herein.
  • Other applications and uses of the immunoglobulin single variable domains and polypeptides of the invention will become clear to the skilled person from the further disclosure herein.
  • immunoglobulin single variable domains that are directed against CXCR7, in particular against CXCR7 from a warm-blooded animal, more in particular against CXCR7 from a mammal such as e.g., mouse, and especially against human CXC 7 (SEQ ID NO: 1); and to provide proteins and polypeptides comprising or essentially consisting of at least one such immunoglobulin single variable domain.
  • CXCR7 such as the diseases, disorders and conditions mentioned herein
  • these objects are achieved by the use of the immunoglobulin single variable domains, proteins, polypeptides and compositions that are described herein.
  • the invention provides immunoglobulin single variable domains that are directed against (as defined herein) and/or can specifically bind (as defined herein) to CXCR7 and in particular human CXCR7 (SEQ !D NO: 1); as well as compounds and constructs, and in particular proteins and polypeptides, that comprise at least one such amino acid sequence.
  • the invention provides immunoglobulin single variable domains and polypeptides that can bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) with an affinity (suitably measured and/or expressed as a K 0 -value (actual or apparent), a K A -vaiue (actual or apparent), a karate and/or a k ofr rate, or alternatively as an IC S0 value, as further described herein) that is as defined herein; as well as compounds and constructs, and in particular proteins and polypeptides, that comprise at least one such amino acid sequence.
  • the immunoglobulin single variable domains and/or polypeptides of the invention are such that they: bind to human CXCR7 (SEQ ID NO: 1) with an EC50 of ⁇ or lower, more preferably of 50nM or lower, even more preferably of 20nM or lower, most preferably of ⁇ or lower in a binding
  • polypeptides comprise only one human CXCR7 binding immunoglobulin single variable domain unit; and/or such that they: - fully displace human CXCL12 (SDF-1) from human CXCR7 (SEQ ID NO: 1) at an average Ki value of 100 nM or less, more preferably at an average Ki value of 20nM or less, even more preferably at an average Ki value of ⁇ or less in an assay as e.g., described in the experimental part (Exam ples 9 and 10), and wherein the polypeptides co m prise only one huma n CXCR7 binding immunoglobulin single varia ble domai n unit, and where in full displacement means an average CXCL12 d isplacement of about 60% to 80% and more (e.g., when measured acco rding to the liga nd displacement assay of Example 9) or wherein full displacement means an average CXCL12 displacement of
  • polypeptides comprise only one huma n CXCR7 binding immunoglobulin single variable domain unit
  • full displacement means an average CXCLll displacement of about 60% to 80% and more [e.g., when measured according to the ligand displacement assay of Example 9) or wherein full displacement means an average CXCL12 displacement of about 80% to 100% a nd more (when measured according to the FACS based competition assay of Example 10) d/or such that they: partially d isplace human CXCL12 (SDF-1) from human CXCR7 (SEQ ID NO: 1) at an average Ki value of 100 nM or less, more prefera bly at a n average Ki value of 20nM or less, even more preferably at a n average Ki value of ⁇ or less in an assay as e.g.
  • polypeptides comprise only one human CXCR7 binding immunoglobulin single variable domain u it, and wherein partial d isplacement means a n average CXCL12 displace ment of a bout 40% to 60% (e.g.
  • pa rtial displacement means an average CXCL12 displacement of about 50% to 80% (when measured according to the FACS based competition assay of Exa mple 10) ; d/or such that they: partial ly d isplace human CXCLll (I-TAC) from human CXCR7 (SEQ I D NO: 1) at an average Ki value of ⁇ or less, more preferably at an average Ki value 500n or less, even more preferably at an average Kt value lOOnM or less, even more preferably at a n average Ki value of 20n or less, even more preferably at an average Ki va lue of lOntvl or less in an assay as e.g.
  • I-TAC human CXCLll
  • polypeptides comprise only one human CXC 7 binding immunoglobulin single va ria ble domain unit, a nd wherein partial displacement means an average CXCLl l displacement of about 40% to 60% (e .g., when measured according to the ligand displacement assay of Exam ple 9) or wherein partia l displacement means an average CXCL12 displacement of a bout 50% to 80% (when measured according to the FACS based competition assay of Example 10), and/or such that they: bind human CXCR7 (SEQ ID NO: 1) with an average Kd va lue of 100 n or less, more preferably at an average Kd value of 50 nM or less, even more preferably at an average Kd value of 40 nM or less, such as less than 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 3 nM or even less, such as less than 1 nM, or most preferably even less than 0.1 nM
  • binding of the immunoglobulin single va riable doma ins and/or polypeptides of the invention to (human) CXCR7 may result in displacing (huma n) CXCLll and/or CXCL12 from (human) CXCR7 as described herein . It should further be a ppreciated that binding of the immunoglobulin single variable domains and/or polypeptides of the invention to (human) CXC 7 may result in inhibiting binding of (huma n) CXCLl l and/or CXCL12 to its cognate receptor, such as, (huma n) CXCR7 as described herein.
  • the invention provides: amino acid sequences that are directed against (as defined herein) CXCR7 and that are capable of inh ibiting or blocking (fully or partially, as further described herein) liga nd binding, and in particular of inhibiting or blocking (fully or partia lly, as further described herein) the binding of SDF-1 to CXCR7 (as further described herein).
  • amino acid sequences a re also referred to herein as "CXCR-7 binding amino acid sequences" or "CXCR7 binding blocks”.
  • these CXCR7-binding amino acid sequences are lSVD's (as described herein), in which case they are also referred to as "CXCR7 -binding ISVD's".
  • CXCR7 -binding ISVD's any CXCR7-binding a mino acid sequences, CXCR7-binding building blocks or CXCR7-binding ISVD's are such that they have blocking activity, i.e. block SDF-1 bind ing to CXCR7 partially or completely, which can be determined by a ny suitable assay known to the person skilled in the art, such as, for instance, by an Alphascreen assay or by a FACS competition assay (e.g. as described herein).
  • the blocking activity is determined by a FACS competition assay as described in Example 9.
  • the ISVD has a blocking activity or com petition ca pacity in NIH3T3-hCXCR7 cells of blocking or competing SDF-1 binding to CXCR7 with an average Ki of less than 600 n s, but preferably, 500 nMs, 400 nMs, 300 n Ms, 200 nMs, 100 nMs or even less.
  • the OlClO-like ISVD has a blocking activity or competition capacity in this assay with an average Ki of less than 100 nfVIs, more preferably, less than 75 nMs, 50 nMs or even less, such as less than 40 n Ms or 30 nMs, 25 n Ms or 24 n Ms or even more preferably of less tha n 22 n Ms.
  • the 14G03-like ISVD has a blocking activity or competition capacity in this assay with an average Ki of less than 150 nMs, more preferably, less than 100 n Ms, 90 nMs, 80 nMs or even less, such as less than 70 n Ms or 60 nMs, 50 nMs or 40 nMs, 30 n Ms, 20 n Ms, 15 n Ms or 10 nMs, 5 n Ms o even more preferably of less tha n 4 nMs.
  • Ki of less than 150 nMs, more preferably, less than 100 n Ms, 90 nMs, 80 nMs or even less, such as less than 70 n Ms or 60 nMs, 50 nMs or 40 nMs, 30 n Ms, 20 n Ms, 15 n Ms or 10 nMs, 5 n Ms o even more preferably of less tha n 4 nMs.
  • CXCR-7 binding amino acid sequences or “CXCR7 binding blocks” may (a nd preferably a lso are) be such that they are capa ble of inhibiting or blocking ⁇ -arrestin recruitment (see Example 15).
  • any CXCR7-binding amino acid sequences, CXCR7-binding building blocks or CXCR7- binding ISVD's are such that they have blocking activity, i.e.
  • SD F-1 mediated CXCR7 signalling pa rtially or completely which can be determined by any suitable assay known to the person skilled in the art, such as, for instance, by any suita ble ⁇ -arrestin recruitment assay, as described herein.
  • the blocking activity or inhibiting ca pacity is determined by a ⁇ -arrestin assay as described in Example 15.
  • the ISVD has a blocki ng activity or an inhibition capacity of ligand (e.g.SDF- 1) induced ⁇ -a rrestin in the Path H under express ⁇ -a rrestin assay (Discove rX) with a % inhibition of ⁇ - a rrestin recruitment of more than 25%, more than 30%, but preferably, 40%, 50%, 60%, 70%, 80% or even more.
  • the 14G03-like ISVD has a blocking activity or inhibition ca pacity in this assay with a % inhibition of more than 50%, more preferably, more than 60%, 70% or even more, such as more tha n 75% or 80%, 85%, or even more preferably of more tha n 90%.
  • OlClO-like sequences a "OlClO-like sequence ", "OlClO-like ISVD", "OlClO-like building block” or "Group 1 ISVDs " is defined as an ISVD (as described herein) that comprises:
  • a CDR1 which comprises or essentially consists of either (i) the amino acid sequence YA G (SEQ ID NO: 93) or (si) a n amino acid seq ue nce that has only 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence NYAMG (SEQ ID NO: 93); and/or b) a CDR2 which comprises or essentially consists of either (i) the amino acid sequence A ITP RAFTTYYA DS V G (SEQ ID NO: 95) or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence AITPRAFTTYYADSVKG (SEQ ID NO: 95); or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence AITPRAFTTYYADSVKG (SEQ ID NO: 95); and/or
  • a CDR3 which comprises or essentially consists of either (i) the amino acid sequence QLVGSGS N LG RQESYAY (SEQ ID NO: 97) or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence QLVGSGSNLG RQESYAY (SEQ ID NO: 97); or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence QLVGSGSNLG RQESYAY (SEQ ID NO: 97); in which the framework sequences present in such an ISVD are as further described herein, and in which CDRl, CDR2 and CDR3 are preferably such that the OlClO-like ISVD has blocking activity, e.g.
  • (some of the) OlClO-like sequences may (and preferably also are) be such that they are capable of inhibiting, blocking or displacing SDF-1 binding (see Examples 9 and
  • CDRl and CDR2 are as defined under a) and b), respectively; or CDRl and CDR3 are as defined under a) and c), respectively; or CDR2 and CDR3 are as defined under b) and c), respectively. More preferably, in such a OlClO-like sequence, CDRl, CDR2 and CDR3 are all as defined under a), b) and c), respectively. Again, in such an OlClO-like sequence, CDRl, CDR2 and
  • CDR3 are preferably such that the OlClO-like ISVD has blocking activity, e.g. block SDF-1 binding to CXCR7 partially or completely as described herein, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or binds and/or recognizes amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • blocking activity e.g. block SDF-1 binding to CXCR7 partially or completely as described herein, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or binds and/or recognizes amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • CDRl may comprise or essentially consist of the amino acid sequence NYAMG (SEQ ID NO: 93) (with CDR2 and CDR3 being as defined under b) and c), respectively); and/or CDR2 may comprise or essentially consist of the amino acid sequence AITPRAFTTYYADSVKG (SEQ SD NO: 95) (with CDRl and CDR3 being as defined under a) and c), respectively); and/or CDR3 may comprise or essentially consist of the amino acid sequence QLVGSGSNLGRQESYAY (SEQ ID NO: 97) (with CDRl and CDR2 being as defined under a) and b), respectively).
  • CDRl may comprise or essentially consist of the amino acid sequence NYAMG (SEQ ID NO: 93) and CDR2 may comprise or essentially consist of the amino acid sequence AITPRAFTTYYADSVKG (SEQ I D NO: 95) (with CDR3 being as defined under c) above); and/or CDRl may comprise or essentially consist of the amino acid sequence NYAMG (SEQ ID NO: 93) and CDR3 may com rise or essentially consist of the amino acid sequence QLVGSGS LG QESYAY (SEQ ID NO: 97) (with CDR2 being as defined under b) above); and/or CDR2 may comprise or essentially consist of the amino acid sequence A ITP R A FTTYYA D S KG (SEQ ID NO: 95) and CDR3 may comprise or essentially consist of the amino acid sequence QLVGSGSNLGRQESYAY (SEQ ID NO: 97) (with CDRl being as defined under a) above).
  • CDRl, CDR2 and CDR3 are preferably such that the OlClO-like ISVD has blocking activity, e.g. block SDF-1 binding to CXCR7 partially or completely as described herein and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or binds and/or recognizes amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • blocking activity e.g. block SDF-1 binding to CXCR7 partially or completely as described herein and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or binds and/or recognizes amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • a "OlClO-like sequence", “OlClO-like ISVD", “OlClO-like building block” or “Group 1 ISVD” is an ISVD that comprises: d) a CDRl which is either (i) the amino acid sequence NYAMG (SEQ ID NO: 93) or (ii) an amino acid sequence that has only 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence NYAMG (SEQ ID NO: 93); and/or
  • a CDR2 which is either (i) the amino acid sequence AITPRAFTTYYADSVKG (SEQ ID NO: 95) or (it) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence AITPRAFTTYYADSVKG (SEQ ID NO: 95); or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence AITPRAFTTYYADSVKG (SEQ ID NO: 95); and/or
  • a CDR3 which is either (i) the amino acid sequence QLVGSGSNLGRQESYAY (SEQ ID NO: 97) or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence QLVGSGSNLGRQESYAY (SEQ ID NO: 97); or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence QLVGSGSNLGRQESYAY (SEQ ID NO: 97); in which the framework sequences present in such an ISVD are as further described herein, and in which CDRl, CDR2 and CDR3 are preferably such that the OlClO-like ISVD has blocking activity, e.g., block SDF-1 binding to CXCR7 partially or completely as described herein and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or
  • CDRl and CDR2 are as defined under d) and e), respectively; or CDRl and CDR3 are as defined under d) and f), respectively; or CDR2 and CDR3 are as defined under e) and f), respectively. More preferably, in such a OlClO-like sequence, CDRl, CDR2 and CDR3 are all as defined under d), e) and f), respectively.
  • an OlClO-like sequence are all as defined under d), e) and f), respectively.
  • CDRl, CDR2 and CDR3 are preferably such that the OlClO-like ISVD has blocking activity, e.g. block SDF-1 binding to CXCR7 partially or completely as described herein, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/o binds and/or recognizes amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • blocking activity e.g. block SDF-1 binding to CXCR7 partially or completely as described herein, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/o binds and/or recognizes amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • CDRl is the amino acid sequence NYAMG (SEQ ID NO: 93) (with CDR2 and CDR3 being as defined under e) and f), respectively); and/or CDR2 is the amino acid sequence A I TP R A FTTY YA D SV KG (SEQ ID NO: 95 ⁇ (with CDRl and CDR3 being as defined under d) and f), respectively); and/or CDR3 is the amino acid sequence QLVGSGSN LG RQESYAY (SEQ ID NO: 97) (with CDRl and CDR2 being as defined under d) and e), respectively).
  • CDRl is the amino acid sequence NYAMG (SEQ ID NO: 93) and CDR2 is the amino acid sequence AITPRAFTTYYADSVKG (SEQ ID NO: 95) (with CDR3 being as defined under f) above); and/or CDRl is the amino acid sequence NYAMG (SEQ I D NO: 93 ⁇ and CDR3 is the amino acid sequence QLVGSGSNLG RQESYAY (SEQ ID NO: 97 ⁇ (with CDR2 being as defined under e) above); and/or CDR2 is the amino acid sequence AITPRAFTTYYADSVKG (SEQ ID NO: 95) and CDR3 is QLVGSGSNLG RQESYAY (SEQ ID NO: 97) (with CDRl being as defined under d) above).
  • CDRl, CDR2 and CDR3 are preferably such that the OlClO-like ISVD has blocking activity, e.g., block SDF-1 binding to CXC 7 partially or completely as described herein, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or binds and/or recognizes amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • blocking activity e.g., block SDF-1 binding to CXC 7 partially or completely as described herein, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or binds and/or recognizes amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • CDR1 is the amino acid sequence NYAMG (SEQ ID NO: 93 ⁇
  • CDR2 is the amino acid sequence AJTPRAFTTYYADSVKG (SEQ ID NO: 95)
  • CDR3 is the amino acid sequence QLVGSGSNLGRQESYAY (SEQ ID NO: 97).
  • the framework sequences may be as further described herein.
  • the framework sequences are such that the framework sequences have at least 80%, such as at least 85%, for example at least 90%, such as at least 95% sequence identity with the framework sequences of 01C10 (which, for example, can be determined by determining the overall degree of sequence identity of a given sequence with the sequence of 01C10 while disregarding the CDR's in the calculation).
  • the combination of CDR's and frameworks present in a given sequence are preferably such that the resulting 01C10- like ISVD has blocking activity, e.g., block SDF-1 binding to CXCR7 partially or completely as described herein and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or binds and/or recognizes amino acid residue W19, and optionally amino acid residue 523 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • blocking activity e.g., block SDF-1 binding to CXCR7 partially or completely as described herein and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or binds and/or recognizes amino acid residue W19, and optionally amino acid residue 523 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • a OlClO-like sequence is an ISVD that has at least 70%, such at least 80%, for example at least 85%, such as at least 90% or more than 95% sequence identity with the amino acid sequence 01C10 (SEQ ID NO: 91),
  • the CDR's may be according to the specifically preferred aspect described above, and may in particularly (but without limitation) be NYAMG (SEQ ID NO: 93) (CDR1); AITPRAFTTYYADSVKG (SEQ ID NO: 95) (CDR2); and QLVGSGSNLGRQESYAY (SEQ ID NO: 97) (CDR3).
  • the combination of CDR's and frameworks present in such a OlClO-like ISVD are preferably such that the resulting OlClO-like ISVD has blocking activity, e.g. block SDF-1 binding to CXCR7 partially or completely as described herein and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or binds and/or recognizes amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • any OlClO-like sequence may be a humanized and/or sequence optimized sequence, as further described herein.
  • 14G03-like sequences a "14GQ3-iike sequence", "14G03-like ISVD", "14G03-Iike building block” or "Group 2 ISVDs" is defined as an ISVD (as described herein) that comprises:
  • a CDR1 which comprises or essentially consists of either (i) the amino acid sequence INYMG (SEQ ID NO: 13) or (ii) an amino acid sequence that has only 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence INYMG (SEQ 10 NO: 13); and/or b) a CDR2 which comprises or essentially consists of either (i) the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23) or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23); or (Hi) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23); and/or
  • a CDR3 which comprises or essentially consists of either (i) the amino acid sequence
  • GGTLYDRRRFES (SEQ ID NO: 33) or (it) an amino acid sequence that has at least 80%, such as at least 85%, for exam le at least 90% or more than 95% sequence identity with the amino acid sequence GGTLYDRRRFES (SEQ ID NO: 33); or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence GGTLYDRRRFES (SEQ ID NO: 33);
  • the framework sequences present in such an SSVD are as further described herein, and in which CDR1, CDR2 and CDR3 are preferably such that the 14G03-like ISVD has blocking activity, e.g. block CXCL11 and/or CXCL12 binding to CXCR7 partially or completely as described above, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or inhibits ⁇ - arrestin recruitment, and/or binds and/or recognizes amino acid residue M33, and optionally amino acid residue V32 and/or amino acid residue M37 in CXC 7 (SEQ ID NO: 1), all as described herein.
  • blocking activity e.g. block CXCL11 and/or CXCL12 binding to CXCR7 partially or completely as described above, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or inhibits ⁇ - arrestin recruitment, and/or binds and/or recognizes amino acid residue M33, and optionally amino
  • (some of the) 14G03-like sequences may (and preferably also are) be such that they are capable of inhibiting, blocking or displacing SDF-1 binding (see Examples 9 and 10), for example in the displacement assay used in Example 10.
  • CDR1 and CDR2 are as defined under a) and b), respectively; or CDR1 and CDR3 are as defined under a) and c), respectively; or CDR2 and CDR3 are as defined under b) and c), respectively.
  • CDR1, CDR2 and CDR3 are all as defined under a), b) and c), respectively.
  • CDR1, CDR2 and CDR3 are preferably such that the 14G03-like ISVD has blocking activity, e.g. block SDF-1 binding to CXCR7 partially or completely as described herein, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or inhibits ⁇ -arrestin recruitment, and/or binds and/or recognizes amino acid residue IV133, and optionally amino acid residue V32 and/or amino acid residue 37 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • blocking activity e.g. block SDF-1 binding to CXCR7 partially or completely as described herein, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or inhibits ⁇ -arrestin recruitment, and/or binds and/or recognizes amino acid residue IV133, and optionally amino acid residue V32 and/or amino acid residue 37 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • CDR1 may comprise or essentially consist of the amino acid sequence INYMG (SEQ ID NO: 13) (with CDR2 and CDR3 being as defined under b) and c), respectively); and/or CDR2 may comprise or essentially consist of the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23) (with CDR1 and CDR3 being as defined under a) and c), respectively); and/or CDR3 may comprise or essentially consist of the amino acid sequence GGTLYDRRRFES (SEQ ID NO: 33) (with CDR1 and CDR2 being as defined under a) and b), respectively).
  • CDR1 may comprise or essentially consist of the amino acid sequence INY G (SEQ ID NO: 13) and CDR2 may comprise or essentially consist of the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23) (with CDR3 being as defined under c) above); and/or CDR1 may comprise or essentially consist of the amino acid sequence INYMG (SEQ ID NO: 13) and CDR3 may comprise or essentially consist of the amino acid sequence GGTLYDRRRFES (SEQ ID NO: 33) (with CDR2 being as defined under b) above); and/or CDR2 may comprise or essentially consist of the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23) and CDR3 may comprise or essentially consist of the amino acid sequence GGTLYDRRRFES (SEQ ID NO: 33) (with CDR1 being as defined under a) above).
  • CDR1, CDR2 and CDR3 are preferably such that the 14G03-like ISVD has blocking activity, e.g. block SDF-1 binding to CXCR7 partially or completely as described herein and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or inhibits ⁇ -arrestin recruitment, and/or binds and/or recognizes amino acid residue M33, and optionally amino acid residue V32 and/or amino acid residue M37 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • blocking activity e.g. block SDF-1 binding to CXCR7 partially or completely as described herein and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or inhibits ⁇ -arrestin recruitment, and/or binds and/or recognizes amino acid residue M33, and optionally amino acid residue V32 and/or amino acid residue M37 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • a "14G03-iike sequence", “14G03-like ISVD", “14G03-like building block” or “Group 2 ISVD” is an ISVD that comprises: d) a CDR1 which is either (i) the amino acid sequence INYMG (SEQ ID NO: 13) or (ii) an amino acid sequence that has only 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence INYMG (SEQ ID NO: 13); and/or
  • a CDR2 which is either (i) the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23) or (si) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23); or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23); and/or
  • a CDR3 which is either (i) the amino acid sequence GGTLYDRRRFES (SEQ ID NO: 33) or (ii) an amino acid sequence that has at least 80%, such as at least 85%, for example at least 90% or more than 95% sequence identity with the amino acid sequence GGTLYDRRRFES (SEQ ID NO:
  • CDR1, CDR2 and CDR3 are preferably such that the 14G03-like ISVD has blocking activity, e.g. block SDF-1 binding to CXCR7 partially or completely as described herein and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or inhibits ⁇ -arrestin recruitment, and/or binds a nd/or recognizes amino acid residue M33, a nd optionally amino acid residue V32 and/or amino acid residue 37 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • CD R2 are as defined under d) and e), respectively; or CDRl and CDR3 are as defined under d) a nd f), respectively; or CDR2 and CDR3 are as defined under e) and f), respectively. More preferably, in such a 14G03-!ike sequence, CDRl, CDR2 a nd CDR3 are a ll as defined under d ), e) and f), respectively. Again, in such an 14G03-iike sequence, CDR l, CDR2 and CDR3 are prefe rably such that the 14G03-like ISVD has blocking activity, e.g.
  • CDRl is the amino acid seq uence INYMG (SEQ ID NO: 13) (with CDR2 a nd CDR3 being as defined under e) and f), respectively); and/or CDR2 is the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23) (with CDRl and CDR3 being as defined under d) and f), respectively); and/or CDR3 is the amino acid seq ue nce GGTLYDRRRFES (SEQ ID NO: 33) (with CDR l and CDR2 being as defined under d ) a nd e), respectively).
  • CDRl is the amino acid sequence INYMG (SEQ ID NO: 13) and CDR2 is the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23) (with CDR3 being as defined under f) above); and/or CDRl is the amino acid seq uence I NYMG (SEQ I D NO: 13) and CDR3 is the amino acid sequence GGTLYDRRRFES (SEQ ID NO: 33) (with CDR2 being as defined under e) above); and/or CDR2 is the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23) and CDR3 is GGTLYDRRRFES (SEQ I D
  • CDRl, CDR2 a nd CDR3 are prefera bly such that the 14G03-like ISVD has blocking activity, e.g. block SDF-1 binding to CXCR7 partia lly or completely as described herein, and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or inhibits ⁇ -arrestin recruitment, and/or binds and/or recognizes amino acid residue M33, and optiona lly amino acid residue V32 a nd/or amino acid resid ue M37 in CXCR7 (SEQ ID NO : 1), all as described herein.
  • CDRl is the am ino acid sequence I NYMG (SEQ ID NO: 13)
  • CDR2 is the amino acid sequence TLTSGGSTNYAGSVKG (SEQ ID NO: 23)
  • CDR3 is the a m ino acid sequence GGTLYDRRRFES (SEQ ID NO: 33).
  • the framework sequences may be as further described herein.
  • the framework sequences are such that the framework sequences have at least 80%, such as at least 85%, for example at least 90%, such as at least 95% sequence identity with the framework sequences of 14G03 (which, for example, can be determined by determining the overall degree of sequence identity of a given sequence with the sequence of 14G03 while disregarding the CDR's in the calculation).
  • the combination of CDR's and frameworks present in a given sequence are preferably such that the resulting 14G03- like ISVD has blocking activity, e.g.
  • a 14G03-like sequence is an ISVD that has at least 70%, such at least 80%, for example at least 85%, such as at least 90% or more than 95% sequence identity with the amino acid sequence 14G03 (SEQ ID NO: 43).
  • the CDR's may be according to the specifically preferred aspect described above, and may in particularly (but without limitation) be INYMG (SEQ ID NO: 13) (CDR1); TLTSGGSTNYAGSVKG (SEQ ID NO: 23) (CDR2); and GGTLYDRRRFES (SEQ ID NO: 33) (CDR3).
  • the combination of CDR's and frameworks present in such a 14G03-like ISVD are preferably such that the resulting 14G03-like ISVD has blocking activity, e.g., block SDF-1 binding to CXCR7 partially or completely as described herein and/or reducing and/or inhibiting tumorigenesis in a xenograph model, and/or inhibits ⁇ -arrestin recruitment, and/or binds and/or recognizes amino acid residue 33, and optionally amino acid residue V32 and/or amino acid residue M37 in CXCR7 (SEQ ID NO: 1), all as described herein.
  • any 14G03-like sequence may be a humanized and/or sequence optimized sequence, as further described herein.
  • an amino acid sequence or polypeptide of the invention will usually contain within its amino acid sequence one or more amino acid residues or one or more stretches of amino acid residues ⁇ i.e., with each "stretch” comprising two or amino acid residues that are adjacent to each other or in close proximity to each other, i.e., in the primary o tertiary structure of the amino acid sequence) via which the amino acid sequence of the invention can bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1), which amino acid residues or stretches of amino acid residues thus form the "site" for binding to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) (also referred to herein as the "antigen binding site").
  • the immunoglobulin single variable domains provided by the invention are preferably in essentially isolated form (as defined herein), or form part of a protein or polypeptide of the invention (as defined herein), which may comprise or essentially consist of one or more immunoglobulin single variable domains of the invention and which may optionally further comprise one or more further immunoglobulin single variable domains (all optionally linked via one or more suitable linkers), and/or one or more further binding domains, binding units, amino acid sequences or other (functional) groups or moieties, that preferably also confer one or more desired properties to the constructs (some non-limiting examples of the same will become clear from the further description herein).
  • the polypeptides or immunoglobulin single variable domains provided by the invention preferentially reduce tumorigenesis in vivo.
  • the invention provides constructs comprising at least two immunoglobulin single variable domains against CXCR7. More preferably, said immunoglobulin single variable domains against CXCR7 are selected from variants of polypeptides and immunoglobulin single variable domains against CXCR7 as defined in section 1.5 in respect of Table B-2 infra ⁇ e.g., Group 2 immunoglobulin single variable domains), wherein said immunoglobulin single variable domains against CXCR7 may be the same or different.
  • said two immunoglobulin single variable domains against CXCR7 are chosen from 14G03-like ISVDs, such as 14G03, 08A05, 08A10, 07C03 and 07B11.
  • the invention provides constructs comprising at least two immunoglobulin single variable domains against CXCR7 are selected from varia ts of polypeptides and immunoglobulin single variable domains against CXCR7 which as defined in section 1.5 in respect of Table B-2 infra (e.g., Group 1 immunoglobulin single variable domains), wherein said immunoglobulin single variable domains against CXCR7 may be the same or different.
  • said two immunoglobulin single va iable domains against CXCR7 are chosen from 01C10 (SEQ ID NO: 91), 01812 (SEQ ID NO: 100), 01F11 (SEQ ID NO: 101) or 01B10 (SEQ ID NO: 102).
  • bispecific constructs comprising at least one Group 1 immunoglobulin single variable domain and at least one Group 2 ISVD are especially suitable for reducing tumour growth in vivo.
  • these constructs inhibit SDF-1 binding to CXCR7, inhibit tumour growth in vivo, as well as inhibit ⁇ -arrestin recruitment.
  • these constructs comprising at least one Group 1 ISVD and at least one Group 2 ISVD bind better to the target (see e.g., Example 17). This would result in a lower dose for inhibiting tumour growth.
  • the simultaneous inhibition of ⁇ -arrestin recruitment would result in a prolonged anti-tumorigenic effect.
  • the invention provides constructs comprising at least two immunoglobulin single variable domains against CXC 7, wherein at least one of said immunoglobulin single variable domains against CXCR7 ⁇ i.e., a "first" immunoglobulin single variable domains against CXCR7 ⁇ is OlClO-like, such as for instance 01C10 ⁇ SEQ ID NO: 91), 01B12 ⁇ SEQ ID NO: 100), 01F11 (SEQ ID NO: 101) or 01B10 (SEQ ID NO: 102), or variants thereof as defined in section 1.5 in respect of Table 8-2 infra (e.g., Group 1 immunoglobulin single variable domains), and wherein at least one immunoglobulin single variable domains against CXCR7 (i.e., a "second" immunoglobulin single variable domain against CXCR7) is selected from variants of polypeptides and immunoglobulin single variable domains against CXCR7 as defined in section 1.5 infra in respect of Table
  • said "first" immunoglobulin single variable domains against CXCR7 is 01C10 and said "second” immunoglobulin single variable domains against CXCR7 is chosen from the group consisting of 14G03-iike, such as for instance, 14G03, 08A05, 08A10, 07CO3 and 07B11.
  • binding to CXCR7 by the Group 1 immunoglobulin single variable domains as represented by 01C10 was influenced by mutating W19.
  • binding of ail tested immunoglobulin single variable domains was affected by a M33 mutation, while Group 1 ISVDs were not. It was further shown that Group 1 iSVDs preferably recognize and/or bind also S23 and D25 (data not shown).
  • Group 1 ISVDs or polypeptides can be characterized by binding/recognizing "Group 1 epitope".
  • Group 1 ISVDs or polypeptides bind and/or recognize amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1).
  • Group 1 epitope comprises amino acid residue W19, and optionally amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1).
  • Group 1 ISVDs is represented by inter alia 01C10 (SEQ ID NO: 91), 01B12 (SEQ ID NO: 100), 01F11 (SEQ ID NO: 101) or 01B10 (SEQ ID NO: 102), apparently hitting an epitope distinct from Group 2 epitope;
  • Group 2 ISVDs or polypeptides can be characterized by binding/recognizing "Group 2 epitope".
  • Group 2 ISVDs or polypeptides do not bind and/or recognize amino acid residue W19, amino acid residue S23 and/or amino acid residue D25 in CXCR7 (SEQ ID NO: 1).
  • Group 2 ISVDs or polypeptides bind and/or recognize amino acid residue M33, and optionally amino acid residue V32 and/or amino acid residue IV137 in CXCR7 (SEQ ID NO: 1).
  • Group 2 epitope comprises amino acid residue M33, and optionally amino acid residue V32 and/or amino acid residue M37 in CXCR7 (SEQ ID NO: 1).
  • Group 2 ISVDs a re represented by 14G03-!ike ISVDs, such as for instance, 14G03 (09A04), 08A05, 08A10 and 07CG3, apparently hitting an epitope distinct from Group 1.
  • Group 2 ISVDs inhibit ⁇ - arrestin recruitment, as defined herein;
  • G roup 3 ISVDs or polypeptides can be cha racterized by binding/recognizing (pa rt of) "Group 1" epitope as well as (part of) "Group 2" epitope.
  • Group 3 ISVDs or polypeptides is represented by 07S11, a pparently intermedia ry to Group 1 and Group 2.
  • the present invention relates to polypeptides ISVDs, as well as (conventional) antibodies, or parts thereof, such as Fc, Fa , minibodies, etc., recognizing and/or binding W19, and optionally S23 and/or D25 in CXCR7.
  • anti-CXCR7/CXCR7 bispecific constructs may be suitably ha lf-life extended (e.g., by pegyiation, fusion to serum a lbumin, or fusion to a peptide or binding unit that ca n bind to a seru m protein such as serum album in, as further described herein), and thus may for exam ple further com prise a serum-a lbumin binding peptide or binding domain (such as those described herein), optionally linked via one or more suitable spacers or linkers.
  • binding domains, binding units, amino acid seque nces or other (functional) groups or moieties include one or more other immunoglobulin single variable domains, such as one or more (single) domain antibodies, dAb's or Nanobodies (e.g., a V H H, humanized V HH or camelized V H , such as a camelized human V H ), so as to provide a "bispecific" protein or polypeptide of the invention (i.
  • polypeptide of the invention that contains at least one - such as one or two - immunoglobulin single variable domain that is directed against CXCR7 and at least one - such as one or two - i mmunoglobulin single varia ble doma in that is directed aga inst another target).
  • the constructs, proteins or polypeptides of the invention may have been provided with an increased half-life, for example by functionalisation and/or by includ ing in the construct a moiety or binding unit that increases the half-life of the construct.
  • functionalisation, moieties or binding units will be clear to the skilled person and may for example include pegyiation, fusion to serum albumin, or fusion to a peptide or binding unit that can bind to a serum protein such as serum albumin .
  • the serum-aibumin binding peptide or binding doma in may be any suita ble serum-albumin binding peptide or binding domain capa ble of increasing the ha if- life of the construct (compared to the same construct without the serum-albumin binding peptide or binding domain), and may in particular be serum albumin binding peptides as described in WO 2008/068280 by applicant (and in particular WO 2009/127691 and WO 2011/095545, both by applicant), or a serum-albumin binding immunoglobulin single variable domain (such as a serum- albumin binding Nanobody; for example Alb-1 or a humanized version of Alb-1 such as Alb-8, for which reference is for example made to WO 06/122787).
  • the half-life of a construct or polypeptide of the invention can (and preferably is) suitably “tailored” for the intended (therapeutic and/or diagnostic) application and/or to obtain the best balance between the desired therapeutic and/or pharmacological effect and possible undesired side-effects.
  • a preferred aspect of the invention provides a "bispecific" polypeptide consisting essentially of one immunoglobulin single variable domain directed against human CXCR7 (or, alternatively, of two immunoglobulin single variable domains directed against human CXCR7, which may be the same or different, so as to provide - when they are the same or different - a "bivalent” polypeptide of the invention, or - when they are different - "biparatopic" polypeptide of the invention) and one immunoglobulin single variable domain directed against human serum albumin linked by a peptide linker (as defined herein), so as to provide a bispecific polypeptide of the invention, respectively, all as described herein.
  • a protein or polypeptide may also be in essentially isolated form (as defined herein).
  • an amino acid sequence (such as a Nanobody) of the invention or a polypeptide of the invention (such as a bivalent, biparatopic or bispecific polypeptide of the invention) may be suitably linked (again, chemically or via one or more suitable linkers or spacers) to a toxin or to a (cyto)toxic residue, moiety or payioad.
  • cytotoxic moieties, compounds, payloads or residues which can be linked to amino acids sequences or polypeptides of the invention to provide - for example - a cytotoxic compound (i.e., a antibody- drug conjugate or "ADC" based upon an amino acid sequence or polypeptide of the invention) will be clear to the skilled person.
  • ADC antibody- drug conjugate
  • cytotoxic amino acid sequences or polypeptides of the invention may in particular be useful/suitable for those applications in which it is intended to kill a cell that expresses the target against which the amino acid sequences or polypeptides of the invention are directed (e.g.
  • (cyto)toxic polypeptides of the invention will 3 either not be ha!f-life extended or will have only a limited and/or tightly controlled ha lf-life extension.
  • At least one amino acid sequence of the invention i.e., immunoglobulin single variable domain aga inst CXCR7
  • immunoglobulin single variable domain aga inst CXCR7
  • CXCR4 immunoglobulin single variable domain aga inst CXCR4
  • at least one amino acid sequence of the invention may be suita bly lin ked to at least one immunoglobulin single variable domain that is directed against CXCR4, so as to provide a bispecific polypeptide of the invention that is directed against both CXCR7 and CXCR4.
  • At least one - such as one o r two - am ino acid seq uences of the invention may be suita bly linked to at least one - such as one or two -immunoglobulin single varia ble domains aga inst CXCR4.
  • imm unoglobulin single variable domains against CXCR4 that can be used in such constructs a re (or may be suitably chosen from) the imm u noglobulin single va riable domains (a nd in particula r one of the Na nobodies) against CXCR4 from the international application WO 09/138519 by Ablynx N.V. (for exa mple and without limitatio n, 238D2/SEQ I D NO: 238 a nd 238D4/SEQ ID NO : 239 in Table B- l.
  • anti-CXCR7/CXCR4 bispecific constructs may be suitably ha lf-life extended (e.g., by pegylation, fusion to serum a lbumin, or fusion to a peptide or binding unit that can bind to a serum protein such as serum a lbumin, as further described herein), and thus may fo r example further comprise a serum-albumin binding peptide or bind ing domain (such as those described herein), optionally linked via one or more suitable spacers o linkers.
  • one specific but non-limiting aspect of the invention is a polypeptide that comprises one or two (and preferably one) immunoglobulin single va ria ble domains (as defined herein, and preferably one or two Nanobodies) against CXCR7, one or two (and prefera ly one) immunoglobulin single va riable domains (as defined herein, and preferably one or two Na nobodies) aga inst CXCR4, and a peptide or imm unoglobulin single variable domain against (human) serum albumin, optionally suitably linked via one or more spacers or linkers.
  • the above anti-CXCR7/CXCR4 bispecific constructs may also be suitably linked (aga in, chemically or via one or more suitable linkers or spacers) to a toxin or to a ( cytotoxic residue, moiety or payioad (as further described herein). Aga in, such (cyto)toxic bispecfic polypeptides of the invention will either not be ha if- life extended or will have only a limited and/or tightly controlled half-life extension.
  • a lso comprises derivatives of the amino acid sequences (e.g., Nanobodies) of the invention and of the polypeptides of the invention.
  • Such derivatives can genera lly be obtained by modification, a nd in particular by chemica l and/or biological (e.g. enzymatical) modification, of the amino acid sequences (e.g., Nanobodies) of the invention and polypeptides of the invention and/or of one or more of the amino acid residues that form the Nanobodies of the invention.
  • such a modification may involve the introduction (e.g., by covalent lin king or in a nother suita ble manner) of one or more functional groups, residues or moieties into or onto the amino acid sequences (e. g., Na nobodies) of the invention and polypeptides of the invention, and in particular of one or more functional groups, resid ues or moieties that confer one or more desired properties or functiona lities to the Nanobody of the invention.
  • functional groups wil l be clear to the skilled person.
  • such modification may comprise the introduction ⁇ e.g., by covalent binding or in any other suitable manner) of one or more functional groups that increase the half-life, the solubility and/or the absorption of the Nanobody of the invention, that reduce the immunogenicity and/or the toxicity of the Nanobody of the invention, that eliminate or attenuate any undesirable side effects of the Nanobody of the invention, and/or that confer other advantageous properties to and/or reduce the undesired properties of the Nanobodies and/or polypeptides of the invention; or any combination of two or more of the foregoing.
  • Such functional groups can generally comprise all functional groups and techniques mentioned in the general background art cited hereinabove as well as the functional groups and techniques known per se for the modification of pharmaceutical proteins, and in particular for the modification of antibodies or antibody fragments (including ScFv's and single domain antibodies), for which reference is for example made to Remington's Pharmaceutical Sciences, 16th ed., Mack Publishing Co., Easton, PA (1980).
  • Such functional groups may for example be linked directly (for example covalently) to a Nanobody of the invention, or optionally via a suitable linker or spacer, as will again be clear to the skilled person.
  • One of the most widely used techniques for increasing the half-life and/or reducing the immunogenicity of pharmaceutical proteins comprises attachment of a suitable pharmacologically acceptable polymer, such as poly(ethyleneglycol) (PEG) or derivatives thereof (such as methoxypoly(ethyleneglycol) or mPEG).
  • PEG poly(ethyleneglycol)
  • derivatives thereof such as methoxypoly(ethyleneglycol) or mPEG.
  • pegylation can be used, such as the pegylation used in the art for antibodies and antibody fragments (including but not limited to (single) domain antibodies and ScFv's); reference is made to for example Chapman, Nat. Biotechnoi., 54, 531-545 (2002); by Veronese and Harris, Adv. Drug Deliv. Rev. 54, 453-456 (2003), by Harris and Chess, Nat. Rev.
  • PEG may be attached to a cysteine residue that naturally occurs in a Nanobody of the invention
  • a Nanobody of the invention may be modified so as to suitably introduce one or more cysteine residues for attachment of PEG, or an amino acid sequence comprising one or more cysteine residues for attachment of PEG may be fused to the N- and/or C-terminus of a Nanobody of the invention, ail using techniques of protein engineering known per se to the skilled person.
  • a PEG is used with a molecular weight of more than 5000, such as more than 10,000 and less than 200,000, such as less than 100,000; for example in the range of 20,000-80,000.
  • Another, usually less preferred modification comprises N-!inked or O-linked glycosylation, usually as part of co-translational and/or post-translational modification, depending on the host cell used for expressing the Nanobody or polypeptide of the invention.
  • Yet another modification may comprise the introduction of one or more detectable labels or other signal-generating groups or moieties, depending on the intended use of the labelled Nanobody.
  • Suitable labels and techniques for attaching, using and detecting them will be clear to the skilled person, and for example include, but are not limited to, the fluorescent labels, phosphorescent labels, chemiluminescent labels, bioiuminescent labels, radio-isotopes, metals, metal chelates, metallic cations, chromophores and enzymes, such as those mentioned on page 109 of WO 08/020079.
  • Other suitable labels will be clear to the skilled person, and for example include moieties that can be detected using NMR or ESR spectroscopy.
  • Nanobodies a d polypeptides of the invention may for example be used for in vitro, in vivo or in situ assays (including immunoassays known per se such as ELISA, RIA, EIA and other "sandwich assays", etc.) as well as in vivo diagnostic and imaging purposes, depending on the choice of the specific label.
  • a chelating group for example to chelate one of the metals or metallic cations referred to above.
  • Suitable chelating groups for example include, without limitation, diethyl-enetriaminepentaacetic acid (DTP A) or ethy!enediaminetetraacetic acid (EDTA).
  • Yet another modification may comprise the introduction of a functional group that is one part of a specific binding pair, such as the biotin-(strept)avidin binding pair.
  • a functional group may be used to iink the Nanobody of the invention to another protein, polypeptide or chemical compound that is bound to the other half of the binding pair, i.e., through formation of the binding pair.
  • a Nanobody of the invention may be conjugated to biotin, and linked to another protein, polypeptide, compound or carrier conjugated to avidin or streptavidin.
  • such a conjugated Nanobody may be used as a reporter, for example in a diagnostic system where a detectable signal-producing agent is conjugated to avidin or streptavidin.
  • binding pairs may for example also be used to bind the Nanobody of the invention to a carrier, including carriers suitable for pharmaceutical purposes.
  • a carrier including carriers suitable for pharmaceutical purposes.
  • One non-limiting example are the liposomal formulations described by Cao and Suresh, Journal of Drug Targetting, 8, 4, 257 (2000).
  • Such binding pairs may also be used to link a therapeutically active agent to the Nanobody of the invention.
  • the imm unoglobulin single va ria ble domai ns a nd polypeptides of the invention as such preferably esse ntially consist of a single amino acid chain that is not linked via d isuiphide bridges to any other am ino acid sequence or chain (but that may or may not contain one or more intramolecular disu i phide bridges.
  • agent of the invention - as described herein - may sometimes contain a disuiphide bridge between CDR3 a nd CDR1 or FR2).
  • one or more immunoglobulin single variable domains of the invention may be linked to each other and/or to other im m unoglobulin single va riable domains (e.g., via d isuiphide bridges) to provide peptide constructs that may also be useful in the invention (fo r example Fab' fragments, F(ab' fragments, ScFv constructs, "d iabodies” and other m ultispecific constructs.
  • Fab' fragments fragments
  • F(ab' fragments, ScFv constructs, "d iabodies” and other m ultispecific constructs.
  • an amino acid sequence of the invention (or a compound, construct or polypeptide comprising the same) is intended for administration to a subject (for example for therapeutic and/or diagnostic purposes as described herein), it is preferably either an am ino acid sequence that does not occur natura lly in sa id subject; or, when it does occur natura lly in said subject, is in essentially isolated form (as defined herein).
  • the imm unoglobulin single va riable domains of the invention are preferably directed against human CXCR7 and in particular human CXCR7 (SEQ. ID NO:
  • the immunoglobulin single va ria ble domains and polypeptides of the invention are preferably directed against CXCR7 from the species to be treated, or at least cross-reactive with CXCR7 from the species to be treated .
  • an am ino acid sequence of the invention may optionally, and in addition to the at least one binding site for binding against CXCR7 and in particular human CXCR7 (SEQ ID NO : 1), contain one or more further binding sites for binding against other antigens, proteins or ta rgets.
  • the efficacy of the immunoglobulin single varia ble domains and polypeptides of the invention, and of com positions comprising the same, can be tested using a y suitable in vitro assay, cell-based assay, in vivo assay and/or animal model known per se, or any combination thereof, depend ing on the specific d isease or disorder involved.
  • Suitable assays and a nimal models will be clear to the skilled person, and for example include ligand displacement assays (Burns et a l, J. Exp. ed . 2006 4;203(9):2201-13), beta arrestin recruitment assays (Zabel et al., J. Immunol. 2009 1;183(5) :3204-
  • immunoglobulin single variable domains and polypeptides that are directed against CXCR7 from a first species of warm-blooded animal may or may not show cross- reactivity with CXCR7 from one or more other species of warm-blooded animal.
  • immunoglobulin single variable domains and polypeptides directed against human CXCR7 and in particular human CXCR7 may or may not show cross reactivity with CXCR7 from one or more other species of primates (such as, without limitation, monkeys from the genus Macaco (such as, and in particular, cynomolgus monkeys ⁇ Macaca fascicularis) and/or rhesus monkeys ⁇ Macaca mulatto)) and baboon ⁇ Papio ursinus)) and/or with CXCR7 from one or more species of animals that are often used in animal models for diseases (for example mouse, rat, rabbit, pig or dog), and in particular in animal models for diseases and disorders associated with CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) (such as the species and animal models mentioned herein).
  • primates such as, without limitation, monkeys from the genus Macaco (such as, and in particular, cynomolgus monkeys ⁇
  • immunoglobulin single variable domains and polypeptides of the invention that are cross-reactive with CXCR7 from multiple species of mammal will usually be advantageous for use in veterinary applications, since it will allow the same amino acid sequence or polypeptide to be used across multiple species.
  • immunoglobulin single variable domains and polypeptides directed against CXCR7 from one species of animal can be used in the treatment of another species of animal, as long as the use of the immunoglobulin single variable domains and/or polypeptides provide the desired effects in the species to be treated.
  • the present invention is in its broadest sense also not particularly lim ited to or defined by a specific antigenic determinant, epitope, part domain, subunit or confirmation ⁇ where applicable) of CXCR7 and in particula r human CXCR7 (SEQ ID NO: 1) against which the immunoglobulin single varia ble domains and polypeptides of the invention are directed .
  • the immunoglobulin single variable domains and polypeptides may or may not be d irected against the CXCL11/CXCL12 interaction site and/or CXC 7/CXCR7 homodimerization site and/or CXCR4/CXCR7 hetero- dimerization site (or heterodimerization of CXCR7 to other chemokine receptor such as e.g. CXCR3), and are as further defined herein.
  • a polypeptide of the invention may contain two or more imm unoglobulin single variable domains of the invention that are directed against CXC 7 and in particular human CXCR7 (SEQ ID NO: 1). Generally, such polypeptides will bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1 ⁇ with increased avid ity compared to a single amino acid sequence of the invention.
  • Such a polypeptide may for example comprise two immunoglobulin single varia ble doma ins of the invention that a re directed against the same antigenic determinant, epitope, part, doma in, subunit or confirmation (where applicable) of CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) (which may or may not be an interaction site); or comprise at least one "first" amino acid sequence of the invention that is directed against a first same antigenic determinant, epitope, part, doma in, subunit or confirmation (where applicable) of CXCR7 and in particular huma n CXCR7 (SEQ ID NO: 1) (which may or may not be a n interaction site), such as for instance Group 1 epitopes; and at least one "second" a mino acid sequence of the invention that is directed against a second antigenic determinant, epitope, part, domain, subunit or confirmation (where applicable) different from the first (and which aga in may or may not be an interaction site)
  • polypeptides of the invention may be formatted e. g., in a biparatopic way such as to combine monovalent building blocks directed against different epitopes as characterized in the experimenta l part (see Exam ples 9 to 17).
  • binding constants e.
  • the immunoglobulin single variable domains and polypeptides may be such that they compete with the cognate binding partners, e.g., CXCL11 (also referred to as l-TAC) and/or CXCL12 (also referred to as SDF-1), for binding to CXCR7, and/or such that they (fully or partially) neutralize binding of the binding partner to the target.
  • CXCL11 also referred to as l-TAC
  • CXCL12 also referred to as SDF-1
  • the immunoglobulin single variable domains and polypeptides of the invention will generally bind to all naturally occurring or synthetic analogs, variants, mutants, alleles, parts and fragments of CXCR7 and in particular human CXCR7 (SEQ ID NO: 1); or at least to those analogs, variants, mutants, alleles, parts and fragments of CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) that contain one or more antigenic determinants or epitopes that are essentially the same as the antigenic determinant(s) or epitope(s) to which the immunoglobulin single variable domains and polypeptides of the invention bind to CXCR7 and in particular to human CXCR7 (SEQ ID NO: 1).
  • the immunoglobulin single variable domains and polypeptides of the invention may bind to such analogs, variants, mutants, alleles, parts and fragments with an affinity and/or specificity that are the same as, or that are different from ⁇ i.e., higher than or lower than), the affinity and specificity with which the immunoglobulin single variable domains of the invention bind to (wild-type) CXCR7.
  • CXCR7 and in particular human CXCR7 exists in a monomeric form and in one or more multimeric forms, e.g., in homodimeric as well in heterodimeric form with CXCR4, e.g., human CXCR4 (R Maksym et al., supra; KE Luker et al.
  • the immunoglobulin single variable domains and polypeptides of the invention i) only bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) in monomeric form, it) only bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) in multimeric/dimeric (homo- and/or heterodimeric) form, or tii) bind to both the monomeric and the multimeric form.
  • the polypeptides of the invention prevent formation of homodimeric human CXCR7 complexes and/or heterodimeric human CXCR4/CXCR7 complexes.
  • the polypeptides of the invention do not induce (even at higher concentration such as ⁇ or less, SOnSvl or less, ⁇ or less, or SOOnM or less) formation of homodimeric human CXCR7 complexes and/or heterodimeric human CXCR4/CXCR7 complexes.
  • the polypeptides of the invention may bind to the monomeric form with an affinity and/or specificity that are the same as, or that are different from (i.e., higher than or lower than), the affinity and specificity with which the immunoglobulin single variable domains of the invention bind to the multimeric form.
  • CXCR7 and in particular human CXCR7 can associate with other proteins or polypeptides to form protein complexes [e.g., with CXCL12/SDF-1 or CXCL11/I-TAC)
  • the immunoglobulin single variable domains and polypeptides of the invention bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1 ⁇ in its non-associated state (and e.g. prevent the ligand binding), bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) in its associated state, or bind to both (preferably to the non-associated state).
  • the immunoglobulin single variable domains and polypeptides of the invention may bind to such associated protein complexes with an affinity and/or specificity that may be the same as or different from ⁇ i.e., higher than or lower than) the affinity and/or specificity with which the immunoglobulin single variable domains and polypeptides of the invention bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) in its non-associated state.
  • proteins or polypeptides that contain two or more immunoglobulin single variable domains directed against CXCR7 and in particular human CXCR7 may bind with higher avidity to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) than the corresponding monomeric amino acid sequence(s).
  • proteins or polypeptides that contain two or more immunoglobulin single variable domains directed against different epitopes of CXCR7 and in particular human CXCR7 may (and usually will) bind with higher avidity than each of the different monomers
  • proteins or polypeptides that contain two o more immunoglobulin single variable domains directed against CXCR7 and in particular human CXCR7 may (and usually will) bind also with higher avidity to a muitimer (e.g. homodimer, heterodimer with CXCR4) of CXCR7 and in particular to a muitimer (e.g. homodimer, heterodimer with human CXCR4) of human CXCR7 (SEQ ID NO: 1).
  • immunoglobulin single variable domains and polypeptides of the invention will at least bind to those forms of CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) (including monomeric, multimeric, associated and different conformational forms) that are the most relevant from a biological and/or therapeutic point of view, as will be clear to the skilled person.
  • Such parts, fragments, ana logs, mutants, variants, alleles and/or derivatives will usually contain (at least part of) a functional antigen-binding site for binding against CXCR7 and in particular human CXCR7 (SEQ ID NO: 1); and more preferably will be capable of specific binding to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1), and even more preferably capable of binding to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) with an EC50 value, average Ki, !CSQ value concerning binding, migration, displacing and/or proliferation blocking and/or other measures for potency, as further described herein, e.g., in the experimental part) that is as defined herein and such parts, fragments, analogs, mutants, variants, alleles and/or derivatives may be more potent, more stable, more soluble and may have the same epitope.
  • fragments or polypeptides of the invention may also be provided by suitably combining (i.e. by linking or genetic fusion) one or more (smaller) parts or fragments as described herein.
  • immunoglobulin single variable domains For a general description of immunoglobulin single variable domains, reference is made to the further description below, as well as to the prior art cited herein. In this respect, it should however be noted that this description and the prior art mainly describes immunoglobulin single variable domains of the so-called "V H 3 class" ⁇ i.e., immunoglobulin single variable domains with a high degree of sequence homology to human germline sequences of the V H 3 class, such as D -47, DP-51 or DP- 29), which form a preferred aspect of this invention.
  • V H 3 class immunoglobulin single variable domains of the so-called "V H 3 class” ⁇ i.e., immunoglobulin single variable domains with a high degree of sequence homology to human germline sequences of the V H 3 class, such as D -47, DP-51 or DP- 29
  • the invention in its broadest sense generally covers any type of immunoglobulin single variable domains directed against CXC 7 and in particular human CXCR7 (SEQ ID NO: 1), and for example aiso covers the immunoglobulin single variable domains belonging to the so-called "V H 4 class" ⁇ i.e., immunoglobulin single variable domains with a high degree of sequence homology to human germline sequences of the V render4 class such as DP-78), as for example described in WO 07/118670.
  • immunoglobulin single variable domains in particular V HH sequences and sequence optimized immunoglobulin single variable domains
  • V HH sequences and sequence optimized immunoglobulin single variable domains can in particular be characterized by the presence of one or more "Hallmark residues" (as described herein) in one or more of the framework sequences (again as further described herein).
  • an immunoglobulin single variable domain can be defined as an amino acid sequence with the (general) structure
  • FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4 in which FR1 to FR4 refer to framework regions 1 to 4, respectively, and in which CDR1 to CDR3 refer to the complementarity determining regions 1 to 3, respectively.
  • the invention provides polypeptides comprising at least an immunoglobulin single variable domain that is an amino acid sequence with the (general) structure
  • FR1 to FR4 refer to framework regions 1 to 4, respectively, and in which CDR1 to CDR3 refer to the complementarity determining regions 1 to 3, respectively, and in which: i) at least one of the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the Kabat numbering are chosen from the Hallmark residues mentioned in Table A- 1 below; and/or in which: ii) said amino acid sequence has at least 80%, more preferably 90%, even more preferably 95% amino acid identity with at least one of the immunoglobulin single variable domains as shown in
  • WO 2009/138519 see SEQ ID NOs: 1 to 125 in WO 2009/138519, in which for the purposes of determining the degree of amino acid identity, the amino acid residues that form the CDR sequences (indicated with X in the sequences) are disregarded; and/or in which: iii) the CDR sequences are generally as further defined herein (e.g.
  • the CDR1, CDR2 and CDR3 in a combination as provided in Table 8-2 note that the CDR definitions are calculated according to the Kabat numbering system); and/or in which: iv) the FR sequences are generally as further defined herein, such as, for instance, the FRl, FR2, FR3 and FR4 in a combination as provided in Table B-2, and/or FRl, FR2, FR3 and FR4 has at least 80%, more preferably 90%, even more preferably 95% amino acid identity with at least one of FRl, FR2, FR3 and FR4, respectively, of the FRs as provided in Table B-2 (wherein the FR definitions are calculated according to the Kabat numbering system).
  • V 1 1 L, V; predominantly L, S, V, M, W, F, T, Q, E, A, R, G, K, Y, N, P, I; preferably L
  • V F usually V F (1) , Y, V, L, A, H, S, I, W, C, N, G, D, T, P, preferably F ) or
  • R or K usually R R. K w , T, E (5) , Q, N, S, I, V, G. M, L, A, D, Y, H; preferably
  • K or R most preferably K
  • G G, A, S, T, D, P, N, E, C, L; preferably G
  • KERE or KQRE at positions 43-46 e.g. as KEREL, KEREF, KQREL, KQREF, KEREG, KQREW or KQREG at positions 43-47.
  • sequences such as TERE (for example TEREL), TQRE (for example TQREL), KECE (for example KEGEL or KECER), KQCE (for example KQCEL), RERE (for example REREG), RQRE (for example RQREL, RQREF or RQREW), QERE (for example QEREG), QQRE, (for example QQREW, QQREL or QQREF), KGRE (for example KGREG), KDRE (for example KDREV) are possible.
  • Some other possible, but less preferred sequences include for example DECKL and NVCEL.
  • positions 44-47 are GLEW
  • position 108 is always Q in (non-humanized) V HH sequences that also contain a W at 103.
  • the GLEW group also contains GLEW-like sequences at positions 44-47, such as for example GVEW, EPEW, GLER, DQEW, BLEW, GIEW, BLEW, GPEW, EWLP, GPER, GLER and ELEW.
  • GVEW GVEW
  • EPEW EPEW
  • GLER DQEW
  • BLEW GIEW
  • BLEW GPEW
  • EWLP GPER
  • GLER and ELEW immunoglobulin single variable domains
  • immunoglobulin single variable domains may be derived in any suitable manner and from any suita ble source, and may for example be naturally occurring V HH sequences (i.e., from a suita ble species of Camelid, e.g., llama) or synthetic or semi-synthetic VHs or VLs ⁇ e.g., from human) .
  • Such im munoglobulin single variable domains may include "humanized” or otherwise “sequence optimized” VH Hs, "camelized” immunoglobulin sequences (and in particular camelized heavy chain variable domain sequences, i.e., camelized VHs), as well as human VHs, human VLs, camelid VHHs that have been a lte red by techniques such as affinity maturation (for example, sta rting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, veneering, combining fragments derived from d ifferent immunoglobulin sequences, PGR assem bly using overlapping primers, and similar techniques for engineering i mmunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing as further described herein.
  • affinity maturation for example, sta rting from synthetic, random or naturally occurring immunoglobulin sequences
  • CDR grafting for example, sta rting from synthetic, random or naturally
  • the invention provides polypeptides comprising one immunoglobulin single variable doma in with a mino acid sequence selected from the group consisting of a mino acid sequences with SEQ ID NOs: 39 to 43 and 91 as well as 99-102 (see Table B-3) and one immunoglobulin single va riable domain with amino acid sequence selected from the group consisting of moieties providing an increased half-life (see below).
  • the invention provides polypeptides comprising at least one imm unoglobulin single va riable domain with amino acid sequence selected from the group consisting of amino acid sequences that essentially consist of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which the CDR sequences of said am ino acid sequences have at least 70% a mino acid identity, prefera bly at least 80% amino acid identity, more preferably at least 90% amino acid identity, such as 95% amino acid identity o r more or even essentially 100% amino acid identity with the CDR sequences of at least one of the imm unoglobulin singie variable doma ins of SEQ ID NOs: 39 to 43 a nd 91 as well as 99-102 (see Ta bles B-2 and 8-3 ).
  • amino acid sequences selected from the group consisting of amino acid sequences that essentially consist of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to
  • This degree of amino acid identity can for example be determined by determining the degree of amino acid identity (in a manner described herein) between said a mino acid sequence and one or more of the sequences of SEQ ID NOs: 39 to 43 a nd 91 as well as 99-102 (see Tables B-2 and B-3), in which the amino acid residues that form the framework regions a re disregarded.
  • Such polypeptides and/or immunoglobulin single variable domains of the invention may further provide the following:
  • polypeptides comprising at least one imm unoglobulin single va ria ble domain that is d irected against (as defined herein) CXCR7 and in particula r huma n CXCR7 (SEQ ID NO: 1) and that has at least 80%, preferably at least 85%, such as 90% or 95% or more sequence identity with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 39 to 43 and 91 as well as 99- 102 (see Table B-3);
  • polypeptides comprising at least one immunoglobulin single variable domain that is directed against (as defined herein) CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) and that cross- block (as defined herein) the binding of at least one of the immunoglobulin single variable domains of SEQ ID NOs: 39 to 43 and 91 as well as 99-102 (see Table B-3) to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) and/or that compete with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 39 to 43 and 91 as well as 99-102 (see Table B-3) for binding to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1); and
  • immunoglobulin single variable domains may be as further described herein; as well as polypeptides of the invention that comprise one or more of such immunoglobulin single variable domains (which may be as further described herein, and may for example be bispecific ⁇ e.g., also bind to serum albumin) and/or biparatopic polypeptides as described herein), and nucleic acid sequences that encode such immunoglobulin single variable domains and polypeptides.
  • immunoglobulin single variable domains and polypeptides do not include any naturally occurring ligands.
  • polypeptides of the invention comprise or essentially consist of at least one immunoglobulin single variable domain of the invention.
  • immunoglobulin single variable domains of the invention are given in SEQ ID NOs: 39 to 43 and 91 as well as 99-102 (see Table B-3).
  • the invention relates to a compound or construct, and in particular to a protein or polypeptide (also referred to herein as a "compound of the invention” or “polypeptide of the invention", respectively) that comprises or essentially consists of one or more (preferably one) immunoglobulin single variable domains directed to human CXCR7 (or suitable fragments thereof), and optionally further comprises one or more other groups, residues, moieties or binding units.
  • a protein or polypeptide also referred to herein as a "compound of the invention” or “polypeptide of the invention”
  • a protein or polypeptide also referred to herein as a "compound of the invention” or “polypeptide of the invention”
  • immunoglobulin single variable domains of the invention may or may not provide further functionality to the amino acid sequence of the invention (and/or to the compound or construct in which it is present) a d may or may not modify the properties of the amino acid sequence of the invention.
  • immunoglobulin single variable domains of the invention can be used as "building blocks" to form polypeptides of the invention, i.e.
  • the compounds or polypeptides of the invention can generally be prepared by a method which comprises at least one step of suitably linking the one or more immunoglobulin single variable domains of the invention to the one or more further groups, residues, moieties or binding units, optionally via the one or more suitable linkers, so as to provide the compound or polypeptide of the invention.
  • Polypeptides of the invention ca also be prepared by a method which generally comprises at least the steps of providing a nucleic acid that encodes a polypeptide of the invention, expressing said nucleic acid in a suitable manner, and recovering the expressed polypeptide of the invention. Such methods ca be performed in a manner known per se, which will be clear to the skilled person, for example on the basis of the methods and techniques further described herein.
  • such further groups, residues, moieties or binding units may be one or more additional immunoglobulin single variable domains, such that the compound or construct is a (fusion) protein or (fusion) polypeptide.
  • said one or more other groups, residues, moieties or binding units are immunoglobulin sequences.
  • said one or more other groups, residues, moieties or binding units are chosen from the group consisting of domain antibodies, immunoglobulin single variable domains that are suitable for use as a domain antibody, single domain antibodies, immunoglobulin single variable domains that are suitable for use as a single domain antibody, "dAb's", immunoglobulin single variable domains that are suitable for use as a dAb, or Nanobodies.
  • such groups, residues, moieties or binding units may for example be chemical groups, residues, moieties, which may or may not by themselves be biologically and/or pharmacologically active.
  • such groups may be linked to the one or more immunoglobulin single variable domains of the invention so as to provide a "derivative" of an amino acid sequence or polypeptide of the invention, as further described herein.
  • compounds or constructs that comprises or essentially consists of one or more derivatives as described herein, and optionally further comprises one or more other groups, residues, moieties or binding units, optionally linked via one or more linkers.
  • said one or more other groups, residues, moieties or binding units are immunoglobulin single variable domains.
  • the one or more immunoglobulin single variable domains of the invention and the one or more groups, residues, moieties or binding units may be linked directly to each other and/or via one or more suitable linkers or spacers.
  • the linkers may also be immunoglobulin single variable domains, so that the resulting compound or construct is a fusion (protein) or fusion (polypeptide).
  • the polypeptides of the invention have an increased half-life in serum (as further described herein) compared to the immunoglobulin single variable domain from which they have been derived.
  • an immunoglobulin single variable domain of the invention may be linked (chemically or otherwise) to one or more groups or moieties that extend the half-life (such as PEG), so as to provide a derivative of an amino acid sequence of the invention with increased half-life.
  • a compound of the invention or a polypeptide of the invention may have an increased half-life, compared to the corresponding amino acid sequence of the invention.
  • immunoglobulin single variable domains or polypeptides of the invention that have been chemically modified to increase the half-life thereof (for example, by means of pegylation); immunoglobulin single variable domains of the invention that comprise at least one additional binding site for binding to a serum protein (such as serum albumin); or polypeptides of the invention that comprise at least one amino acid sequence of the invention that is linked to at least one moiety (and in particular at least one amino acid sequence) that increases the ha If- life of the amino acid sequence of the invention.
  • polypeptides of the invention that comprise such half-life extending moieties or immunoglobulin single variable domains will become clear to the skilled person based on the further disclosure herein; and for example include, without limitation, polypeptides in which the one or more immunoglobulin single variable domains of the invention are suitably linked to one or more serum proteins or fragments thereof (such as (human) serum albumin or suitable fragments thereof) or to one or more binding units that can bind to serum proteins (such as, for example, domain antibodies, immunoglobulin single variable domains that are suitable for use as a domain antibody, single domain antibodies, immunoglobulin single variable domains that are suitable for use as a single domain antibody, "dAb's", immunoglobulin single variable domains that are suitable for use as a dAb, or Nanobodies that can bind to serum proteins such as serum albumin (such as human serum albumin), serum immunoglobulins such as IgG, or transferrin; reference is made to the further description and references mentioned herein); polypeptides in
  • the compounds or polypeptides of the invention with increased half-life preferably have a half-life that is at least 1.5 times, preferably at least 2 times, such as at least 5 times, for example at least 10 times or more than 20 times, greater than the half-life of the corresponding amino acid sequence of the invention per se.
  • the compounds or polypeptides of the invention with increased half-life may have a half-life e.g., in humans that is increased with more than 1 hours, preferably more than 2 hours, more preferably more than 6 hours, such as more than 12 hours, or even more than 24, 48 or 72 hours, compared to the corresponding amino acid sequence of the invention per se.
  • such compounds or polypeptides of the invention have a serum half-life e.g., in humans that is increased with more than 1 hours, preferably more than 2 hours, more preferably more than 6 hours, such as more than 12 hours, or even more than 24, 48 or 72 hours, compared to the corresponding amino acid sequence of the invention per se.
  • such compounds or polypeptides of the invention exhibit a serum half-life in human of at least about 12 hours, preferably at least 24 hours, more preferably at least 48 hours, even more preferably at least 72 hours or more.
  • compounds or polypeptides of the invention may have a half-life of at least 5 days (such as about 5 to 10 days), preferably at least 9 days (such as about 9 to 14 days), more preferably at least about 10 days (such as about 10 to 15 days), or at least about 11 days (such as about 11 to 16 days), more preferably at least about 12 days (such as about 12 to 18 days or more), or more than 14 days (such as about 14 to 19 days).
  • the invention provides a polypeptide of the invention comprising i) one CXCR7 binding imm unoglobulin single varia ble domain as described herein; and ii) one or more (preferably one) serum albumin binding immunoglobulin single variable doma in as described herein.
  • the invention provides a polypeptide of the invention comprising i) one or more CXCR7 binding immunoglobulin single variable domain as described herein; a nd ii) one or more (preferably one) serum a lbumin bind ing immunoglobulin single variable doma in of SEQ ID NO: 2 (Table B-l) .
  • the invention provides a polypeptide of the invention comprising i) one or more CXCR7 binding imm unoglobulin single va riable domain as described herein; and ii) one or more (preferably one) serum albumin binding immunoglobulin single variable doma in with CDRs (defined according to the Kabat numbering) of SEQ I D NO: 2 (Table B-2, B-l) .
  • proteins or polypeptides that comprise or essentially consist of a single imm unoglobulin single varia ble domain will be referred to he rein as “monovalent” proteins or polypeptides or as “monovalent constructs” .
  • Proteins and polypeptides that comprise or essentially consist of two or more immunoglobulin single va ria ble doma ins such as at least two im m unoglobulin single variable domains of the invention or at least one immunoglobulin single va riable domain of the invention and at least one other imm unoglobulin single variable domain
  • multivalent proteins or polypeptides or as “multivalent constructs” may provide certain adva ntages compa red to the co rresponding monovalent immunoglobulin single variable domai ns of the invention.
  • a polypeptide of the invention comprises or essentially consists of at least one immunoglobulin single variable domain of the invention and at least one other binding unit (i.e. directed against another epitope, antigen, ta rget, protein or polypeptide), which is preferably a lso a immunoglobulin single variable domain.
  • Such proteins or polypeptides a re also referred to herein as "multispecific” proteins or polypeptides or as "multispecific constructs", a nd these may comprise of two immunoglobulin single variable domains of the invention, such as one immunoglobulin single variable domain d irected against CXCR7 a nd one immunoglobulin single variable domain against serum albumin.
  • multispecific immunoglobulin single variable domains are the constructs of SEQ. ID NOs: 44 to 48, 80-81, 83-85 and 88-89 as well as 131-140 (see Table B-4), as well as clones 009, 013, 018-029, 031-038, 044, 046, 048-053, 055-058, 060, 061, 063, 065, 068, 069, 072, 081-086 and 093 (Tables B- 12 to B-14).
  • a polypeptide of the invention comprises or essentially consists of at least one immunogiobulin single variable domain of the invention, optionally one or more further immunoglobulin single variable domains, and at least one other amino acid sequence (such as a protein or polypeptide ⁇ that confers at least one desired property to the immunoglobulin single variable domain of the invention and/or to the resulting fusion protein.
  • fusion proteins may provide certain advantages compared to the corresponding monovalent immunoglobulin single variable domains of the invention such as e.g. may provide an increased ha!f-life.
  • the one or more immunoglobulin single variable domains and/or other immunoglobulin single variable domains may be directly linked to each other and/or suitably linked to each other via one or more linker sequences.
  • linkers Some suitable but non-limiting examples of such linkers will become clear from the further description herein.
  • the linker sequence joining the immunoglobulin single variable domains are SEQ ID NOs: 49 to 58 - see Table B-5, or a combination of both, o as known in the art.
  • a polypeptide of the invention may for example be chosen from the group consisting of immunoglobulin single variable domains that have more than 80%, preferably more than 90%, more preferably more than 95%, such as 99% or more "sequence identity" (as defined herein) with one or more of the immunoglobulin single variable domains of SEQ ID NOs: 39 to 43 and 91 as well as 99-102 (see Table B-3), in which the polypeptides are preferably as further defined herein, i.e., in the preferred format of one immunoglobulin single variable domain directed against CXCR7 and one immunoglobulin singe variable domain directed against serum albumin.
  • a polypeptide of the invention may for example be chosen from the group consisting of polypeptides that have more than 80%, preferably more than 90%, more preferably more than 95%, such as 99% or more "sequence identity" (as defined herein) with one or more of the polypeptides of SEQ ID NOs: 44 to 48 (see Table B-4).
  • biparatopic and bispecific polypeptides of the invention are given in SEQ ID NOs: 78 to 89 as well as SEQ ID NOs: 131-140, or clones 009, 013, 018-029, 031-038, 044, 046, 048-053, 055-058, 060, 061, 063, 065, 068, 069, 072, 081-086 and 093 (Tables B-12 to B- 14).
  • the polypeptides of the invention may be formulated as a pharmaceutical preparation or composition comprising at least one polypeptide of the invention and at least one pharmaceutically acceptable carrier, diluent or excipient and/or adjuvant, and optionally one or more further pharmaceutically active polypeptides and/or compounds.
  • a formulation may be in a form suitable for oral administration, for parenteral administration (such as by intravenous, intramuscular or subcutaneous injection or intravenous infusion), for topical administration, for administration by inhalation, by a skin patch, by an implant, by a suppository, etc. wherein which the parenteral administration is preferred.
  • Such suitable administration forms which may be solid, semi-solid or liquid, depending on the manner of administration - as well as methods and carriers for use in the preparation thereof, will be clear to the skilled person, and are further described herein.
  • a pharmaceutical preparation or composition will generally be referred to herein as a "pharmaceutical composition”.
  • a pharmaceutical preparation or composition for use in a non-human organism will generally be referred to herein as a "veterinary composition”.
  • the invention relates to a pharmaceutical composition that contains at least one amino acid of the invention, at least one polypeptide of the invention or at least one polypeptide of the invention and at least one suitable carrier, diluent or excipient ⁇ i.e., suitable for pharmaceutical use), and optionally one or more further active substances.
  • polypeptides of the invention can be formulated and administered in any suitable manner known per se.
  • polypeptides of the invention may be formulated and administered in any manner known per se for conventional antibodies and antibody fragments (including ScFv's and diabodies) and other pharmaceutically active proteins.
  • formulations a d methods for preparing the same will be clear to the skilled person, and for example include preparations suitable for parenteral administration (for example intravenous, intraperitoneal, subcutaneous, intramuscular, intraluminal, intra-arterial or intrathecal administration) or for topical ⁇ i.e,, transdermal or intradermal) administration.
  • Preparations for parenteral administration may for example be sterile solutions, suspensions, dispersions or emulsions that are suitable for infusion or injection.
  • Suitable carriers or diluents for such preparations for example include, without limitation, those mentioned on page 143 of WO 08/020079.
  • the preparation is an aqueous solution or suspension.
  • polypeptides of the invention can be administered using gene therapy methods of delivery. See, e.g., U.S. Patent No. 5,399,346, which is incorporated by reference for its gene therapy delivery methods.
  • gene therapy methods of delivery See, e.g., U.S. Patent No. 5,399,346, which is incorporated by reference for its gene therapy delivery methods.
  • primary cells transfected with the gene encoding an amino acid sequence polypeptide of the invention can additionally be transfected with tissue specific promoters to target specific organs, tissue, grafts, tumors, or cells and can additionally be transfected with signal and stabilization sequences fo subcellu!arly localized expression.
  • the polypeptides of the invention may be systemicaliy administered, e.g., orally, in combination with a pharmaceutically acceptable vehicle such as an inert diluent or an assimilable edible carrier. They may be enclosed in hard or soft shell gelatin capsules, may be compressed into tablets, or may be incorporated directly with the food of the patient's diet.
  • a pharmaceutically acceptable vehicle such as an inert diluent or an assimilable edible carrier.
  • the polypeptides of the invention may be combined with one or more excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
  • Such compositions and preparations should contain at least 0.1% of the polypeptide of the invention.
  • compositions and preparations may, of course, be varied and may conveniently be between about 2 to about 60% of the weight of a given unit dosage form.
  • amount of the polypeptide of the invention in such therapeutically useful compositions is such that an effective dosage level will be obtained.
  • polypeptides of the invention may be used in biodegradable polymeric drug delivery systems, slow release poly(lactic-co-glycolic acid formulations and the like (Hart et al., Cochrane Database Syst Rev. 2008 Jul 16; (3): CD007294).
  • the polypeptides of the invention may have a beneficial distribution and kinetics profile in solid tumors compared to conventional antibodies such as e.g., IgG.
  • the tablets, troches, pills, capsules, and the like may also contain binders, exctpients, disintegrating agents, lubricants and sweetening or flavoring agents, for example those mentioned on pages 143- 144 of WO 08/020079.
  • the unit dosage form When the unit dosage form is a capsule, it may contain, in addition to materials of the above type, a liquid carrier, such as a vegetable oil or a polyethylene glycol. Various other materials may be present as coatings or to otherwise modify the physical form of the solid unit dosage form. For instance, tablets, pills, or capsules may be coated with gelatin, wax, shellac or sugar and the like.
  • a syrup or elixir may contain the polypeptides of the invention, sucrose or fructose as a sweetening agent, methyl and propylparabens as preservatives, a dye and flavoring such as cherry or orange flavor.
  • any material used in preparing any unit dosage form should be pharmaceutically acceptable and substantially non-toxic in the amounts employed.
  • the polypeptides of the invention may be incorporated into sustained-release preparations and devices.
  • Preparations and formulations for oral administration may also be provided with an enteric coating that will allow the constructs of the invention to resist the gastric environment and pass into the intestines. More generally, preparations and formulations for oral administration may be suitably formulated for delivery into any desired part of the gastrointestinal tract. In addition, suitable suppositories may be used for delivery into the gastrointestinal tract.
  • polypeptides of the invention may also be administered intravenously or intraperitoneally by infusion or injection. Particular examples are as further described on pages 144 and 145 of WO 08/020079.
  • the polypeptides of the invention may be applied in pure form, i.e., when they are liquids. However, it will generally be desirable to administer them to the skin as compositions or formulations, in combination with a dermatological!y acceptable carrier, which may be a solid or a liquid. Particular examples are as further described on page 145 of WO 08/020079.
  • the concentration of the polypeptides of the invention in a liquid composition such as a lotion, wili be from about 0.1-25 wt-%, preferably from about 0.5-10 wt-%.
  • concentration in a semi-solid or solid composition such as a gel or a powder will be about 0.1-5 wt-%, preferably about 0.5-2.5 wt-%.
  • the amount of the polypeptides of the invention required for use in treatment will vary not only with the particular polypeptide selected but also with the route of administration, the nature of the condition being treated and the age and condition of the patient and will be ultimately at the discretion of the attendant physician or clinician.
  • the dosage of the polypeptides of the invention varies depending on the target cell, tumor, tissue, graft, or organ.
  • the desired dose may conveniently be presented in a single dose or as divided doses administered at appropriate intervals, for example, as two, three, four or more sub-doses per day.
  • the sub-dose itself may be further divided, e.g., into a number of discrete loosely spaced administrations.
  • An administration regimen could include long-term, daily treatment.
  • long-term is meant at least two weeks and preferably, several weeks, months, or years of duration. Necessary modifications in this dosage range may be determined by one of ordinary skill in the art using only routine experimentation given the teachings herein. See Remington's Pharmaceutical Sciences (Martin, E.W., ed. 4), Mack Publishing Co., Easton, PA. The dosage can also be adjusted by the individual physician in the event of any complication.
  • the invention in another aspect, relates to a method for the prevention and/or treatment of at least one diseases and disorders associated with CXCR7, said method comprising administering, to a subject in need thereof, a pharmaceutically active amount of a polypeptide of the invention, and/or of a pharmaceutical composition comprising the same.
  • prevention and/or treatment not only comprises preventing and/or treating the disease, but also generally comprises preventing the onset of the disease, slowing or reversing the progress of disease, preventing or slowing the onset of one or more symptoms associated with the disease, reducing and/or alleviating one or more symptoms associated with the disease, reducing the severity and/or the duration of the disease and/or of any symptoms associated therewith and/or preventing a further increase in the severity of the disease and/or of any symptoms associated therewith, preventing, reducing or reversing any physiological damage caused by the disease, and generally any pharmacological action that is beneficial to the patient being treated.
  • the subject to be treated may be any warm-blooded animal, but is in particular a mammal, and more in particular a human being.
  • the subject to be treated will in particular be a person suffering from, or at risk of, the diseases and disorders mentioned herein.
  • the invention relates to a method for the prevention and/or treatment of at least one disease or disorder that is associated with CXCR7, with its biological or pharmacological activity, and/or with the biological pathways or signaling in which CXCR7 is involved, said method comprising administering, to a subject in need thereof, a pharmaceutically active amount of an amino acid sequence of the invention, of a Polypeptide of the invention, of a polypeptide of the invention, and/or of a pharmaceutical composition comprising the same.
  • the invention relates to a method for the prevention and/or treatment of at least one disease or disorder that can be treated by modulating CXCR7, its biological or pharmacological activity, and/or the biological pathways or signaling in which CXC 7 is involved, said method comprising administering, to a subject in need thereof, a pharmaceutically active amount of a polypeptide of the invention, and/or of a pharmaceutical composition comprising the same, in one embodiment, said pharmaceutically effective amount may be a n amount that is sufficient to modulate CXCR7, its biological or pharmacological activity, and/or the biological pathways or signaling in which CXCR7 is involved; and/or an amount that provides a level of the polypeptide of the invention in the circulation that is sufficient to mod ulate CXCR7, its biological or pharmacological activity, and/or the biologica l pathways or signaling in which CXCR7 is involved.
  • the invention relates to a method for the prevention and/or treatment of at least o ne disease or disorder that can be prevented and/or treated by administering a polypeptide of the invention, or a nucleotide construct of the invention encoding the same, and/or of a pharmaceutical composition comprising the same, to a patient.
  • the method com prises ad m inistering a pha rmaceutically active amount of a polypeptide of the invention, or a nucleotide construct of the invention encoding the same, a nd/or of a pharmaceutical composition comprising the same to a subject in need thereof.
  • the invention relates to a method for the prevention and/or treatment of at least one disease or disorder that can be prevented and/or treated by inhibiting binding of CXCL12 and/or CXCL11 to CXCR7 in specific cells or in a specific tissue of a subject to be treated (and in particula r, by inhibiting binding of CXCL12 and/or CXCL11 to CXCR7 in cancer ceils or i n a tumor present in the subject to be treated), said method comprising administering a pharmaceutically active amount of a polypeptide of the invention, or a nucleotide construct of the invention encoding the same, and/or of a pharmaceutical composition comprising the same, to a subject in need thereof.
  • the invention relates to a method for the prevention and/or treatment of at least one disease or disorder chosen from the group consisting of the diseases a nd disorders listed herein, said method comprising administering, to a subject in need thereof, a polypeptide of the invention, or a nucleotide construct of the invention encoding the same, and/or of a pharmaceutical composition comprising the same.
  • the invention relates to a method for immunotherapy, and in particular for passive immunotherapy, which method comprises ad ministering, to a subject suffe ring from or at risk of the diseases and disorders mentioned herein, a pharmaceutically active amount of a polypeptide of the invention, or a nucleotide construct of the invention encoding the sa me, and/or of a pharmaceutical composition comprising the same.
  • the amino acid sequences, polypeptides of the invention and/or the compositions comprising the same can be administered in any suitable manner, depending on the specific pharmaceutical formulation or composition to be used.
  • the polypeptides of the invention and/or the compositions comprising the same can for example be administered orally, intra peritoneally (e.g.
  • the polypeptides of the invention and/or the compositions comprising the same are administered according to a regime of treatment that is suitable for preventing and/or treating the disease or disorder to be prevented or treated.
  • the clinician will generally be able to determine a suitable treatment regimen, depending on factors such as the disease or disorder to be prevented or treated, the severity of the disease to be treated and/or the severity of the symptoms thereof, the polypeptide of the invention to be used, the specific route of administration and pharmaceutical formulation or composition to be used, the age, gender, weight, diet, general condition of the patient, and similar factors well known to the clinician.
  • the treatment regimen will comprise the administration of one or more polypeptides of the invention, or of one or more compositions comprising the same, in one or more pharmaceutically effective amounts or doses.
  • the specific amount(s) or doses to be administered can be determined by the clinician, again based on the factors cited above.
  • the polypeptides of the invention will generally be administered in an amount between 1 gram and 0.01 microgram per kg body weight per day, preferably between 0.1 gram and 0.1 microgram per kg body weight per day, such as about 1, 10, 100 or 1000 microgram per kg body weight per day, either continuously ⁇ e.g., by infusion), as a single daily dose or as multiple divided doses during the day.
  • the clinician will generally be able to determine a suitable daily dose,, depending on the factors mentioned herein.
  • a single contiguous polypeptide of the invention will be used. In one embodiment two or more polypeptides of the invention are provided in combination.
  • polypeptides of the invention may be used in combination with one or more further pharmaceutically active compounds or principles, i.e., as a combined treatment regimen, which may or may not lead to a synergistic effect.
  • a combined treatment regimen which may or may not lead to a synergistic effect.
  • the clinicia n will be able to select such further compounds or principles, as well as a suitable combined treatment regimen, based on the factors cited above and his expert judgment.
  • polypeptides of the invention may be used in combination with other pharmaceutically active compounds or principles that are or can be used for the prevention and/or treatment of the diseases and disorders cited herein, as a result of which a synergistic effect may or may not be obtained.
  • examples of such compounds and principles, as well as routes, methods and pharmaceutical formulations or compositions for administering them will be clear to the clinician, and generally include the cytostatic active principles usually applied for the treatment of the tumor to be treated.
  • CXCR4 antagonists such as e.g., AM 03100, other chemokine receptor antagonists, taxoi; gemcitobine; cisplatin; clAP inhibitors (such as inhibitors to clAPl, c!AP2 and/or XIAP); MEK inhibitors including but not limited to, e.g., U0126, PD0325901; bRaf inhibitors including but not limited to, e.g., RAF265; and mTQR inhibitors including but not limited to, e.g., RAD001; VEGF inhibitors including but not limited to e.g.
  • Her 2 inhibitors including but not limited to e.g., trastuzumab and lapatinib; PDGFR, FGFR, src, JAK, STAT and/or GSK3 inhibitors; selective estrogen receptor modulators including but not limited to tamoxifen; estrogen receptor downregulators including but not limited to fulvestrant.
  • Specific contemplated combinations for use with the polypeptides of the invention for inflammatory conditions include, but are not limited to, e.g., interferon beta 1 alpha and beta, nataiizumab; TNF alpha antagonists including but not limited to e.g., infliximab, adalimumab, certolizumab pegol, etanercept; disease-modifying antirheumatic drugs such as e.g., methotrexate (EvITX); glucocortioids including but not limited to e.g. hydrocortisone; Nonsteroidal anti-inflammatory drugs including but not limited to e.g., ibuprofen, sulindac.
  • TNF alpha antagonists including but not limited to e.g., infliximab, adalimumab, certolizumab pegol, etanercept
  • disease-modifying antirheumatic drugs such as e.g., methotre
  • Othe r specific com ouncls/polypeptides that could be used in com bination (thera py) with the compounds/polypeptides of the invention are the am ino acid seq uences and polypeptides directed against CXC 4 that are described in the international application WO 09/138519 by Ablynx N .V. , the non-prepublished US application 61/358,495 by Ablynx N .V. filed on J une 25, 2010; the PCT application PCT/EP210/064765 by Ablynx N.V. filed on October 4, 2010; and/or the PCT application PCT/EP2011/050156 by Ablynx N.V. filed on January 7, 2011.
  • two or more substances or principles When two or more substances or principles are to be used as part of a combined treatment regimen, they can be administered via the same route of adm inistration or via d ifferent routes of administration, at essentially the same time or at different times (e.g., essentially sim ultaneously, consecutively, or according to an a lternating regime).
  • the substances or principles When the substances or principles are to be administered simultaneously via the same route of administration, they may be administered as different pharmaceutica l form ulations or compositions or pa rt of a combined pharmaceutica l formulation or composition, as wiil be clear to the skilled person.
  • each of the substances or principles may be administered in the same amount and according to the same regimen as used when the compo u nd or principle is used on its own, and such combined use may or may not lead to a synergistic effect.
  • the combined use of the two or more active substances or principles leads to a synergistic effect, it may also be possible to reduce the amount of one, more or all of the substances or principles to be administered, while still achieving the desired therapeutic action.
  • This may for exa mple be useful for avoiding, limiting or reducing a y unwanted side-effects that are associated with the use of one or more of the substances or principles when they are used in their usual amounts, while still obtaining the desired pha rmaceutical or therapeutic effect.
  • the effectiveness of the treatment regimen used according to the invention may be determined and/or followed in any manner known per se for the disease or disorder involved, as wiil be clear to the clinician.
  • the clinician will also be able, where appropriate and on a case-by-case basis, to change or modify a pa rticula r treatment regimen, so as to achieve the desired therapeutic effect, to avoid, limit or reduce unwa nted side-effects, and/or to achieve an a ppropriate ba la nce between achievin the desired therapeutic effect on the one hand and avoiding, limiting or reducing undesired side effects on the other hand.
  • the treatment regimen wiil be followed until the desired therapeutic effect is achieved a nd/or for as long as the desired therapeutic effect is to be mainta ined. Again, this can be determined by the clinician.
  • the invention relates to the use of polypeptide of the invention in the prepa ration of a pha rmaceutica l composition for prevention a nd/or treatment of at least one of the diseases and disorders associated with CXCR7; and/or for use in one or more of the methods of treatment mentioned herein.
  • the subject to be treated may be any warm-blooded animal, but is in particular a mamma l, and more in particula r a human being.
  • the su ject to be treated includes any animal raised for commercial purposes or kept as a pet.
  • the subject to be treated will in pa rticular be a person suffering from, or at risk of, the diseases and d isorders mentioned herein.
  • the invention relates to the use of a polypeptide of the invention, or a nucleotide encoding the sa me, in the preparation of a pharmaceutica l composition for the prevention a nd/or treatment of at least one disease or disorder that can be prevented and/or treated by administering a polypeptide of the i nvention, or a nucleotide e ncoding the same, and/or a pharmaceutical composition of the same to a patient.
  • the invention relates to the use of a polypeptide of the invention, or a nucleotide encod ing the same, in the preparation of a pharmaceutical composition for the prevention and/or treatment of diseases and disorders associated with CXCR7, a nd in particular for the prevention a nd treatment of one or more of the diseases and d isorders listed herein.
  • the one or more polypeptide of the invention, or nucleotide encoding the same, a nd/or a pharmaceutical composition of the same may also be suita bly combined with one or more other active principles, such as those mentioned herein.
  • the invention aiso relates to a composition (such as, without limitation, a pharmaceutical composition or prepa ration as further described herein) for use, either in vitro (e. g., in an in vitro or cellu lar assay) or in vivo (e.g., in a n a single cell or multicellular orga nism, and in particular in a mam mal, a nd more in particular in a huma n being, such as in a h uman being that is at risk of or suffers from a disease or disorder of the invention).
  • in vitro e. g., in an in vitro or cellu lar assay
  • in vivo e.g., in a n a single cell or multicellular orga nism, and in particular in a mam mal, a nd more in particular in a huma n being, such as in a h uman being that is at risk of or suffers from a disease or disorder of the invention.
  • modulating or “to modulate” generally means red ucing or inhibiting the activity of CXCR7 and in particular human CXCR7 (SEQ ID NO: 1), as measured using a suitable in vitro, cellular or in vivo assay (such as those mentioned herein) .
  • reducing or inhibiting the activity of CXCR7 and in particular human CXCR7 SEQ.
  • 10 NO: 1 as measured using a suitable in vitro, cellular or in vivo assay (such as those mentioned herein), by at least 1%, preferably at least 5%, such as at least 10% or at least 25%, for example by at least 50%, at least 60%, at least 70%, at least 80%, or 90% or more, com pared to activity of CXCR7 and in particula r human CXCR7 (SEQ ID NO: 1) in the same assay under the same conditions but without the presence of the polypeptide of the invention.
  • a suitable in vitro, cellular or in vivo assay such as those mentioned herein
  • Mod ulating may for example involve reducing or inhibiting the binding CXCR7 to one of its substrates or !iga nds a nd/or com peting with natura l ligands (CXCL11 and/or CXCL12 ), substrate for binding to CXCR7.
  • CXCL11 and/or CXCL12 natura l ligands
  • the invention further relates to methods for preparing or generating the imm unoglobulin single va riable domains, polypeptides, nucleic acids, host cells, prod ucts a nd compositions described herein. Some preferred but non-limiting examples of such methods will become clear from the further description herein.
  • these methods may comprise the steps of:
  • the set, collection or library of immunoglobulin single variable domains may be any suitable set, collection or library of imm unoglobulin single variable domains.
  • the set, collection or library of im munoglobulin single variable domains may be a set, collection or libra ry of immunoglobulin sequences (as described herein), such as a naive set, collection or library of immunoglobulin sequences; a synthetic or sem i-synthetic set, collection or library of imm unoglobulin seq uences; a nd/or a set, collection or libra ry of immunoglobulin sequences that have been subjected to affinity maturation.
  • the set, collection or library of immunoglobulin single variable domains may be a set, collection or library of heavy or light chain variable doma ins (such as VL-, VH- or VH H domains).
  • the set, collection or library of immunoglobulin single variable domains may be a set, collection or library of domain a ntibodies or single domain antibodies, or may be a set, collection or library of immunoglobulin single va ria ble domains that are capable of functioning as a domai n a nti body or single domain antibody.
  • the set, collection or library of immunoglobulin single variable domains may be an immune set, collection or library of immunoglobulin sequences, for example derived from a mamma! that has been suitably immunized with CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) or with a suitable antigenic determinant based thereon or derived therefrom.
  • a suitable antigenic determinant based thereon or derived therefrom.
  • said antigenic determinant may be an extracellular part, region, domain, loop or other extracellular epitope(s).
  • the set, collection o library of immunoglobulin single variable domains may be displayed on a phage, phagemid, ribosome or suitable micro-organism (such as yeast), such as to facilitate screening.
  • suitable methods, techniques and host organisms for displaying and screening (a set, collection or library of) immunoglobulin single variable domains will be clear to the person skilled in the art, for example on the basis of the further disclosure herein. Reference is also made to the review by Hoogenboom in Nature Biotechnology, 23, 9, 1105-1116 (2005).
  • the method for generating immunoglobulin single variable domains comprises at least the steps of:
  • the method for generating an amino acid sequence directed against CXCR7 and in particular human CXCR7 may comprise at least the steps of:
  • the set, collection or library of nucleic acid sequences encoding immunoglobulin single variable domains may for example be a set, collection or library of nucleic acid sequences encoding a naive set, collection or library of immunoglobulin sequences; a set, collection or library of nucleic acid sequences encoding a synthetic or semi-synthetic set, collection or library of immunoglobulin seq uences; and/or a set, collection or libra ry of nucleic acid sequences encoding a set, collection or library of immunoglobulin sequences that have been subjected to affinity maturation.
  • the method for generating an amino acid seq uence directed against CXCR7 and in particular human CXCR7 may com prise at least the steps of:
  • nucleic acid seq uences for nucleic acid sequences that encode a n amino acid sequence that can bind to and/or has affinity for CXCR7 and in pa rticular human CXCR7 (SEQ I D NO: 1) and that is cross-blocked or is cross blocking a immunoglobulin single varia ble domain or polypeptide of the invention, e.g., SEQ I D NOs: 39 to 43, 91 or 99-102 (Table B-3); and
  • the invention also relates to immunoglobulin single varia ble domains that are obtained by the above methods, or a lternatively by a method that comprises the one of the above methods and in addition at least the steps of determining the nucleotide sequence or amino acid seq uence of said imm unoglobulin seque nce; and of expressing or synthesizing said amino acid sequence in a manner known per se, such as by expression in a suitable host cell or host organism or by chemica l synthesis.
  • one or more immunoglobulin single variable domains of the invention may be suitably h umanized, camelized or otherwise seq uence optim ized (e.g. sequence optimized fo r ma nufacturability, sta bility and/or solubility); a nd/or the amino acid sequence(s) thus obta ined may be linked to each other or to one or more other suitable immunoglobulin single varia ble domains (optionally via one or more suitable linkers) so as to provide a polypeptide of the invention.
  • a nd/or the amino acid sequence(s) thus obta ined may be linked to each other or to one or more other suitable immunoglobulin single varia ble domains (optionally via one or more suitable linkers) so as to provide a polypeptide of the invention.
  • a nucleic acid sequence encoding an am ino acid sequence of the invention may be suitably humanized, camelized or otherwise seq uence optimized [e.g., seq uence optimized for manufactura bility, sta bility and/or solubility) and suitably expressed; and/or one or more nucleic acid sequences encoding a n amino acid sequence of the invention may be linked to each other or to one or more nucleic acid sequences that encode other suita ble immunoglobulin single variable domains (optiona lly via nucleotide sequences that encode one or more suitable linkers), after which the nucleotide sequence thus o btained may be suitably expressed so as to provide a polypeptide of the invention.
  • the invention f urther relates to applications and uses of the immunoglobulin single variable domains, compounds, constructs, polypeptides, nucleic acids, host cells, products and com positions described herein, as well as to methods for the diagnosis, prevention and/or treatment for diseases and disorders associated with CXCR7 and in particular human CXCR7 (SEQ ID NO: 1).
  • SEQ ID NO: 1 Some preferred but non-limiting applications and uses will become clear from the further description herein.
  • the invention also relates to the immunoglobulin single variable domains, compounds, constructs, polypeptides, nucleic acids, host cells, products and compositions described herein for use in therapy.
  • the invention also relates to the immunoglobulin single variable domains, compounds, constructs, polypeptides, nucleic acids, host ceils, products and compositions described herein for use in therapy of a disease or disorder that can be prevented or treated by administering, to a subject in need thereof, of (a pharmaceutically effective amount of) an amino acid sequence, compound, construct or polypeptide as described herein.
  • the invention relates to the immunoglobulin single variable domains, compounds, constructs, polypeptides, nucleic acids, host ceils, products and compositions described herein for use In therapy of cancer.
  • polypeptides of the invention and immunoglobulin single variable domains may be altered in order to further improve potency or other desired properties.
  • an immunoglobulin single variable domain can be defined as a polypeptide with the formula 1:
  • FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4 in which FR1 to FR4 refer to framework regions 1 to 4, respectively, and in which CDR1 to CDR3 refer to the complementarity determining regions 1 to 3, respectively.
  • CDR1, CDR2 and CDR3 sequences that are mentioned on the same line or row in Table B-2) will usually be preferred (although the invention in its broadest sense is not limited thereto, and also comprises other suitable combinations of the CDR sequences mentioned in Table B-2). Also, a combination of CDR sequences and framework seq uences that occur in the same clone (i.
  • CDR sequences and framework sequences that are mentioned on the same line or row in Table B-2) will usually be preferred (although the invention in its broadest sense is not lim ited thereto, and also comprises other suita ble combinations of the CDR sequences and framework sequences mentioned in Table B- 2, as well as combinations of such CDR sequences and other suitable fra mework seque nces, e.g., as further described herein ⁇ .
  • each CDR can be replaced by a CDR chosen from the group consisting of immunoglobulin single va riable doma ins that have at least 80%, preferably at least 90%, more prefera bly at least 95%, even more preferably at least 99% seq uence identity (as defined herein) with the mentioned CDR's; in which: i) a ny amino acid substitution in such a CDR is prefera bly, a nd compared to the corresponding CDR sequence mentioned in Table B-2, a conservative amino acid substitution (as defined herein); a nd/or
  • a ny such CDR sequence preferably only contains amino acid substitutions, a nd no amino acid deletions or insertions, compa red to the corresponding CDR sequence mentioned in Table B-2; a nd/or
  • a ny such CDR seq uence is a CDR that is derived by mea ns of a techniq ue for affinity maturation known per se, a nd in pa rticula r starting from the corresponding CDR seq uence mentioned in Table B-2.
  • At least one of the CDR1, CDR2 and CDR3 sequences present is suitably chosen from the group consisting of the CDR1, CDR2 and CDR3 sequences, respectively, listed in Table B-2; or from the group of CDR1, CDR2 and CDR3 sequences, respectively, that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% "seq uence identity" (as defined herein) with at least one of the CDR1, CDR2 and CDR3 sequences, respectively, listed in Table B-2; and/or from the group consisting of the CDR1, CDR2 and CDR3 sequences, respectively, that have 3, 2 or only 1 "amino acid difference(s)" (as defined herein ) with at least o e of the CDR1, CDR2 and CDR3 sequences, respectively, listed in Table B-2.
  • suitably chosen is meant that, as applicable, a CDR1 sequence is chosen from suitable CDR1 sequences (i.e. as defined herein), a CD 2 sequence is chosen from suitable CDR2 sequences (i.e. as defined herein), and a CDR3 sequence is chosen from suitable CDR3 sequence (i.e. as defined herein), respectively.
  • the CDR sequences are preferably chosen such that the Nanobodies of the invention bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) with an affinity (suitably measured and/or expressed as a EC50 value, or alternatively as an IC 50 value, as further described herein in various in vitro and/or in vivo potency or other assays) that is as defined herein.
  • At least the CDR3 sequence present is suitably chosen from the group consisting of the CDR3 sequences listed in Table B-2 or from the group of CDR3 sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the CDR3 sequences listed in Table B-2; and/or from the group consisting of the CDR3 sequences that have 3, 2 or only 1 amino acid difference(s) with at least one of the CDR3 sequences listed in Table B- 2.
  • At least two of the CDR1, CDR2 and CDR3 sequences present are suitably chosen from the group consisting of the CDR1, CDR2 and CDR3 sequences, respectively, listed in Table B-2 or from the group consisting of CDR1, CDR2 and CDR3 sequences, respectively, that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the CDR1, CDR2 and CDR3 sequences, respectively, listed in Table B-2; and/or from the group consisting of the CDR1, CDR2 and CDR3 sequences, respectively, that have 3, 2 or only 1 "amino acid difference(s)" with at ieast one of the CDR1, C0 2 and CDR3 sequences, respectively, listed in Table B-2.
  • the CDR3 sequence present is suitably chosen from the group consisting of the CDR3 sequences listed in Table B-2 or from the group of CDR3 sequences that have at least 80%, preferably at least 90%, more preferably at Ieast 95%, even more preferably at Ieast 99% sequence identity with at least one of the CDR3 sequences listed in Table B-2, respectively; and at Ieast one of the CDR1 and CDR2 sequences present is suitably chosen from the group consisting of the CDR1 and CDR2 sequences, respectively, listed in Table B-2 or from the group of CDR1 and CDR2 sequences, respectively, that have at least 80%, preferably at Ieast 90%, more preferably at Ieast 95%, even more preferably at Ieast 99% sequence identity with at ieast one of the CDR1 and CDR2 sequences, respectively, listed in Table B- 2; and/or from the group consisting of the CDR1 and CDR2 sequences, respectively, that
  • all three CDRl, CDR2 and CDR3 sequences present are suitably chosen from the group consisting of the CDRl, CDR2 and CDR3 sequences, respectively, listed in Table B-2 or from the group of CDRl, CDR2 and CDR3 sequences, respectively, that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the CDRl, CDR2 and CDR3 sequences, respectively, listed in Table B-2; and/or from the group consisting of the CDRl, CDR2 and CDR3 sequences, respectively, that have 3, 2 or only 1 amino acid difference(s) with at least one of the CDRl, CDR2 and CDR3 sequences, respectively, listed in Table B-2.
  • At least one of the CDRl, CDR2 and CDR3 sequences present is suitably chosen from the group consisting of the CDRl, CDR2 and CDR3 sequences, respectively, listed in Table B-2.
  • At least one or preferably both of the other two CDR sequences present are suitably chosen from CDR sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the corresponding CDR sequences, respectively, listed in Table B-2; and/or from the group consisting of the CDR sequences that have 3, 2 or only 1 amino acid difference(s) with at least one of the corresponding sequences, respectively, listed in Table B-2.
  • at least the CDR3 sequence present is suitably chosen from the group consisting of the CDR3 listed in Table B-2.
  • At least one and preferably both of the CDRl and CDR2 sequences present are suitably chosen from the groups of CDRl and CDR2 sequences, respectively, that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with the CDRl and CDR2 sequences, respectively, listed in Table B-2; and/or from the group consisting of the CDRl and CDR2 sequences, respectively, that have 3, 2 or only 1 amino acid differencefs) with at least one of the CDRl and CDR2 sequences, respectively, listed in Table B-2.
  • the immunoglobulin single variable domains of the invention at least two of the CDRl, CDR2 and CDR3 sequences present are suitably chosen from the group consisting of the CDRl, CDR2 and CDR3 sequences, respectively, listed in Table B-2.
  • the remaining CDR sequence present is suitably chosen from the group of CDR sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the corresponding CDR sequences listed in Table B-2; and/or from the group consisting of CDR sequences that have 3, 2 or only 1 amino acid difference(s) with at least one of the corresponding sequences listed in Table B-2.
  • the CDR3 sequence is suitably chosen from the group consisting of the CDR3 sequences listed in Table B-2, and either the CDRl sequence or the CDR2 sequence is suitably chosen from the group consisting of the CDRl and CDR2 sequences, respectively, listed in Table B-2.
  • the remaining CDR sequence present is suitably chosen from the group of CDR sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with at least one of the corresponding CDR sequences listed in Table B-2; and/or from the group consisting of CDR sequences that have 3, 2 or only 1 amino acid difference(s) with the corresponding CDR sequences listed in Table B-2.
  • ail three CDRl, CDR2 and CDR3 sequences present are suitably chosen from the group consisting of the CDRl, CDR2 and CDR3 sequences, respectively, listed in Table B-2.
  • a CDR in a immunoglobulin single variable domain of the invention is a CDR sequence mentioned in Table B-2 or is suitably chosen from the group of CDR sequences that have at least 80%, preferably at least 90%, more preferably at least 95%, even more preferably at least 99% sequence identity with a CDR sequence listed in Table B-2; and/or from the group consisting of CDR sequences that have 3, 2 or only 1 amino acid difference(s) with a CDR sequence listed in Table B-2, that at least one and preferably both of the other CDR's are suitably chosen from the CDR sequences that belong to the same combination in Table B-2 (i.e., mentioned on the same line or row in Table B-2) or are suitably chosen from the group of CDR sequences that have at least 80%, preferably at least 90%, more preferably at least 95%
  • a polypeptide of the invention can for example comprise a CDRl sequence that has more than 80 % sequence identity with one of the CDRl sequences mentioned in Table B-2, a CDR2 sequence that has 3, 2 or 1 amino acid difference with one of the CDR2 sequences mentioned in Table B-2 (but belonging to a different combination), and a CDR3 sequence.
  • Some preferred immunoglobulin single variable domains of the invention may for example comprise: (1) a CDRl sequence that has more than 80 % sequence identity with one of the CDRl sequences mentioned in Table B-2; a CDR2 sequence that has 3, 2 or 1 amino acid difference with one of the CDR2 sequences mentioned in Table B-2 (but belonging to a different combination); and a CDR3 sequence that has more than 80 % sequence identity with one of the CDR3 sequences mentioned in Table B-2 (but belonging to a different combination); or (2) a CDRl sequence that has more than 80 % sequence identity with one of the CDRl sequences mentioned in Table B-2; a CDR2 sequence, and one of the CDR3 sequences listed in Table B-2; or (3) a CDRl sequence; a CDR2 sequence that has more than 80% sequence identity with one of the CDR2 sequence listed in Table B-2; and a CDR3 sequence that has 3, 2 or 1 amino acid differences with the CDR3 sequence mentioned in Table B-2 that belongs to the same combination as the CD 2
  • Some particularly preferred immunoglobulin single variable domains of the invention may for example comprise: (1) a CDRl sequence that has more than 80 % sequence identity with one of the CDRl sequences mentioned in Table B-2; a CDR2 sequence that has 3, 2 or 1 amino acid difference with the CD 2 sequence mentioned in Table B-2 that belongs to the same combination; and a CDR3 sequence that has more than 80 % sequence identity with the CDR3 sequence mentioned in Table B- 2 that belongs to the same combination; (2) a CDRl sequence; a CDR2 listed in Table B-2 and a CDR3 sequence listed in Table B-2 (in which the CDR2 sequence and CDR3 sequence may belong to different combinations).
  • Some even more preferred immunoglobulin single variable domains of the invention may for example comprise: (1) a CDRl sequence that has more than 80 % sequence identity with one of the CDRl sequences mentioned in Table B-2; the CDR2 sequence listed in Table B-2 that belongs to the same combination; and a CDR3 sequence mentioned in Table B-2 that belongs to a different combination; or (2) a CDRl sequence mentioned in Table B-2; a CDR2 sequence that has 3, 2 or 1 amino acid differences with the CDR2 sequence mentioned in Table B-2 that belongs to the same combination; and a CDR3 sequence that has more than 80% sequence identity with the CDR3 sequence listed in Table B-2 that belongs to the same or a different combination.
  • Particularly preferred immunoglobulin single variable domains of the invention may for exampie comprise a CDRl sequence mentioned in Table B-2, a CDR2 sequence that has more than 80 % sequence identity with the CDR2 sequence mentioned in Table B-2 that belongs to the same combination; and the CDR3 sequence mentioned in Table B-2 that belongs to the same combination.
  • the CDRl, CDRl and CDR3 sequences present are suitably chosen from one of the combinations of CDRl, CDR2 and CDR3 sequences, respectively, listed in Table 8-2.
  • CDRl has a length of between 1 and 12 amino acid residues, and usually between 2 and 9 amino acid residues, such as 5, 6 or 7 amino acid residues; and/or (b) CDR2 has a length of between 13 and 24 amino acid residues, and usually between 15 and 21 amino acid residues, such as 16 and 17 amino acid residues; and/or (c) CDR3 has a length of between 2 and 35 amino acid residues, and usually between 3 and 30 amino acid residues, such as between 6 and 23 amino acid residues.
  • the invention relates to a immunoglobulin single variable domain in which the CDR sequences (as defined herein) have more than 80%, preferably more than 90%, more preferably more than 95%, such as 99% or more sequence identity (as defined herein) with the CDR sequences of at least one of the immunoglobulin single variable domains of SEQ ID NOs: 39 to 43 or 91 as well as 99-102 (see Table B-3).
  • Another preferred, but non-limiting aspect of the invention relates to humanized variants of the immunoglobulin single variable domains of SEQ ID NOs: 39 to 43 and 91 as well as 99-102 (see Table B-3), that comprise, compared to the corresponding native V HK sequence, at least one humanizing substitution (as defined herein), and in particular at least one humanizing substitution in at least one of its framework sequences (as defined herein).
  • the immunoglobulin single variable domains that are mentioned herein as "preferred” (or “more preferred”, “even more preferred”, etc.) are also preferred (or more preferred, o even more preferred, etc.) for use in the polypeptides described herein.
  • polypeptides that comprise or essentially consist of one or more "preferred” immunoglobulin single variable domains of the invention will generally be preferred, and polypeptides that comprise or essentially consist of one or more "more preferred” immunoglobulin single variable domains of the invention will generally be more preferred, etc.
  • nucleic acid that encodes an amino acid sequence of the invention (such as an immunoglobulin single variable domain of the invention) or a polypeptide of the invention comprising the same.
  • an amino acid sequence of the invention such as an immunoglobulin single variable domain of the invention
  • polypeptide of the invention comprising the same.
  • nucleic acids of the invention such a nucleic acid may be in the form of a genetic construct, as defined herein. Specific embodiments of this aspect of the invention are provided in Table B-6, SEQ ID NOs: 59 to 63 and 73 to 77.
  • the invention relates to nucleic acid sequences of imm unoglobulin single variable domain in which the sequences (as defined herein) have more than 80%, preferably more than 90%, more preferably more than 95%, such as 99% or more sequence identity (as defined herein) with the sequences of at least one of nucleic acid sequence of the immunoglobulin single variable domains of SEQ ID NOs: 59 to 63 and 73 to 77 (see Table B-6).
  • the invention relates to nucleic acid sequences that comprise the nucleic acid sequences of immunoglobulin single variable domain in which the sequences (as defined herein) have more than 80%, preferably more than 90%, more preferably more than 95%, such as 99% or more sequence identity (as defined herein) with the sequences of at least one of nucleic acid sequence of the immunoglobulin single variable domains of SEQ ID NOs: 59 to 63 and 73 to 77 (see Table B-6).
  • the invention relates to host or host cell that expresses or that is capable of expressing an amino acid sequence (such as an immunoglobulin single variable domain) of the invention and/or a polypeptide of the invention comprising the same; and/or that contains a nucleic acid of the invention.
  • an amino acid sequence such as an immunoglobulin single variable domain
  • a polypeptide of the invention comprising the same; and/or that contains a nucleic acid of the invention.
  • one particularly useful method for preparing a polypeptide of the invention generally comprises the steps of:
  • nucleic acid of the invention i) the expression, in a suitable host cell or host organism (also referred to herein as a "host of the invention") or in another suitable expression system of a nucleic acid that encodes said amino acid sequence, polypeptide of the invention (also referred to herein as a “nucleic acid of the invention”), optionally followed by:
  • such a method may comprise the steps of:
  • a nucleic acid of the invention can be in the form of single or double stranded DMA or RNA, and is preferably in the form of double stranded DMA,
  • the nucleotide sequences of the invention may be genomic DMA, cDNA or synthetic DMA (such as DMA with a codon usage that has been specifically adapted for expression in the intended host cell or host organism).
  • the nucleic acid of the invention is in essentially isolated from, as defined herein.
  • the nucleic acid of the invention may also be in the form of, be present in and/or be part of a vector, such as for example a plasmid, cosmid or YAC, which again may be in essentially isolated form.
  • nucleic acids of the invention can be prepared or obtained in a manner known per se, based on the information on the immunoglobulin single variable domains for the polypeptides of the invention given herein, and/or can be isolated from a suitable natural source.
  • nucleotide sequences encoding naturally occurring V HH domains can for example be subjected to site-directed mutagenesis, so at to provide a nucleic acid of the invention encoding said analog.
  • nucleic acid of the invention also several nucleotide sequences, such as at least one nucleotide sequence encoding a polypeptide of the invention and for example nucleic acids encoding one or more linkers can be linked together in a suitable manner.
  • Techniques for generating the nucleic acids of the invention will be clear to the skilled person and may for instance include, but are not limited to, automated DNA synthesis; site-directed mutagenesis; combining two or more naturally occurring and/or synthetic sequences (or two or more parts thereof), introduction of mutations that lead to the expression of a truncated expression product; introduction of one or more restriction sites (e.g.
  • the nucleic acid of the invention may also be in the form of, be present in and/or be part of a genetic construct, as will be clear to the person skilled in the art and as described on pages 131-134 of WO 08/020079 (incorporated herein by reference).
  • Such genetic constructs generally comprise at least one nucleic acid of the invention that is optionally linked to one or more elements of genetic constructs known per se, such as for example one or more suitable regulatory elements (such as a suitable promoter(s), enhancer(s), terminator(s), etc.) and the further elements of genetic constructs referred to herein.
  • suitable regulatory elements such as a suitable promoter(s), enhancer(s), terminator(s), etc.
  • Such genetic constructs comprising at least one nucleic acid of the invention will also be referred to herein as "genetic constructs of the invention”.
  • the genetic constructs of the invention may be DMA or RNA, and are preferably double-stranded DNA.
  • the genetic constructs of the invention may also be in a form suitable for transformation of the intended host cell or host organism, in a form suita le for integration into the genomic DNA of the intended host cell or in a form suitable for independent replication, maintenance and/or inheritance in the intended host organism.
  • the genetic constructs of the invention may be in the form of a vector, such as for example a plasmid, cosmid, YAC, a viral vector or transposon.
  • the vector may be an expression vector, i.e., a vector that can provide for expression in vitro and/or in vivo (e.g., in a suitable host cell, host organism and/or expression system).
  • a genetic construct of the invention comprises
  • one or more regulatory elements such as a promoter and optionally a suitable terminator; and, optionally,
  • the nucleic acids of the invention and/or the genetic constructs of the invention may be used to transform a host cell or host organism, i.e., for expression and/or production of the polypeptide of the invention.
  • Suitable hosts or host ceils will be clear to the skilled person, and may for example be any suitable fungal, prokaryotic or eukaryotic cell or cell line or any suitable fungal, prokaryotic or eukaryotic organism, for example those described on pages 134 and 135 of WO 08/020079.; as well as all other hosts or host celis known per se for the expression and production of antibodies and antibody fragments (including but not limited to (single) domain antibodies and ScFv fragments), which will be clear to the skilled person.
  • the immunoglobulin single variable domains, and polypeptides of the invention can for example also be produced in the milk of transgenic mammals, for example in the miik of rabbits, cows, goats or sheep (see for example US-A-6,741,957, US-A-6,304,489 and US-A-6,849,992 for general techniques for introducing transgenes into mammals), in plants or parts of plants including but not limited to their leaves, flowers, fruits, seed, roots or turbers (for example in tobacco, maize, soybean or alfalfa) or in for example pupae of the silkworm Bombix mori.
  • immunoglobulin single variable doma ins, and polypeptides of the i nvention ca n also be expressed and/or produced in cell-free expression systems, and suitable examples of such systems will be clear to the skilled person.
  • Some preferred, but non-limiting exam ples include expression in the wheat germ system; in rabbit reticulocyte lysates; or in the E. cols ' Zubay system.
  • the polypeptides based thereon can be prepared thro ugh expression in a suitable bacterial system, and suitable bacterial expression systems, vectors, host cells, regulatory elements, etc., will be clea r to the skilled person, for exam ple from the references cited above. It should however be noted that the invention in its broadest sense is not limited to expression in bacterial systems. Prefera bly, in the invention, an (in vivo or in vitro) expression system, such as a bacterial expression system, is used that provides the polypeptides of the invention in a form that is suitable for pharmaceutical use, and such expression systems will again be clear to the skilled person.
  • polypeptides of the invention suitable for pha rmaceutical use can be prepared using techniques for peptide synthesis.
  • preferred heterologous hosts for the (industria l) production of imm unoglobulin single varia ble domains or immunoglobulin single variable domain-containing protein therapeutics include stra ins of E. coli, Pichia pastoris, S. cerevisiae that are suitable for large scale expression/prod uction/fermentation, a nd in pa rticular for large sca le pharmaceutical (i.e., GMP grade) expression/ roduction/ fermentation. Suitable examples of such strains will be clea r to the skilled person.
  • Such strains and production/expression systems are also made available by companies such as Richte r Helm ( Hamburg, Germany) or CMC Biologies (Soeborg, Denma rk).
  • mamma lian cell lines in particula r Chinese hamster ovary (CHO) cells, can be used for large scale expression/production/fermentation, and in particular for large scale pha rmaceutical expression/production/fermentation .
  • Aga in, such expression/production systems a re also made available by some of the companies mentioned a bove.
  • a human cell or cell line is used (i.e., leading to a protein that essentially has a human glycosylation pattern) or another mamma lian ce ll line is used that can provide a gtycosylation pattern that is essentially and/or functionally the same as human glycosylation or at least mimics huma n glycosylation.
  • prokaryotic hosts such as £ coll do not have the ability to glycosylate proteins, and the use of lower eukaryotes such as yeast usua lly leads to a glycosylation pattern that differs from human glycosylation.
  • yeast usua lly leads to a glycosylation pattern that differs from human glycosylation.
  • Neve rtheless it should be understood that ail the foregoing host cells and expression systems can be used in the invention, depend ing on the desired polypeptide to be obtained .
  • the polypeptide of the invention is glycosylated .
  • the polypeptide of the invention is non-giycosylated .
  • the polypeptide of the invention is produced in a bacteria l cell, in particular a bacterial cell suita ble for large sca le pharmaceutica l production, such as cells of the strains mentioned above.
  • the polypeptide of the invention is prod uced in a yeast cell, in pa rticula r a yeast ceil suitable for large scale pharmaceutical prod uction, such as ce lls of the species mentioned a bove.
  • the polypeptide of the invention is produced in a mamma lian cell, in particular in a huma n cell or in a cell of a huma n cell line, and more in particular in a human cell or in a cell of a human cell line that is suitable for large scale pharmaceutical production, such as the cel l lines mentioned hereina bove.
  • the immunoglobulin single variable domains, and polypeptides of the invention can be produced either intracellullarly ⁇ e.g., in the cytosol, in the perip!asma or in inclusion bodies) a nd then isolated from the host cells and optionally further purified; or ca be produced extracellularly (e.g., in the medium in which the host DC ls a re cultured) a nd then isolated from the culture medium a nd optionally further purified .
  • the polypeptide of the invention is a a mino acid sequence, polypeptide that has been produced intracellula r ⁇ and that has been isolated from the host cell, and in particular from a bacterial cell or from an inclusion body in a bacterial cell.
  • the amino acid sequence, or polypeptide of the invention is a n amino acid sequence, or polypeptide that has been produced extracellula rly, a nd that has been isolated from the medium in which the host cell is cultivated.
  • Some preferred, but non-limiting promoters for use with these host cells include those mentioned on pages 139 and 140 of WO 08/020079. Some preferred, but non-limiting secretory sequences for use with these host cells include those mentioned on page 140 of WO 08/020079.
  • Suitable techniques for transform ing a host or host cell of the invention will be clea r to the skilled person a nd may depend on the intended host ceil/host organism and the genetic construct to be used . Reference is again made to the hand books and patent a pplications mentioned above.
  • a step for detecting and selecting those host ceils or host organisms that have been successfully tra nsformed with the nucleotide sequence/genetic construct of the invention may be performed.
  • This may for insta nce be a selection step based on a selectable marker present in the genetic construct of the invention or a step involving the detection of the amino acid sequence of the inve ntion, e.g., using specific antibodies.
  • the transformed host cell (which may be in the form or a sta ble cell line) or host organisms (which may be in the form of a stable mutant line or strain) form further aspects of the present invention.
  • these host cells or host orga nisms are such that they express, or are (at least) capable of expressing ⁇ e.g., under suita ble conditions), a polypeptide of the invention (and in case of a host organism: in at least one cell, part, tissue or organ thereof).
  • the invention also includes further generations, progeny a nd/or offspring of the host cell or host organism of the invention that may for instance be obtained by ceil division or by sexua l or asexual re production.
  • the transformed host cell or transformed host organism may generally be kept, maintained and/or cultured under conditions such that the (desired) amino acid sequence, or polypeptide of the invention is expressed/produced. Suitable conditions will be clear to the skilled person and will usually depend upon the host cell/host organism used, as well as on the regulator elements that control the expression of the (relevant) nucleotide seq uence of the invention. Again, reference is made to the handbooks and patent applications mentioned above in the pa ragraphs on the genetic constructs of the invention.
  • suita ble conditions may include the use of a suitable medium, the presence of a suitable source of food a nd/or suitable nutrients, the use of a suitable temperature, and optionally the presence of a suitable inducing factor or compound (e.g., when the nucleotide sequences of the invention a re under the control of a n inducible promoter); a ll of which may be selected by the skilled person.
  • a suitable inducing factor or compound e.g., when the nucleotide sequences of the invention a re under the control of a n inducible promoter
  • a suitable inducing factor or compound e.g., when the nucleotide sequences of the invention a re under the control of a n inducible promoter
  • a suitable inducing factor or compound e.g., when the nucleotide sequences of the invention a re under the control of a n inducible promoter
  • amino acid sequence, or polypeptide of the invention may (first) be generated in an immature form (as mentioned a bove), which may then be subjected to post-translationa l modification, depending on the host cell/host organism used.
  • amino acid sequence, or polypeptide of the invention may be glycosylated, aga in depending on the host cell/host orga nism used.
  • the amino acid sequence, or polypeptide of the invention may then be isolated from the host cell/host organism and/or fro m the med ium in which said host cell or host organism was cultivated, using protein isolation a nd/or purification techniques known per se, such as (preparative) chromatography and/or electrophoresis techniques, differential precipitation techniques, affinity techniq ues (e.g., using a specific, cleavable a mino acid sequence fused with the amino acid sequence, or polypeptide of the invention) and/or preparative immunological techniques ⁇ i.e. using anti bodies against the amino acid seq uence to be isolated) .
  • protein isolation a nd/or purification techniques known per se such as (preparative) chromatography and/or electrophoresis techniques, differential precipitation techniques, affinity techniq ues (e.g., using a specific, cleavable a mino acid sequence fused with the amino acid sequence, or polypeptide of the invention
  • a num ber of d ifferent screening protocols can be utilized to identify agents that modulate the level of activity or function of CXCR7 i n cells, particularly in mam ma lian ce lls, and especially in human cells.
  • the screening methods involve screening a agent or a plurality of agents to identify one or more agents that interacts with (human) CXCR7 (SEQ ID NO:l), for example, by bind i ng to a CXCR7 or a fragment thereof and preventing the polypeptides or ISVDs of the invention, such as, for insta nce, comprising any one of SEQ ID NOs: 39-48, 78-89, 91, 99-102 or 132-140, from binding to CXCR7 (SEQ ID NO: 1),
  • an agent binds CXCR7 with at least about 1.5, 2, 3, 4, 5, 10, 20, 50, 100, 300, 500, or 1000 times the affinity of the agent for another protein.
  • the fragment of CXCR7 comprising the epitopes described herein (and optionally com prising further non-CXCR7 amino acids at the N and/or C term ini) is no more tha n, e.g., 300, 250, 200, 150, 100, 50, 40, 30, 20 or fewer amino acids.
  • the CXCR7 fragment is any fragment havin less than all of the a mino acids in the full length CXCR7 polypeptide.
  • CXCR7 modulators are identified by screening for molecules that compete with the polypeptide or ISVD of the invention from binding to a CXCR7 polypeptide, or fragment thereof.
  • Those of skill in the a rt will recognize that there are a num ber of ways to perform competition analyses, for instance, such as disclosed herein .
  • samples with CXCR7 a re pre-incubated with a labeled polypeptides or ISVDs of the invention, such as, for instance, com prising any one of SEQ ID NOs: 39-48, 78-89, 91, 99-102 or 132-140 and then contacted with a potential competitor molecule.
  • Alteration e.g., a decrease
  • the quantity of polypeptide or ISVD bound to CXCR7 in the presence of a test compound indicates that the test compound is a potential CXCR7 modulator.
  • kits are also provided by the invention.
  • such kits may include any or all of the following: assay reagents, buffers, and the anti-CXCR7 polypeptides or ISVOs of the invention.
  • a therapeutic product may include sterile saline or another pharmaceutically acceptable emulsion and suspension base.
  • kits may include instructional materials containing directions (i.e., protocols) for the practice of the methods of this invention.
  • instructional materials typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention.
  • Such media include, but are not limited to electronic storage media ⁇ e.g., magnetic discs, tapes, cartridges, chips), optical media ⁇ e.g., CD ROM), and the like.
  • Such media may include addresses to internet sites that provide such instructional materials.
  • Aspect A-l An immunoglobulin single variable domain that is directed against and/or that can specifically bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1).
  • Aspect A-2 An immunoglobulin single variable domain according to aspect A-l, that is in essentially isolated form.
  • Aspect A-3 An immunoglobulin single variable domain according to aspect A-l or A-2, for administration to a subject, wherein said immunoglobulin single variable domain does not naturally occur in said subject.
  • Aspect A-4 An immunoglobulin single variable domain that can specifically bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) with a dissociation constant (K D ) of IfJ 5 to 10 " 12 moles/litre or less, and preferably 10 '7 to 10 "12 moles/litre or less and more preferably 10 8 to 10 " 12 moles/litre.
  • K D dissociation constant
  • Such an immunoglobulin single variable domain may in particular be an immunoglobulin single variable domain according to any of the preceding aspects.
  • An immunoglobulin single variable domain that can specifically bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) with a rate of association (k on -rate) of between 10 2 M ' V 1 to about 10 7 M ' V 1 , preferably between 10 3 M ' V 1 and 10 7 M ' V 1 , more preferably between 10 4 M ' V 1 and 10' M ' V 1 , such as between 10 s M ' V 1 and 10 7 M ' V 1 .
  • Such an immunoglobulin single variable domain may in particular be an immunoglobulin single variable domain according to any of the preceding aspects.
  • A-6 An immunoglobulin single variable domain that can specifically bind to CXCR7 and in particular human CXCR7 (SEQ. ID NO: 1) with a rate of dissociation (k off rate) between 1 s "1 and 10 "6 s "1 , preferably between 10 ' ⁇ s '1 and 10 "6 s * , more preferably between 10 3 s '1 and 10 " s '1 , such as between 10 "'1 s "1 and 10 6 s '1 .
  • Such an immunoglobulin single variable domain may in particular be an immunoglobulin single variable domain according to any of the preceding aspects.
  • A-7 An immunoglobulin single variable domain that can specifically bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1 ⁇ with an affinity less than 500 nM, preferably less than 200 nM, more preferably less than 10 nM, such as less than 500 pM.
  • Such an immunogiobulin single variable domain may in particular be an immunoglobulin single variable domain according to any of the preceding aspects.
  • Aspect A-8 An immunoglobulin single variable domain that can specifically displace SDF-1 and/or l-TAC (CXCLll and/or CXCL12) on CXCR7 and in particular on human CXCR7 (SEQ ID NO: 1) with an average i of less than 500 n , preferably less than 200 nM, more preferably less than 10 nM, such as less than 1 nM and an average SDF-1 and/or I- TAC displacement of 50% or more, more preferably of 75% or more, even more preferably of 80% or more.
  • Such an average Ki and/or average displacement value may be determined e.g. in an assay as described in Example 9 or 10.
  • Aspect A-9 An immunoglobulin single variable domain that can specifically displace SDF-1 and/or l-TAC (CXCLll and/or CXCL12) on CXCR7 and in particular on human CXCR7 (SEQ ID NO: 1) with an average Ki of less than 20 nM and an average SDF-1 and/or l-TAC displacement of 70% or more.
  • Such an average Ki and/or average displacement value may be determined e.g. in an assay as described in Example 9 or 10.
  • Aspect A-10 An immunoglobulin single variable domain according to any of the preceding aspects, that essentially consists of 4 framework regions (FR1 to FR4 respectively) and 3 complementarity determinin regions (CDR1 to CDR3 respectively).
  • Aspect A-ll An imm unoglobulin single va riable domain according to any of the preceding aspects, that is a n immunoglobulin sequence.
  • Aspect A-12 An imm unoglobulin single va riable domain according to any of the preceding aspects, that is a natura lly occurring imm unoglobulin sequence (from a ny suitable species) or a synthetic or semi-synthetic imm unoglobulin sequence.
  • Aspect A-13 An immunoglobulin single va riable domain accord ing to a ny of the preceding aspects that is a huma nized immunoglobulin sequence, a camelized immunoglobulin seq uence or a n immunoglobulin sequence that has been obtained by techniques such as affinity maturation.
  • Aspect A-14 An imm unoglobulin single variable domain according to a y of the preceding aspects, that essentially consists of a light chain variable domain sequence ⁇ e.g., a VL- sequence); or of a heavy chain variable domain sequence (e.g., a VH-sequence).
  • Aspect A-15 An im munoglobulin single varia ble domain according to a ny of the preceding aspects, that essentially consists of a heavy chain varia ble domain sequence that is derived from a conventiona l four-chain a ntibody or that essentially consist of a heavy cha in va riable doma in sequence that is derived from heavy chain a ntibody.
  • Aspect A-16 An im munoglobulin single va ria ble domain according to a ny of the preceding aspects, that essentia lly consists of a domain antibody (or an immunoglobulin single va riable domain that is suitable for use as a domain antibody), of a single domain antibody (or an im munoglobulin single variable domain that is suitable for use as a single doma in antibody), of a "dAb” (or an immunoglobulin single variable domain that is suitable for use as a dAb ⁇ or of a Nanobody (including but not limited to a VH H sequence).
  • Aspect A-17 An im munoglobulin single varia ble domain according to any of the preceding aspects, that essentially consists of a Na nobody.
  • Aspect A-18 An im munoglobulin single va riable domain according to a y of the preceding aspects, that essentia lly consists of a Na nobody that
  • i) has at least 80% amino acid identity with at least one of the imm unoglobulin single variable doma ins of SEQ I D NOs: 1 to 22 of WO 2009/138519, in which for the purposes of determ ining the degree of amino acid identity, the amino acid resid ues that form the CDR sequences a re disregarded;
  • Aspect A-19 An immunoglobulin single variable domain according to any of the preceding aspects, that essentially consists of an immunoglobulin single variable domain that i) has at least 80% amino acid identity with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 39 to 43, 91 or 99-102, in which for the purposes of determining the degree of amino acid identity, the amino acid residues that form the CDR sequences are disregarded;
  • ii) preferably one or more of the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the Kabat numbering are chosen from the Hallmark residues mentioned in Table A-l.
  • Aspect A-20 An immunoglobulin single variable domain according to any of the preceding aspects, that essentially consists of a polypeptide that comprises of
  • a first immunoglobulin single variable domain that has at least 80% amino acid identity with an immunoglobulin single variable domain selected from the group of immunoglobulin single variable domain having SEQ ID NOs: 39 to 43
  • amino acid residues that form the CDR sequences are disregarded; and, optionally, comprises
  • Aspect A-21 An immunoglobulin single variable domain according to any of the preceding aspects, that essentially consists of a humanized or otherwise sequence optimized immunoglobulin single variable domain.
  • Aspect A-22 An immunoglobulin single variable domain according to any of the preceding aspects, that, in addition to the at least one binding site for binding against CXCR7 and in particular human CXCR7 (SEQ ID NO: 1), contains one or more further binding sites for binding against other antigens, proteins or targets.
  • Aspect 8-1 An immunoglobulin single variable domain that is directed against and/or that can specifically bind CXCR7 and in particular human CXCR7 (SEQ ID NO: 1), and that comprises one or more (preferably one) stretches of amino acid residues chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with at least one of the immunoglobulin single variable domains of SEQ ID NOs 9 to 13, 93 or 107-110;
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 9 to 13, 93 or 107-110;
  • immunoglobulin single variable domains that have at least 80% amino acid identity with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 19 to 23, 95, or 115-118;
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 19 to 23, 95, or 115-118;
  • immunoglobulin single variable domains that have at least 80% amino acid identity with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 29 to 33, 97 or 123-126;
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 29 to 33, 97 or 123-126;
  • Such an immunoglobulin single variable domain may in particular be VHH or sequence optimized VHH such as humanized, stabilized and/or solubilized VHH.
  • Aspect B-2 An immunoglobulin single variable domain according to aspect B-1, in which at least one of said stretches of amino acid residues forms part of the antigen binding site for binding against CXCR7 and in particular human CXC 7 (SEQ ID NO: 1).
  • Aspect B-3 An immunoglobulin single variable domain sequence that is directed against and/or that can specifically bind CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) and that comprises two or more stretches of amino acid residues chosen from the group consisting of:
  • immunogiobuiin single variable domains that have at least 80% amino acid identity with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 9 to 13, 93 or 107-110;
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with at least one of the immunoglobulin single variable domains of SEQ !D NOs: 9 to 13, 93 or 107-110;
  • immunogiobuiin single variable domains that have at least 80% amino acid identity with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 19 to 23, 95, or 115-118;
  • immunogiobuiin single variable domains that have 3, 2, or 1 amino acid difference with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 19 to 23, 95, or 115-118;
  • immunoglobulin single variable domains that have at least 80% amino acid identity with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 29 to 33, 97 or 123-126;
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with at least one of the immunoglobulin single variable domains of
  • Such an immunoglobulin single variable domain may in particular be VHH or sequence optimized VHH such as humanized, stabilized and/or solubilized VHH.
  • Aspect B-4 An immunoglobulin single variable domain according to aspect B-3, in which the at least two stretches of amino acid residues forms part of the antigen binding site for binding against CXC 7 and in particular human CXCR7 (SEQ ID NO: 1).
  • Aspect B-5 An immunoglobulin single variable domain sequence that is directed against and/or that can specifically bind CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) and that comprises three or more stretches of amino acid residues, in which the first stretch of amino acid residues is chosen from the group consisting of: a) the immunoglobuiin single variable domains of SEQ. ID NOs: 9 to 13, 93 or 107- 110;
  • immunoglobulin single variable domains that have at least 80% amino acid identity with at least one of the immunoglobulin single variable domains of
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 9 to 13, 93 or 107-110;
  • the second stretch of amino acid residues is chosen from the group consisting of: d) the immunoglobulin single variable domain of SEQ ID NOs: 19 to 23, 95, or 115-118;
  • immunoglobulin singie variable domains that have at least 80% amino acid identity with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 19 to 23, 95, or 115-118;
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 19 to 23, 95, or 115-118;
  • the third stretch of amino acid residues is chosen from the group consisting of: g) the immunoglobulin single variable domains of SEQ ID NOs: 29 to 33, 97 or
  • immunoglobulin single variable domains that have at least 80% amino acid identity with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 29 to 33, 97 or 123-126; i) immunoglobu!in single variable domains that have 3, 2, or 1 amino acid difference with at least one of the immunoglobulin single variable domains of SEQ ID NOs: 29 to 33, 97 or 123-126.
  • Such an immunoglobulin single variable domain may in particular be VHH or sequence optimized VHH such as humanized, stabilized and/or solubilized VHH,
  • Aspect B-6 An immunoglobulin single variable domain according to aspect B-5, in which the at least three stretches of amino acid residues forms part of the antigen binding site for binding against CXCR7 and in particular human CXCR7 ⁇ SEQ ID NO: 1).
  • Aspect B-7 An immunoglobulin single variable domain that is directed against and/or that can specifically bind CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) in which the
  • CDR sequences of said immunoglobulin single variable domain have at least 70% amino acid identity, preferably at least 80% amino acid identity, more preferably at least 90% amino acid identity, such as 95% amino acid identity or more or even essentially 100% amino acid identity with the CDR sequences of at least one of the immunoglobulin single variable domains of SEQ ID NOs: 39 to 43, 91 or 99-102.
  • the CDR sequences are preferentially determined via Kabat as defined herein.
  • Such an immunoglobulin single variable domain may in particular be VHH or sequence optimized VHH such as humanized, stabilized and/or solubilized VHH.
  • Aspect C-l An immunoglobulin single variable domain or polypeptide that is directed against
  • an immunoglobulin single variable domain may in particular be an immunoglobulin single variable domain according to any of the aspects A-l to A-22 and/or according to aspects B-l to B-7.
  • such an immunoglobulin single variable domain is able to specifically bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1).
  • Aspect C-2 An immunoglobulin single variable domain or polypeptide, such as an antibody or fragment thereof, that is directed against CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) and that is cross-blocked from binding to CXCR7 and in particular human
  • CXCR7 by at least one of the immunoglobulin single variable domains of SEQ ID NOs: 39 to 43, 91 or 99-102, or polypeptides of SEQ ID NOs: 44 to 48, 78-89 or 131-140.
  • an immunoglobulin single variable domain may in particular be an immunoglobulin single variable domain according to any of the aspects A-l to A-22 and/or according to aspects B-1 to B-7.
  • a n immunoglobulin single variable domain is able to specifically bind to CXCR7 and in particular huma n CXCR7 (SEQ ID NO: 1).
  • An immunoglobulin single variable doma in or polypeptide according to any of aspects C-l to C-3 wherein the ability of said imm unoglobulin single variable domain to cross-block or to be cross-blocked is detected in an ELISA assay.
  • An immunoglobulin single varia ble domain according to any of aspects B-1 to B-7 or C-l to C-7, that is in essentia lly isolated form .
  • An immunoglobulin single variable domain according to a y of aspects B-1 to B-7, C-l to C-7, and/or Dl for administration to a subject, wherein said immunoglobulin single variable doma in does not natura lly occur in sa id subject.
  • An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-l to C-7, and/or Dl to D-2 that can specifically bind to CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) with a dissociation consta nt (K D ) of 10 s to 10 "12 moles/litre or less, and preferably 10 " 7 to 10 '12 moles/litre or less and more preferably 10 "8 to 10 "12 moles/litre.
  • K D dissociation consta nt
  • An imm unoglobulin single variable domain according to any of aspects B-1 to B-7, C- l to C-7, and/or D-l to D-3 that can specifically bind to CXCR7 and in pa rticular human CXCR7 (SEQ ID NO: 1) with a rate of association (k on -rate) of between 10 2 M ' Y 1 to about 10 7 fviV 1 , preferably between 10 3 ' V 1 and 10 7 M ' V 1 , more preferably between 10 4 M ' V 1 and 10 7 M ' V 1 , such as between 10 s M ' Y 1 and lO 7 IvrV.
  • An imm unoglobulin single va riable domain according to a ny of aspects B-1 to B-7, C-l to C-7, and/or D-l to D-4 that can specifically bind to CXCR7 and in pa rticular human CXCR7 (SEQ ID NO: 1) with a rate of dissociation (k off rate) between 1 s "1 and 10 " s "1 preferably between 10 '2 s "1 and 10 e s 1 , more preferably between 10 "3 s "1 and 10 "6 s ⁇ ⁇ such as between 10 " * s "1 and 10 6 s "1 .
  • An im munoglobulin single variable domain according to any of aspects B- 1 to B-7, C- 1 to C-7, and/or D-l to D-5 that can specifically bind to CXCR7 and in particula r human CXCR7 (SEQ I D NO: 1) with an affinity less than 500 nM, preferably less than 200 nM, more preferably I ess than 10 nM, such as less than 500 pM.
  • the immunoglobulin single variable domains according to aspects D-l to D-6 may in particular be an immunoglobulin single variable domain according to any of the aspects A-l to A-22.
  • An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7 and/or Dl to D-6, that is a naturally occurring immunoglobulin single variable domain (from any suitable species) or a synthetic or semi-synthetic immunogiobulin single variable domain.
  • An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or E-l that is sequence optimized
  • An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or D-l or D-2 that is stabilized.
  • An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or E-l to E-3, that is a naturally occurring immunoglobulin sequence (from any suitable species) or a synthetic or semi-synthetic immunoglobulin sequence.
  • An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or E-l to E-4 that is a humanized immunoglobulin sequence, a camelized immunoglobulin sequence or an immunoglobulin sequence that has been obtained by techniques such as affinity maturation.
  • An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or E-l to E-5 that essentially consists of a light chain variable domain sequence ⁇ e.g., a V.-sequence); or of a heavy chain variable domain sequence (e.g., a V H -sequence).
  • An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or E-l to E-6, that essentially consists of a heavy chain variable domain sequence that is derived from a conventional four-chain antibody or that essentially consist of a heavy chain variable domain sequence that is derived from heavy chain antibody.
  • An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or E-l to E-7, that essentially consists of a domain antibody (or an immunoglobulin single variable domain that is suitable for use as a domain antibody), of a single domain antibody (or an immunoglobulin single variable domain that is suitable for use as a single domain antibody), of a "dAb” (or a immunoglobulin single variable domain that is suitable for use as a dAb) or of a Nanobody (including but not limited to a V H H sequence).
  • Aspect E ⁇ 9 An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or E-1 to E-8 that essentially consists of a Nanobody.
  • Aspect E-10 An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or E-1 to E-9 that essentially consists of a immunoglobulin single variable domain that
  • i) has at least 80% amino acid identity with at least one of the immunoglobulin single variable domains described herein, in which for the purposes of determining the degree of amino acid identity, the amino acid residues that form the CDR sequences are disregarded;
  • ii) preferably one or more of the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the Kabat numbering are chosen from the Hallmark residues mentioned in Table B-2.
  • Aspect E-11 An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or E-1 to E-10, that essentially consists of an immunoglobulin single variable domain that
  • i) has at least 80% amino acid identity with at least one of the An immunoglobulin single variable domains of SEQ ID NOs: 39 to 43, 91 or 99-102, in which for the purposes of determining the degree of amino acid identity, the amino acid residues that form the CDR sequences are disregarded;
  • ii) preferably one or more of the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the Kabat numbering are chosen from the Hallmark residues mentioned in Table B-2.
  • Aspect E-12 An immunoglobulin single variable domain according to any of aspects B-1 to B-7, C-1 to C-7, Dl to D-6, and/or E-1 to E-11 that essentially consists of a humanized immunoglobulin single variable domain.
  • Aspect E-13 An immunoglobulin single variable domain according to any of the aspects B-1 to B-7,
  • the immunoglobulin single variable domains according to aspects E-1 to E-13 may in particular be an immunoglobulin single variable domain according to a y of the aspects A-l to A-22.
  • Aspect K-l Polypeptide that comprises of one or more immunoglobulin single variable domains according to any of aspects A-l to A-22, B-l to B-7, C-l to C-4, D-1 to D-6, and/or E-1 to E-13, and optionally further comprises one or more peptidic linkers.
  • Aspect K-2 Polypeptide according to aspect K-l, which additionally comprises one or more
  • immunoglobulin single variable domain directed against serum albumin.
  • Aspect K-3 Polypeptide according to any of aspects K-l or K-2, in which said immunoglobulin single variable domain directed against serum albumin is directed against human serum albumin.
  • Aspect K-4 Polypeptide according to any of aspects K-l to K-3, in which said one or more immunoglobulin single variable domain directed against serum albumin is an immunoglobulin single variable domain with SEQ ID NO: 2.
  • Aspect K-5 Polypeptide that comprises of one or more immunoglobulin single variable domains according to any of aspects A-l to A-22, B-l to B-7, C-l to C-4, D-1 to D-6, and/or E-1 to E-13, one or more cytotoxic payioads, and optionally further comprises one or more peptidic linkers.
  • Aspect K-6 Polypeptide that comprises or essentially consists of one or more immunoglobulin single variable domains according to any of aspects A-l to A-22, B-l to B-7, C-l to C- 4, D-1 to D-6, and/or E-1 to E-13, one or more (and preferably one) immunoglobulin single variable domains (preferably Nanobody) directed against CXCR4 and optionally further comprises one or more peptidic linkers.
  • Aspect K-7 Polypeptide that comprises or essentially consists of at least one (preferably one) immunoglobulin single variable domain (preferably Nanobody) directed against (human) CXCR7 and at least one (cyto)toxic group, moiety or payload (optionally linked chemically or via one or more suitable linkers or spacers).
  • immunoglobulin single variable domain preferably Nanobody
  • Aspect K-8 Polypeptide that comprises or essentially consists of at least one (preferably one) immunoglobulin single variable domain (preferably Nanobody) directed against (human) CXCR7, at least one (preferably one) immunoglobulin single variable domain (preferably Nanobody) directed against (human) CXCR4 and at least one (cyto)toxic group, moiety or payload (optionally linked chem ically or via one or more suitable linkers or spacers).
  • Aspect K-9 Polypeptide that comprises or essentially consists of at least one (preferably one) immunoglobulin single variable domain (preferably Nanobody) directed against (human) CXCR7 and at least one (preferably one) immunoglobulin single variable domain (prefera bly Na nobody) directed aga inst ( huma n) CXC 4 (optionally linked chemically or via one or more suitable linke rs or spacers).
  • immunoglobulin single variable domain preferably Nanobody
  • immunoglobulin single variable domain prefera bly Na nobody
  • Aspect K-10 Polypeptide that comprises or essentially consists of at least one (preferably one) immunoglobulin single va ria ble domain ( refera bly Na nobody) directed against (human) CXCR7, at least one (preferably one) immunoglobulin single variable domain
  • Nanobody directed against (human) CXCR4, a nd a peptide or immunoglobulin single varia ble domain ( prefera bly Nanobody) d irected against (human) serum a lbumin (optionally linked chemically or via one or more suitable linkers or spacers).
  • Aspect K-l l Polypeptide that comprises or essentially consists of two immunoglobulin single variable domains (preferably Nanobody) directed against (human) CXCR7, which a re the same (optionally lin ked chemically or via one or more suitable linkers or spacers).
  • Aspect K-12 Polypeptide that comprises or essentially consists of two immunoglobulin single variable domains (preferably Nanobody) d irected aga inst (human) CXCR7, which a re different from each other (optionally linked chemically or via one or more suitable linkers or spacers) .
  • Aspect K-13 Polypeptide that com prises or essentia lly consists of two immunoglobulin single va riable domains (prefera bly Na nobody) directed against (huma n) CXCR7, which are the same, and a peptide or immunoglobulin single variable domain (prefera bly Nanobody) directed against (human) serum albumin (optionally linked chemically or via one or more suitable linkers or spacers).
  • Aspect K-14 Polypeptide that comprises or essentially consists of two immunoglobulin single variable domains (preferably Nanobody) directed against (human) CXCR7, which are d ifferent from each other, and a peptide or i mmunoglobulin single va riable domain (preferably Nanobody) directed against (human) serum albumin (optionally linked chemically or via one or more suitable linkers or spacers) .
  • Nucleic acids preferably Nanobody directed against (human) CXCR7, which are d ifferent from each other
  • a peptide or i mmunoglobulin single va riable domain preferably Nanobody directed against (human) serum albumin (optionally linked chemically or via one or more suitable linkers or spacers) .
  • Aspect M-l Nucleic acid or nucleotide sequence, that encodes an immunoglobulin single variable domain according to any of aspects A-l to A-22, B-l to B-7, C-l to C-4, D-l to D-6, E-l to E-13, a polypeptide according to any of aspects K-l to K-4.
  • Aspect -2 Nucleic acid or nucleotide sequence with SEQ ID NOs: 59-63, 73-77 or 99 (Table B-6).
  • Aspect N-l Host or host eel! that expresses, or that under suitable circumstances is capable of expressing, an immunoglobulin single variable domain according to any of aspects A- 1 to A-22, B-l to B-7, C-l to C-4, D-l to D-6, E-l to E-13, a polypeptide according to any of aspects K-l to K-4; and/or that comprises a nucleic acid o nucleotide sequence according to aspect M-l or M-2.
  • Aspect 0-1 Composition comprising at least one immunoglobulin single variable domain according to any of aspects A-l to A-22, B-l to B-7, C-l to C-4, D-l to D-6, E-l to E-13, or at Ieast one polypeptide according to any of aspects K-l to K-4, or nucleic acid or nucleotide sequence according to aspects M-l or M-2.
  • Aspect 0-2 Composition according to aspect 0-1, which is a pharmaceutical composition.
  • composition according to aspect 0-2 which is a pharmaceutical composition, that further comprises at ieast one pharmaceutically acceptable carrier, diluent or excipient and/or adjuvant, and that optionally comprises one or more further pharmaceutically active polypeptides and/or compounds.
  • Aspect P-l Method for producing an immunoglobulin single variable domain according to any of aspects A-l to A-22, B-l to B-7, C-l to C-4, D-l to D-6, E-l to E-13, a polypeptide according to any of aspects K-l to K-4, said method at Ieast comprising the steps of: a) expressing, in a suitable host cell or host organism or in another suitable expression system, a nucleic acid or nucleotide sequence according to aspect M-l, or aspect M-2;
  • Aspect P-2 Method for prod ucing an immunoglobulin single variable domain according to any of aspects A-1 to A-22, B-1 to B-7, C-1 to C-4, D-1 to D-6, E-1 to E-13, a polypeptide accord ing to any of aspects K-l to K-4, said method at least comprising the steps of: a) cultivating and/or ma intaining a host or host cell according to aspect N-l under cond itions that a re such that said host or host cell expresses and/or produces at least one imm unoglobulin single variable domain according to any of aspects A-1 to A-22, B-1 to B-7, C-1 to C-4, D-1 to D-6, E-1 to E-13, a polypeptide according to any of aspects K-l to K-4;
  • nucleic acid sequences that encode an imm unoglobulin single variable domain that ca n bind to and/or has affinity for CXCR7 and in pa rticular human CXCR7 (SEQ ID NO: 1) and that is cross-blocked or is cross blocking a Nanobody of the invention, e.g., SEQ ID NO: 39 to 43, 91 or 99-102 (Table-B-3), or a polypeptide or construct of the invention, e.g., SEQ ID NO: 44 to 48, 78-89 or 131-140 (see Table B-4 ⁇ ; and
  • said method comprising administering, to a subject in need thereof, a pharmaceutical ly active amount of at least one imm unoglobulin single varia ble domain according to any of aspects A-1 to A-22, B-1 to B-7, C-1 to C-4, 1
  • Aspect R-2 Method for the prevention and/or treatment of at least one disease or disorder that is associated with CXCR7 and in particular human CXCR7 (SEQ ID NO: 1), with its biological or pharmacological activity, and/or with the biological pathways or signalling in which CXCR7 and in particular human CXCR7 (SEQ ID NO: 1) is involved, said method comprising administering, to a subject in need thereof, a pharmaceutically active amount of at least one immunoglobulin single variable domain according to any of aspects A-l to A-22, B-1 to B-7, C-1 to C-4, D-1 to D-6, E-1 to E-13, a polypeptide according to any of aspects K-l to K-4; or composition according to aspect 0-2 or 0-3.
  • Aspect R-3 Method for the prevention and/or treatment of at least one disease or disorder that can be prevented and/or treated by administering, to a subject in need thereof, at least one immunoglobulin single variable domain according to any of aspects A-l to A-22, B-1 to B-7, C-1 to C-4, D-1 to D-6, E-1 to E-13, a polypeptide according to any of aspects K-l to K-4; or composition according to aspect 0-2 or 0-3, said method comprising administering, to a subject in need thereof, a pharmaceutically active amount of at least one at least one immunoglobulin single variable domain according to any of aspects A-l to A-22, B-1 to B-7, C-1 to C-4, D-1 to D-6, E-1 to E-13, a polypeptide according to any of aspects K-l to K-4; or composition according to aspect 0-2 or 0-3.
  • Aspect R-4 Method for immunotherapy, said method comprising administering, to a subject in need thereof, a pharmaceutically active amount of at least one immunoglobulin single variable domain according to any of aspects A-l to A-22, B-1 to B-7, C-1 to C-4, D-1 to D-6, E-1 to E-13, a polypeptide according to any of aspects K-l to K-4; or composition according to aspect 0-2 or 0-3.
  • Aspect R-5 An immunoglobulin single variable domain according to any of aspects A-l to A-22, B- 1 to B-7, C-1 to C-4, D-1 to D-6, E-1 to E-13, a polypeptide according to any of aspects K-l to K-4, a pharmaceutical composition according to aspect 0-2 or 0-3 for use in one or more of the methods according to aspects R-l to R-3.
  • Aspect R-6 A polypeptide according to any of aspects K-l to K-4, for the diagnosis, prevention and/or treatment of cancer. Further aspects:
  • a construct comprising at least one immunoglobulin single variable domain (ISVD) that binds to and/or recognizes amino acid residue M33, and optionally amino acid residue V32 and/or amino acid residue M37 in CXC 7 (SEQ ID NO: 1) and at least one ISVD that binds to and/or recognizes amino acid residue WF19, and optionally S23 and/or D25 of CXCR7 (SEQ. ID NO: 1).
  • ISVD immunoglobulin single variable domain
  • the construct according to aspect 1 for use as a medica ment to reduce tumour growth and/or to treat cancer, preferably head and neck cancer or GBM.
  • An immunoglobulin single variable domain that can specifically displace SDF-1 and l-TAC on human CXCR7 (SEQ ID NO: 1) with an average Ki of less than 100 nfvl and an average SDF-1 and l-TAC displacement of 50% or more.
  • An immunoglobulin single variable domain that can specifically displace SDF-1 on human CXCR7 (SEQ ID NO: 1) with an average Ki of less than 100 nM and an average SDF-1 displacement of 50% or more.
  • An immunoglobulin single variable domain that can specifically displace l-TAC on human CXCR7 (SEQ ID NO: 1) with an average Ki of less than 100 nM and an average l-TAC displacement of 50% or more.
  • An immunoglobulin single variable do main that can bind human CXCR7 (SEQ ID NO: 1 ⁇ with a Kd of less than 50nM.
  • An immunoglobulin single variable domain that binds to and/or recognizes amino acid residue M33, and optionally amino acid residue V32 and/or amino acid residue M37 in CXCR7 (SEQ ID NO: 1).
  • An immunoglobulin single variable domain that binds to and/or recognizes amino acid residue WF19, and optionally S23 and/or D25 of CXCR7 (SEQ ID NO: 1).
  • the i mmunoglobulin single variable domain according to aspect 10 or 11 for use as a medicament to reduce tumour growth and/or to treat cancer, preferably head and neck cancer or GBM.
  • CDR1 is chosen from the group consisting of:
  • CDR2 is chosen from the group consisting of:
  • CDR3 is chosen from the group consisting of:
  • immunoglobulin si ngle variable domain of any of aspects 3-12, wherein the immunoglobulin single va riable doma in comprises a n a mino acid sequence with the formula 1
  • FRl to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable doma in:
  • CDRl is chosen from the group consisting of:
  • CDR2 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 20; f) immunogiobuiin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 20; and wherein CDR3 is chosen from the group consisting of:
  • immunoglobulin single variabie domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 30; i) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunogiobuiin single variabie domain of SEQ ID NO: 30.
  • immunoglobulin single variable domain of any of aspects 3-12, wherein the immunogiobuiin single variable domain comprises an amino acid sequence with the formula 1
  • FRl to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain
  • CDR1 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 11, c) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 11, and wherein CDR2 is chosen from the group consisting of;
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 21; f) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variabie domain of SEQ ID NO: 21; and wherein CDR3 is chosen from the group consisting of: g) the immunoglobulin single variable domain of SEQ ID NO: 31;
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 31; i) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 31.
  • immunoglobulin single variable domain of any of aspects 3-12, wherein the immunoglobulin single variable domain comprises an amino acid sequence with the formula 1
  • FRl to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain
  • CDR1 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 12
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 12, and wherein CDR2 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 22; f) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 22; a d wherein CDR3 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 32; i) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 32.
  • immunoglobulin single variable domain of any of aspects 3-12, wherein the immunoglobulin single variable domain comprises an amino acid sequence with the formula 1
  • FRl to F 4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain
  • CDR1 is chosen from the group consisting of: a) the immunoglobulin single variable domain of SEQ ID NO: 13,
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 13
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ. ID NO: 13 and wherein CDR2 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 23; f) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 23; and wherein CDR3 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 33; i) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 33.
  • immunoglobulin single variable domain of any of aspects 3-12, wherein the immunoglobulin single variable domain comprises an amino acid sequence with the formula 1
  • FRl to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain; a d wherein CDR1 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 93, c) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 93; and wherein CDR2 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 95; f) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 95; and wherein CDR3 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 97; i) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 97.
  • immunoglobulin single variable domain of any of aspects 3-12, wherein the immunoglobulin single variable domain comprises an amino acid sequence with the formula 1 FRl - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4 (1); wherein FRl to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain; and
  • CDR1 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 107
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 107
  • CDR2 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 115; f) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ 10 NO: 115; and wherein CDR3 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 123; i) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 123.
  • immunoglobulin single variable domain of any of aspects 3-12, wherein the immunoglobulin single variable domain comprises an amino acid sequence with the formula 1 FRl - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4 (1); wherein FRl to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain; and
  • CDR1 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 108
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 108
  • CDR2 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 116; f) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 116; and wherein CDR3 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 124; i) immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 124.
  • immunoglobulin single variable domain of any of aspects 3-12, wherein the immunoglobulin single variable domain comprises an amino acid sequence with the formula 1 FRl - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4 (1); wherein FRl to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain; and
  • CDR1 is chosen from the group consisting of:
  • immunoglobulin single variable domains that have at least 80% amino acid identity with the immunoglobulin single variable domain of SEQ ID NO: 110
  • immunoglobulin single variable domains that have 3, 2, or 1 amino acid difference with the immunoglobulin single variable domain of SEQ ID NO: 110
  • CDR2 is chosen from the group consisting of:
  • FRs framework regions
  • SEQ ID NQs 4 to 8, 92, 103, 104 or 106
  • FR1 14 to 18, 94, 111, 112 or 114
  • FR3 24 to 28, 96, 119, 120 or 122
  • FR4 34 to 38, 98, 127, 128 or 130
  • the polypeptide according to aspect 23, wherein the immunoglobulin single variable domain is selected from the group consisting of immunoglobulin single variable domains that have an a mino acid sequence with a sequence identity of more than 80% with the immunoglobulin single va riable domains of SEQ I D NOs: 39 to 43, 91 o 99-102.
  • polypeptide according to a ny of aspects 23 - 25 a nd add itiona lly comprising ALBS (SEQ I D NO: 2), and optionally comprising a linker selected from the group of linkers with SEQ ID NOs: 49 to 58.
  • constructs comprising at least two ISVDs that bind to and/or recognize am ino acid residue WF19, a nd optionally S23 a d/or D25 of CXCR7 (SEQ ID NO : 1), wherein said at least two ISVDs ca n be the same or different; constructs comprising at least two ISVDs that bind to and/or recognize amino acid residue M33, and optionally amino acid residue V32 and/or amino acid residue 37 in CXCR7 (SEQ ID NO: 1), wherein said at least two ISVDs can be the same or different; constructs comprising at least one group 1 ISVD and at least one group 2 ISVD; - constructs comprising at least one group 1 ISVD and at least one group 3 ISVD;
  • constructs comprising at least one group 2 ISVD and at least one group 3 ISVD; and constructs comprising at least one OlClO-like sequence and at least one 14G03-like sequence.
  • the construct according to aspect 28 for use as a medicament to reduce tumour growth and/or to treat cancer, preferably head and neck cancer or GBSVl.
  • a pharmaceutical composition comprising
  • An immunoglobulin single variable domain according to any of aspects 3-22, a polypeptide according to any of aspects 23-27, or a construct according to any of aspects 1, 2, 28 or 29for use in rheumatoid arthritis.
  • An immunoglobulin single variable domain according to any of aspects 3-22, a polypeptide according to any of aspects 23-27, or a construct according to any of aspects 1, 2, 28 or 29 for use in multiple sclerosis.
  • FR1 to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain
  • CDR1 is the immunoglobuiin single variable domain of SEQ ID NO: 9;
  • COR2 is the immunoglobulin single variable domain of SEQ ID NO: 19;
  • CDR3 is the immunoglobulin single variable domain of SEQ ID NO: 29. 37.
  • An immunoglobulin single variable comprising an amino acid sequence with the formula 1 variable domain comprises an amino acid sequence with the formula 1
  • FR1 to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain
  • CDR1 is the immunoglobulin single variable domain of SEQ ID NO: 10;
  • CDR2 is the immunoglobulin single variable domain of SEQ ID NO: 20;
  • CDR3 is the immunoglobulin single variable domain of SEQ ID NO: 30.
  • An immunoglobulin single variable comprising an amino acid sequence with the formula 1 variable domain comprises an amino acid sequence with the formula 1
  • FR1 to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain
  • CDR1 is the immunoglobulin single variable domain of SEQ ID NO: 11;
  • CDR2 is the immunoglobulin single variable domain of SEQ ID NO: 21;
  • CDR3 is the immunoglobulin single variable domain of SEQ ID NO: 31.
  • An immunoglobulin single variable comprising an amino acid sequence with the formula 1 variable domain comprises an amino acid sequence with the formula 1
  • FR1 to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain
  • CDR1 is the immunoglobulin single variable domain of SEQ ID NO: 12;
  • CDR2 is the immunoglobulin single variable domain of SEQ ID NO: 22; and wherein CDR3 is the immunoglobulin single variable domain of SEQ ID NO: 32.
  • An immunoglobulin single variable comprising an amino acid sequence with the formula 1 variable domain comprises an amino acid sequence with the formula 1
  • FR1 to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain
  • CDR1 is the immunoglobulin single variable domain of SEQ ID NO: 13;
  • CDR2 is the immunoglobulin single variable domain of SEQ ID NO: 23; and wherein CDR3 is the immunoglobulin single variable domains of SEQ ID NO: 33.
  • An immunoglobulin single variable comprising an amino acid sequence with the formula 1 variable domain comprises an amino acid sequence with the formula 1
  • FR1 to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain
  • CDR1 is the immunoglobulin single variable domain of SEQ ID NO: 93;
  • CD 2 is the immunoglobulin single variable domain of SEQ ID NO: 95; and wherein CDR3 is the immunoglobulin single variable domain of SEQ ID NO: 97.
  • An immunoglobulin single variable comprising an amino acid sequence with the formula 1 variable domain comprises an amino acid sequence with the formula 1
  • FR1 to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable domain
  • CDR1 is the immunoglobulin single variable domain of SEQ ID NO: 107;
  • CDR2 is the immunoglobulin single variable domain of SEQ ID NO: 115; and wherein CDR3 is the immunoglobulin single variable domain of SEQ ID NO: 123.
  • An immunoglobulin single variable comprising an amino acid sequence with the formula 1 variable domain comprises an amino acid sequence with the formula 1
  • FR1 to FR4 refer to framework regions 1 to 4 and are framework regions of an immunoglobulin single variable doma in;
  • CDR1 is the immunoglobulin single variable domain of SEQ ID NO: 108;
  • CDR2 is the immunogiobuiin single varia ble domain of SEQ. ID NO: 116; and wherein CDR3 is the immunoglobulin single varia ble domains of SEQ ID NO: 124.
  • An immunoglobulin single va ria ble comprising an amino acid sequence with the formula 1 variable domain comprises a n amino acid sequence with the formula 1
  • FRl to FR4 refer to framework regions 1 to 4 a nd are framework regions of an im m unoglobul in single varia ble doma in;
  • CDR1 is the imm unoglobulin single va riable domain of SEQ ID NO: 110;
  • CDR2 is the imm unoglobulin single va riable domain of SEQ ID NO: 118; and wherein CDR3 is the immunoglobulin single variable domain of SEQ ID NO: 126.
  • APGKERERVAAITPRAFTTYYADSVKGRFTISRDNAKNT AYLQI SLKPEDTAVYYCAAQLVGSGSNLGRQESYAYWG QGTLVTVSSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS GGGGSEVQLVESGGGLVQTGASLRLSCAASGRTFSNYA GWFRQAPGKERERVAAITPRAFTTYYADSVKGRF ISRD NAKNTAYLQMVSLKPEDTA YYCAAQLVGSGSNLGRQES YAY GQGTLV VSSGGGGSGGGGSGGGGSGGGGSGGGGS GGGGSGGGGSEVQLVESGGGLVQPGNSLRLSCAASGFTF SSFGMSWVRQAPGKGLEWSSISGSGSDTLYADSVKGRF TISRDNAKTTLYLQMNSLRPEDTAVYYCTIGGSLSRSSQ
  • GAGGTACAGCTGGTGGAGTCTGGGGGTGGCTTGGTGCAA CCGGGTAACAGTCTGCGCCTTAGCTGCGCAGCGTCTGGC TTTACCTTCAGCTCCTTTGGCATGAGCTGGGTTCGCCAG GCTCCGGGAAAAGGACTGGAATGGGTTTCGTCTATTAGC
  • GGCAGTGGTAGCGATACGCTCTACGCGGACTCCGTGAAG GGCCGTTTCACCATCTCCCGCGATAACGCCAAAACTACA CTGTATCTGCAAATGAATAGCCTGCGTCCTGAAGACACG
  • endotoxin-free pVAXl-CXCR7 plasmid was produced, dissolved to a concentration of 2 mg/mL in 0.9% saline and stored at -20T.
  • Four llamas (391, 395, 396 and 397) were immunized with 2 mg pVAXl-hCXCR7 via intradermal Jet injection (Akra DermoJet France) for four times with two weeks intervals.
  • the 4 animals received a boost with camel kidney (CAK!) cells (Nguyen et al. 2001. Adv. Immunol. 79: 261-296) (2 x 10 7 cells) stably expressing hCXCR7.
  • llamas Three llamas (385, 387 and 404) were immunized with four injections of 2 x 10 7 HEK293 cells transfected with pCDNA3.1-hCXCR7 with two weeks intervals. From llamas 391, 395, 396 and 397, peripheral blood lymphocytes were collected 4 days and 10 days after the last DNA immunization and 3 days and 9 days after the cell boost. From llamas 385, 387 and 404, peripheral blood lymphocytes were collected 4 and 8 days after the final cell injection. Additionally, a biopsy of the palpable bow iymph node (LN) was collected from each llama via local surgery 3 days after the last ceil boost. From all lymphocyte harboring immune tissues total RNA was extracted and used as template to prepare cDNA.
  • LN palpable bow iymph node
  • cDNA was prepared from the extracted total RNA samples (example 2) and used to amplify the cDNA repertoire via nested PCR as previously described (WO 02/085945 and WO 04/049794).
  • the PCR products were digested with S//I (introduced via nested PCR in the FR1 primer region) and SsfEII (restriction site naturally occurring in FR4) and following gel electrophoresis, the DNA fragment of approximately 400 bps was purified from gel.
  • the amplified cDNA repertoire was iigated into the corresponding restriction sites of S/ I- SsrEII digested phage display vector (pAX50) to obtain a library after e!ectropo ration of Escherichia coli TGI.
  • This display vector allows the production of phage particles, expressing the individual VHHs (hereinforth also referred to as Nanobodies) as a fusion protein with a C-terminal yc-His6-tag (hereinforth also TAG-1 or SEQ ID NO: 71) and with the genel!l product.
  • Phage from the above libraries were used for selections on HCXCR7 virus-like particles (VLP; Integral Molecular), intact CXCR7 expressing cells, membrane extracts from CXCR7 expressing cells and peptides.
  • VLP virus-like particles
  • a first selection round 10 units of VLPs derived from H.CXCR7 transfected HEK293 cells were coated in 96- we I i Maxisorp plate (Nunc) and blocked with low-fat milk powder (Marvel! 4% in PBS). After 2 hours of incubation with rescued phage, trypsin elution (1 mg/mi) was allowed for 15 minutes at room temperature subsequent to 20 PBS washes. Protease activity was immediately neutralized by applying 16 m protease inhibitor ABSF. The round 1 phage outputs were rescued and a second selection round was performed on 10 or 1 units of plate-immobilized hCXCR7 VLPs. The round 2 phage outputs selected on 10 or 1 units plate immobilized hCXCR7 VLPs were infected into TGI cells and plated on agar plates (LB + Amp + 2% glucose).
  • Nanobodies were sequenced and redundant Nanobodies (identical AA sequence) were removed. This resulted in the identification of 78 unique sequences, belonging to 45 distinct Nanobody B-cel! lineages. Phage ELISA data for representative clones from distinct Nanobody B-cell lineages are represented in Table B-7 and indicate that the Nanobodies do bind to human CXCR7 on VLP. Notably, all Nanobodies were derived from PBLs after cell boost, except for Nanobody 01C10 (see Example 2). Evaluated against the other CXCR7 specific Nanobodies, Nanobody 01C10 was a notorious weak binder, which in first instance was used for comparative reasons (data not shown).
  • Ciones representing distinct Nanobody B-ceil lineages were tested as periplasmic extracts for their binding to ceil surface exposed CXC 7.
  • 5-fold dilutions of periplasmic extract were incubated with Hek293 HCXCR7 and Hek293wt cells.
  • Binding of the Nanobodies was detected using mouse anti-myc (Serotec), followed by anti-mouse IgG-PE (Jackson !mmununoresearch).
  • Binding signals of selected Nanobody clones are represented in Table B-8 and indicate that the Nanobodies do bind to cellular human CXCR7.
  • Table ⁇ -8 CXCR7 screening resuits-FACS analysis.
  • Nanobodies were recloned in £ coli expression vector pAXlOO and expressed as C-terminal linked myc, His6 (hereforth also Tag-2 or SEQ ID NO: 72) -tagged proteins.
  • Various Nanobodies were also expressed as fusion proteins comprising Alb8 (Nanobody-linker-A!b8-myc-His6) (see sequences SEQ ID NOs: 44 to 48 - Table B-4) or as tagless Nanobodies. Expression was induced by IPTG and allowed to continue for 4h at 37°C. After spinning the cell cultures, periplasmic extracts were prepared by freeze-thawing the pellets. Nanobodies were purified from these extracts using immobilized metal affinity chromatography (I AC) and a buffer exchange to D-PBS.
  • I AC immobilized metal affinity chromatography
  • Example 9 Nanobodies compete with SDF-1 for CXCR7 binding (displacement assay)
  • Nanobodies were evaluated in SDF-1 ligand displacement assays using stable NIH3T3-hCXCR7 cells. 24h after seeding the cells, the cells were pre- incubated for 1 h at 4°C with a dilution series of purified monovalent Nanobodies and the corresponding C-terminal Tag-2 tagged fusion proteins to the human serum albumin binding Nanobody Alb8 (see Table B-4: SEQ ID NOs 44 to 48 wherein the polypeptides are all C-terminal tagged with Tag-2). Also reference molecules Mab 8F11 (Biolegend), Mab 11G8 (R&D) and unlabelled SDF-1 were included in the assay.
  • Radiolabeled [ 5 I]-CXCL12 was diluted and added to the cells to reach a final concentration of 75 pM and cells were incubated for 3 h at 4°C. After incubation, cells were washed twice, lysed with R!PA buffer and the 123 l signal was measured. Average i values and the percentage of displacement relative to the displacement of cold SDF-1, are shown in Table B-10. The competition of tested Nanobodies of Group 1 and Mab 8F11 is between 73 and 83%, relative to competition with unlabelled SDF-1.
  • Nanobody 07C03 and Mab 8F11 (Biolegend) to compete with SDF-1 was evaluated in competition FACS with HEK-hCXCR7 cells. Cells were incubated simultaneously with 4 nfvl biotiny!ated SDF-1 (R&D) and with diluted test molecules, for 2 h at 4X. Binding of biotinyiated SDF-1 was detected using streptavidin-PE. Competition curves are depicted in Figure 1. In this assay, Mab 8F11 and 07C03 competition is complete (>95%), relative to competition with unlabelled SDF-1, underscoring the complete inhibition of the SDF-1-CXCR7 interaction.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Neurosurgery (AREA)
  • Rheumatology (AREA)
  • Pain & Pain Management (AREA)
  • Engineering & Computer Science (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/EP2012/055499 2006-12-19 2012-03-28 Bispecific anti-cxcr7 immunoglobulin single variable domains Ceased WO2012130874A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
AU2012234284A AU2012234284B2 (en) 2011-03-28 2012-03-28 Bispecific anti-CXCR7 immunoglobulin single variable domains
EP12713656.2A EP2691418A1 (en) 2011-03-28 2012-03-28 Bispecific anti-cxcr7 immunoglobulin single variable domains
CA2831415A CA2831415A1 (en) 2011-03-28 2012-03-28 Bispecific anti-cxcr7 immunoglobulin single variable domains
US14/008,011 US20150158948A9 (en) 2011-03-28 2012-03-28 Bispecific anti-cxcr7 immunoglobulin single variable domains
JP2014501588A JP6181040B2 (ja) 2011-03-28 2012-03-28 二特異性抗cxcr7免疫グロブリン単一可変ドメイン
CN201280026571.1A CN103917560B (zh) 2011-03-28 2012-03-28 双特异性抗‑cxcr7免疫球蛋白单可变结构域
US13/650,600 US9512236B2 (en) 2006-12-19 2012-10-12 Amino acid sequences directed against GPCRS and polypeptides comprising the same for the treatment of GPCR-related diseases and disorders
US13/937,718 US9994639B2 (en) 2011-03-28 2013-07-09 Biological materials related to CXCR7
US15/969,938 US20180355048A1 (en) 2011-03-28 2018-05-03 Biological materials related to cxcr7

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US201161468250P 2011-03-28 2011-03-28
US61/468,250 2011-03-28
US201161540272P 2011-09-28 2011-09-28
US61/540,272 2011-09-28
US201261600263P 2012-02-17 2012-02-17
US61/600,263 2012-02-17

Related Child Applications (4)

Application Number Title Priority Date Filing Date
PCT/EP2009/056026 Continuation-In-Part WO2009138519A1 (en) 2006-12-19 2009-05-18 AMINO ACID SEQUENCES DIRECTED AGAINST CXCR4 AND OTHER GPCRs AND COMPOUNDS COMPRISING THE SAME
US99298211A Continuation-In-Part 2006-12-19 2011-04-05
US13/650,600 Continuation-In-Part US9512236B2 (en) 2006-12-19 2012-10-12 Amino acid sequences directed against GPCRS and polypeptides comprising the same for the treatment of GPCR-related diseases and disorders
US13/937,718 Continuation-In-Part US9994639B2 (en) 2011-03-28 2013-07-09 Biological materials related to CXCR7

Publications (1)

Publication Number Publication Date
WO2012130874A1 true WO2012130874A1 (en) 2012-10-04

Family

ID=45952494

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2012/055499 Ceased WO2012130874A1 (en) 2006-12-19 2012-03-28 Bispecific anti-cxcr7 immunoglobulin single variable domains

Country Status (7)

Country Link
US (3) US20150158948A9 (enExample)
EP (1) EP2691418A1 (enExample)
JP (1) JP6181040B2 (enExample)
CN (1) CN103917560B (enExample)
AU (1) AU2012234284B2 (enExample)
CA (1) CA2831415A1 (enExample)
WO (1) WO2012130874A1 (enExample)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPWO2014081029A1 (ja) * 2012-11-26 2017-01-05 学校法人近畿大学 抗がん剤による末梢神経障害の予防、治療、または軽減剤
EP3248986A2 (en) 2014-05-16 2017-11-29 Ablynx NV Immunoglobulin variable domains
US11851480B2 (en) 2016-02-12 2023-12-26 Ablynx N.V. Method for the production of immunoglobulin single variable domains
WO2024133935A1 (en) 2022-12-23 2024-06-27 Ablynx Nv Protein-based conjugation carriers
WO2024170756A1 (en) 2023-02-17 2024-08-22 Ablynx N.V. Polypeptides binding to the neonatal fc receptor

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9512236B2 (en) 2006-12-19 2016-12-06 Ablynx N.V. Amino acid sequences directed against GPCRS and polypeptides comprising the same for the treatment of GPCR-related diseases and disorders
AU2009248049B2 (en) 2008-05-16 2015-07-23 Ablynx N.V. Amino acid sequences directed against CXCR4 and other GPCRs and compounds comprising the same
US8937164B2 (en) 2010-03-26 2015-01-20 Ablynx N.V. Biological materials related to CXCR7
KR20180068982A (ko) * 2015-09-14 2018-06-22 갤럭시 바이오테크, 엘엘씨 혈관신생 인자에 대한 매우 강력한 모노클로날 항체
NO2768984T3 (enExample) 2015-11-12 2018-06-09
LT3374392T (lt) * 2015-11-13 2022-01-25 Ablynx Nv Patobulinti serumo albuminą surišantys imunoglobulino kintami domenai
SG11201804178YA (en) 2015-11-18 2018-06-28 Merck Sharp & Dohme Pd1 and/or lag3 binders
CN109313183B (zh) * 2016-06-23 2022-10-21 埃博灵克斯股份有限公司 免疫球蛋白单可变结构域的改进的药代动力学测定
US20200392512A1 (en) * 2018-02-26 2020-12-17 Ablynx N.V. Nucleotide sequences encoding peptide linkers

Citations (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1991001743A1 (en) 1989-08-01 1991-02-21 Cemu Bioteknik Ab Stabilized protein or peptide conjugates
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
WO1994029457A2 (en) 1993-06-09 1994-12-22 Unilever N.V. Process for producing fusion proteins comprising scfv fragments by a transformed mould
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
WO1996034103A1 (en) 1995-04-25 1996-10-31 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
WO1999042077A2 (en) 1998-02-19 1999-08-26 Xcyte Therapies, Inc. Compositions and methods for regulating lymphocyte activation
WO2001045746A2 (en) 1999-12-24 2001-06-28 Genentech, Inc. Methods and compositions for prolonging elimination half-times of bioactive compounds
US6304489B1 (en) 1993-08-27 2001-10-16 Hiroshi Iwahashi Non-volatile semiconductor memory device and data programming method
WO2002076489A1 (en) 2001-03-09 2002-10-03 Dyax Corp. Serum albumin binding moieties
WO2002085945A2 (en) 2001-04-24 2002-10-31 Erasmus Universiteit Rotterdam Vhh single heavy chain antibody and a method for its preparation in a mammal
WO2004041865A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Stabilized single domain antibodies
WO2004041867A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders
US6741957B1 (en) 2000-07-21 2004-05-25 Daimlerchrysler Corporation Analytical tire model for vehicle durability and ride comfort analysis
WO2004049794A2 (en) 2002-12-03 2004-06-17 The Babraham Institute Single chain antibodies produced in a transgenic mouse
WO2004060965A2 (en) 2002-12-31 2004-07-22 Nektar Therapeutics Al, Corporation Hydrolytically stable maleimide-terminated polymers
US6849992B2 (en) 2001-12-03 2005-02-01 Samsung Sdi Co., Ltd. Plasma display device having efficient heat conductivity
WO2006003388A2 (en) 2004-06-30 2006-01-12 Domantis Limited Compositions and methods for treating inflammatory disorders
WO2006030220A1 (en) 2004-09-17 2006-03-23 Domantis Limited Compositions monovalent for cd40l binding and methods of use
WO2006116319A2 (en) 2005-04-21 2006-11-02 Chemocentryx, Inc. Reagents that bind ccx-ckr2
WO2006122787A1 (en) 2005-05-18 2006-11-23 Ablynx Nv Serum albumin binding proteins
US20070167443A1 (en) 2005-11-10 2007-07-19 Chemocentryx, Inc. Substituted quinolones and methods of use
WO2007118670A1 (en) 2006-04-14 2007-10-25 Ablynx N.V. Dp-78-like nanobodies
WO2008020079A1 (en) 2006-08-18 2008-02-21 Ablynx N.V. Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling
WO2008028977A2 (en) 2006-09-08 2008-03-13 Ablynx N.V. Serum albumin binding proteins with long half-lives
WO2008048519A2 (en) 2006-10-18 2008-04-24 Chemocentryx, Inc. Antibodies that bind cxcr7 epitopes
WO2008068280A1 (en) 2006-12-05 2008-06-12 Ablynx N.V. Peptides capable of binding to serum proteins
WO2008068880A1 (ja) 2006-11-30 2008-06-12 Tokyo Ohka Kogyo Co., Ltd. 被処理体を液体処理する処理装置
WO2009127691A1 (en) 2008-04-17 2009-10-22 Ablynx N.V. Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same
WO2009138519A1 (en) 2008-05-16 2009-11-19 Ablynx Nv AMINO ACID SEQUENCES DIRECTED AGAINST CXCR4 AND OTHER GPCRs AND COMPOUNDS COMPRISING THE SAME
WO2010043650A2 (en) * 2008-10-14 2010-04-22 Ablynx Nv Amino acid sequences directed against cellular receptors for viruses and bacteria
WO2010070145A2 (en) * 2008-12-19 2010-06-24 Ablynx N.V. Method for generation of immunoglobulin sequences
WO2010141986A1 (en) * 2009-06-09 2010-12-16 Mabdesign Pty Ltd Novel antibodies and uses therefor
WO2011095545A1 (en) 2010-02-05 2011-08-11 Ablynx Nv Peptides capable of binding to serum albumin and compounds, constructs and polypeptides comprising the same
WO2011117423A1 (en) * 2010-03-26 2011-09-29 Ablynx N.V. Immunoglobulin single variable domains directed against cxcr7

Family Cites Families (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FI903489A0 (fi) 1988-11-11 1990-07-10 Medical Res Council Ligander med en enda sektion, receptorer innehaollande naemnda ligander, foerfaranden foer deras framstaellning samt anvaendning av liganderna och receptorerna.
WO1992002551A1 (en) 1990-08-02 1992-02-20 B.R. Centre Limited Methods for the production of proteins with a desired function
AU766675B2 (en) 1998-03-30 2003-10-23 Northwest Biotherapeutics, Inc. Therapeutic and diagnostic applications based on the role of the CXCR-4 gene in tumorigenesis
US7018812B2 (en) 2000-11-03 2006-03-28 Duke University Modified G-protein coupled receptors
US7253007B2 (en) 2001-11-30 2007-08-07 Chemocentryx, Inc. Compositions and methods for detecting and treating diseases and conditions related to chemokine receptors
US7871619B2 (en) 2001-11-30 2011-01-18 Chemocentryx, Inc. Compositions and methods for detecting and treating diseases and conditions related to chemokine receptors
US7442512B2 (en) 2001-11-30 2008-10-28 Chemocentryx, Inc. Compositions and methods for detecting and treating diseases and conditions related to chemokine receptors
AU2002351896A1 (en) 2001-12-11 2003-06-23 Ablynx N.V. Method for displaying loops from immunoglobulin domains in different contexts
AU2003209059A1 (en) 2002-02-08 2003-09-02 Genetastix Corporation Human monoclonal antibodies against membrane proteins
US7211240B2 (en) 2002-03-01 2007-05-01 Bracco International B.V. Multivalent constructs for therapeutic and diagnostic applications
US20060002935A1 (en) 2002-06-28 2006-01-05 Domantis Limited Tumor Necrosis Factor Receptor 1 antagonists and methods of use therefor
JP4603894B2 (ja) 2002-12-03 2010-12-22 ユセベ ファルマ ソシエテ アノニム 抗体産生細胞を同定するためのアッセイ
GB0312481D0 (en) 2003-05-30 2003-07-09 Celltech R&D Ltd Antibodies
JP2007521234A (ja) 2003-08-12 2007-08-02 ウィリアム エム ヤーブロー 尋常性ざ瘡の治療薬及び使用方法
ATE554390T1 (de) 2003-08-20 2012-05-15 Ucb Pharma Sa Verfahren zur gewinnung von antikörpern
WO2006047417A2 (en) 2004-10-21 2006-05-04 University Of Florida Research Foundation, Inc. Detection of cannabinoid receptor biomarkers and uses thereof
US8329178B2 (en) 2005-02-18 2012-12-11 Dana-Farber Cancer Institute, Inc. Antibodies against CXCR4 and methods of use thereof
DK2444424T3 (en) * 2005-05-20 2018-12-03 Ablynx Nv IMPROVED NANOL BODIES (TM) FOR TREATING AGGREGATED MEDICINAL DISORDERS
JP2009511032A (ja) 2005-10-11 2009-03-19 アブリンクス エン.ヴェー. Egfrおよびigf−irに対するナノボディおよびポリペプチド
WO2007055823A2 (en) 2005-10-28 2007-05-18 Multispan, Inc. Gpcr expressing cell lines and antibodies
US20070269422A1 (en) * 2006-05-17 2007-11-22 Ablynx N.V. Serum albumin binding proteins with long half-lives
US9512236B2 (en) 2006-12-19 2016-12-06 Ablynx N.V. Amino acid sequences directed against GPCRS and polypeptides comprising the same for the treatment of GPCR-related diseases and disorders
AU2007336242B2 (en) 2006-12-19 2012-08-30 Ablynx N.V. Amino acid sequences directed against GPCRs and polypeptides comprising the same for the treatment of GPCR-related diseases and disorders
CA2731617A1 (en) 2008-07-22 2010-01-28 Maria Joao Saraiva Amino acid sequences directed against multitarget scavenger receptors and polypeptides
WO2011143231A2 (en) 2010-05-10 2011-11-17 The Broad Institute High throughput paired-end sequencing of large-insert clone libraries

Patent Citations (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5399346A (en) 1989-06-14 1995-03-21 The United States Of America As Represented By The Department Of Health And Human Services Gene therapy
WO1991001743A1 (en) 1989-08-01 1991-02-21 Cemu Bioteknik Ab Stabilized protein or peptide conjugates
WO1994004678A1 (en) 1992-08-21 1994-03-03 Casterman Cecile Immunoglobulins devoid of light chains
WO1994029457A2 (en) 1993-06-09 1994-12-22 Unilever N.V. Process for producing fusion proteins comprising scfv fragments by a transformed mould
US6304489B1 (en) 1993-08-27 2001-10-16 Hiroshi Iwahashi Non-volatile semiconductor memory device and data programming method
WO1996034103A1 (en) 1995-04-25 1996-10-31 Vrije Universiteit Brussel Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
WO1999042077A2 (en) 1998-02-19 1999-08-26 Xcyte Therapies, Inc. Compositions and methods for regulating lymphocyte activation
WO2001045746A2 (en) 1999-12-24 2001-06-28 Genentech, Inc. Methods and compositions for prolonging elimination half-times of bioactive compounds
US6741957B1 (en) 2000-07-21 2004-05-25 Daimlerchrysler Corporation Analytical tire model for vehicle durability and ride comfort analysis
WO2002076489A1 (en) 2001-03-09 2002-10-03 Dyax Corp. Serum albumin binding moieties
WO2002085945A2 (en) 2001-04-24 2002-10-31 Erasmus Universiteit Rotterdam Vhh single heavy chain antibody and a method for its preparation in a mammal
US6849992B2 (en) 2001-12-03 2005-02-01 Samsung Sdi Co., Ltd. Plasma display device having efficient heat conductivity
WO2004041865A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Stabilized single domain antibodies
WO2004041867A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Camelidae antibodies against imminoglobulin e and use thereof for the treatment of allergic disorders
WO2004041863A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Single domain antibodies directed against interferon- gamma and uses therefor
WO2004041862A2 (en) 2002-11-08 2004-05-21 Ablynx N.V. Single domain antibodies directed against tumour necrosis factor-alpha and uses therefor
WO2004049794A2 (en) 2002-12-03 2004-06-17 The Babraham Institute Single chain antibodies produced in a transgenic mouse
WO2004060965A2 (en) 2002-12-31 2004-07-22 Nektar Therapeutics Al, Corporation Hydrolytically stable maleimide-terminated polymers
WO2006003388A2 (en) 2004-06-30 2006-01-12 Domantis Limited Compositions and methods for treating inflammatory disorders
WO2006030220A1 (en) 2004-09-17 2006-03-23 Domantis Limited Compositions monovalent for cd40l binding and methods of use
WO2006116319A2 (en) 2005-04-21 2006-11-02 Chemocentryx, Inc. Reagents that bind ccx-ckr2
WO2006122787A1 (en) 2005-05-18 2006-11-23 Ablynx Nv Serum albumin binding proteins
US20070167443A1 (en) 2005-11-10 2007-07-19 Chemocentryx, Inc. Substituted quinolones and methods of use
WO2007118670A1 (en) 2006-04-14 2007-10-25 Ablynx N.V. Dp-78-like nanobodies
WO2008020079A1 (en) 2006-08-18 2008-02-21 Ablynx N.V. Amino acid sequences directed against il-6r and polypeptides comprising the same for the treatment of deseases and disorders associated with il-6-mediated signalling
WO2008028977A2 (en) 2006-09-08 2008-03-13 Ablynx N.V. Serum albumin binding proteins with long half-lives
WO2008048519A2 (en) 2006-10-18 2008-04-24 Chemocentryx, Inc. Antibodies that bind cxcr7 epitopes
WO2008068880A1 (ja) 2006-11-30 2008-06-12 Tokyo Ohka Kogyo Co., Ltd. 被処理体を液体処理する処理装置
WO2008068280A1 (en) 2006-12-05 2008-06-12 Ablynx N.V. Peptides capable of binding to serum proteins
WO2009127691A1 (en) 2008-04-17 2009-10-22 Ablynx N.V. Peptides capable of binding to serum proteins and compounds, constructs and polypeptides comprising the same
WO2009138519A1 (en) 2008-05-16 2009-11-19 Ablynx Nv AMINO ACID SEQUENCES DIRECTED AGAINST CXCR4 AND OTHER GPCRs AND COMPOUNDS COMPRISING THE SAME
WO2010043650A2 (en) * 2008-10-14 2010-04-22 Ablynx Nv Amino acid sequences directed against cellular receptors for viruses and bacteria
WO2010070145A2 (en) * 2008-12-19 2010-06-24 Ablynx N.V. Method for generation of immunoglobulin sequences
WO2010141986A1 (en) * 2009-06-09 2010-12-16 Mabdesign Pty Ltd Novel antibodies and uses therefor
WO2011095545A1 (en) 2010-02-05 2011-08-11 Ablynx Nv Peptides capable of binding to serum albumin and compounds, constructs and polypeptides comprising the same
WO2011117423A1 (en) * 2010-03-26 2011-09-29 Ablynx N.V. Immunoglobulin single variable domains directed against cxcr7

Non-Patent Citations (59)

* Cited by examiner, † Cited by third party
Title
"Handbook of Therapeutic Antibodies", 2007, WILEY, pages: 252 - 255
"MONOCLONAL ANTIBODY Anti-CXCR7/RDC1; K0223-3 9C4 Mouse IgG1 [kappa] 100 [mu]g", MBL, 12 January 2009 (2009-01-12), XP055032499, Retrieved from the Internet <URL:http://www.mblintl.com/sites/default/files/datasheets/K0223-3.PDF> [retrieved on 20120712] *
"Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING COMPANY, USA
ADV. ENZYMOL., vol. 47, 1978, pages 45 - 149
BALABANIAN K ET AL: "The Chemokine SDF-1/CXCL12 Binds to and Signals through the Orphan Receptor RDC1 in T Lymphocytes", JOURNAL OF BIOLOGICAL CHEMISTRY, THE AMERICAN SOCIETY OF BIOLOGICAL CHEMISTS, INC, US, vol. 280, no. 42, 21 October 2005 (2005-10-21), pages 35760 - 35766, XP003015681, ISSN: 0021-9258, DOI: 10.1074/JBC.M508234200 *
BURNS ET AL., J.EXP.MED., vol. 203, no. 9, 4 December 2005 (2005-12-04), pages 2201 - 2213
BURNS ET AL., J.EXP.MED., vol. 203, no. 9, pages 2201 - 2213
CARBAJAL ET AL.: "Migration of engrafted neural stem cells is mediated by CXCL12 signaling through CXCR4 in a viral model of multiple sclerosis", PROC NATL ACAD SCI USA., vol. 107, pages 11068 - 11073
CATHERINE J. HUTCHINGS ET AL: "Therapeutic antibodies directed at G protein-coupled receptors", MABS, vol. 2, no. 6, 1 November 2010 (2010-11-01), pages 594 - 606, XP055011782, ISSN: 1942-0862, DOI: 10.4161/mabs.2.6.13420 *
CHAPMAN, ADVANCED DRUG DELIVERY REVIEWS, vol. 54, 2002, pages 531 - 545
CHOU; FASMAN, BIOCHEMISTRY, vol. 13, 1974, pages 211
DECANNIERE ET AL.: "A single-domain antibody fragment in complex with RNase A: non-canonical loop structures and nanomolar affinity using two CDR loops", STRUCTURE, vol. 7, no. 4, 15 April 1999 (1999-04-15), pages 361 - 370
DESMYTER ET AL.: "Crystal structure of a camel single-domain VH antibody fragment in complex with lysozyme", NATURE STRUCTURAL & MOLECULAR BIOLOGY, vol. 3, no. 9, September 1996 (1996-09-01), pages 803 - 811
DUCRY; STUMP, BIOCONJUGATE CHEM., vol. 21, no. 1, 2010, pages 5 - 13
EISENBERG ET AL., PROC. NATL. ACAD SCI. USA, vol. 81, 1984, pages 140 - 144
GOLDMAN ET AL., ANN. REV. BIOPHYS. CHEM., vol. 15, 1986, pages 321 - 353
GONZALES ET AL., TUMOUR BIOL., vol. 26, no. 1, 2005, pages 31 - 43
HARRIS; CHESS, NAT. REV. DRUG. DISCOV., 2003, pages 2
HART ET AL., COCHRANE DATABASE SYST REV., 16 July 2008 (2008-07-16), pages CD007294
HEGEN ET AL., ANN RHEUM DIS., vol. 67, no. 11, November 2008 (2008-11-01), pages 1505 - 1515
HERMSEN ET AL.: "Centromeric breakage as a major cause of cytogenetic abnormalities in oral squamous cell carcinoma", GENES CHROMOSOMES CANCER, vol. 15, 1996, pages 1 - 9
HOLLIGER; HUDSON, NAT BIOTECHNOL, vol. 23, no. 9, September 2005 (2005-09-01), pages 1126 - 1136
HOLT ET AL.: "Domain antibodies: proteins for therapy", TRENDS BIOTECHNOL., vol. 21, no. 11, 2003, pages 484 - 490
HOOGENBOOM, NATURE BIOTECHNOLOGY, vol. 23, no. 9, 2005, pages 1105 - 1116
IRVING ET AL.: "Ribosome display and affinity maturation: from antibodies to single V-domains and steps towards cancer therapeutics", J. IMMUNOL. METHODS, vol. 248, no. 1-2, 2001, pages 31 - 45
JENNIFER M. BURNS, ET AL.: "A novel chemokine receptor for SDF-1 and I-TAC involved in cell survival, cell adhesion, and tumor development", J.EXP.MED., vol. 203, no. 9, 4 September 2006 (2006-09-04), pages 2201 - 2213
JIANHUA WANG, ET AL.: "Molecular Basis of Cell and Developmental Biology", J.BIOL.CHEM, vol. 283, 2008, pages 4283 - 4294
K E LUKER ET AL.: "Imaging chemokine receptor dimerization with firefly luciferase complementation", FASEB JOURNAL, vol. 23, 2009, pages 823 - 834
KABAT ET AL.: "Sequence of proteins of immunological interest", US PUBLIC HEALTH SERVICES, NIH BETHESDA, MD
KENNETH, A ET AL.: "Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists"
KYTE; DOOLITTLE, J MOLEC. BIOL., vol. 157, pages 105 - 132
LEVIN; WEISS: "Optimizing the affinity and specificity of proteins with molecular display", MOL. BIOSYST., vol. 2, no. 1, 2006, pages 49 - 57
LUKER ET AL., FASEB J., vol. 23, no. 3, 2009, pages 823 - 834
LUNDBLAD; BRADSHAW, BIOTECHNOL. APPL. BIOCHEM., vol. 26, 1997, pages 143 - 151
MARTIN, E.W.: "Remington's Pharmaceutical Sciences", MACK PUBLISHING CO.
MAZZINGHI ET AL., J.EXP.MED., vol. 205, no. 2, 18 February 2008 (2008-02-18), pages 479 - 490
NAUNYN-SCHMIED ARCHIVES PHARMACOLOGY, vol. 379, pages 385 - 388
NGUYEN ET AL., ADV. IMMUNOL., vol. 79, 2001, pages 261 - 296
ODEMIS ET AL., J CELL SIGN., vol. 123, 1 April 2010 (2010-04-01), pages 1081 - 1088
PETERS; M GIBALDI; D PERRON: "Pharmacokinetics", 1982, MARCEL DEKKER, article "Pharmacokinetic analysis: A Practical Approach"
PRESTA: "Engineering of therapeutic antibodies to minimize immunogenicity and optimize function", ADV. DRUG DELIV. REV., vol. 58, no. 5-6, pages 640 - 656
R B MAKSYM ET AL.: "The role of stromal-derived factor-1 - CXCR7 axis in development of cancer", EUROPEAN JOURNAL OF PHARMACOLOGY, vol. 625, no. 1-3, 2009, pages 31 - 40
RANGER: "A new human cell line (FaDu) from a hypopharyngeal carcinoma", CANCER, vol. 29, 1972, pages 117 - 121
REMINGTON: "Science and Practice of Pharmacy", 2005, LIPPINCOTT WILLIAMS AND WILKINS
RIECHMANN; MUYLDERMANS: "Induction of immune responses and molecular cloning of the heavy chain antibody repertoire of Lama glama", J. IMMUNOL. METHODS, vol. 240, no. 1-2, 23 June 2000 (2000-06-23), pages 185 - 195
SCHMITZ ET AL.: "Phage Display: A Molecular Tool for the Generation of Antibodies-A Review", PLACENTA, vol. 21, no. SUPP.A, 2000, pages S106 - S212
SCHULZ ET AL.: "Principles of Protein Structure", 1978, SPRINGER-VERLAG
SPINELLI ET AL.: "The crystal structure of a llama heavy chain variable domain", NATURAL STRUCTURAL & MOLECULAR BIOLOGY, vol. 3, no. 9, September 1996 (1996-09-01), pages 752 - 757
VERONESE; HARRIS: "Introduction and overview of peptide and protein pegylation", ADV. DRUG DELIV. REV., vol. 54, 2003, pages 453 - 456
WANG ET AL., J IMMUNOL., vol. 183, no. 5, 1 September 2009 (2009-09-01), pages 3204 - 3211
WARD ET AL.: "Binding activities of a repertoire of single immunoglobulin variable domains secreted from Escherichia coli", NATURE, vol. 341, no. 6242, 12 October 1989 (1989-10-12), pages 544 - 546
WEKERLE, ANN RHEUM DIS., vol. 67, no. 3, December 2008 (2008-12-01), pages III56 - III60
YANG ET AL., PROTEIN ENGINEERING, vol. 16, no. 10, 2003, pages 761 - 770
YI ET AL.: "EGFR Gene Overexpression Retained in an Invasive Xenograft Model by Solid Orthotopic Transplantation of Human Glioblastoma Multiforme Into Nude Mice", CANCER INVEST., vol. 29, 2011, pages 229 - 239
ZABEL ET AL., J. IMMUNOL., vol. 183, no. 5, 1 December 2008 (2008-12-01), pages 3204 - 3211
ZABEL ET AL.: "Elucidation of CXCR7 mediated signalling events and inhibition of CXCR4 mediated tumor cell transendothelial migration by CXCR7 ligands", J IMMUNOL., vol. 183, no. 5, 2009, pages 3204 - 3211
ZABEL ET AL.: "Elucidation of CXCR7-Mediated Signaling Events and Inhibition of CXCR4-Mediated Tumor Cell Transendothelial Migration by CXCR7 Ligands", J.IMMUN., vol. 183, 2009, pages 3204 - 3211
ZHENG ET AL.: "Chemokine receptor CXCR7 regulates the invasion, angiogenesis and tumour growth of human hepatocellular carcinoma cells", J. RES., vol. 29, 2010, pages 31
ZHENHUA MIAO, ET AL.: "CXCR7 (RDC1) promotes breast and lung tumor growth in vivo and is expressed on tumor-associated vasculature", PROC. NATL. ACAD. SCI. USA, vol. 104, 2007, pages 15735 - 15740

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPWO2014081029A1 (ja) * 2012-11-26 2017-01-05 学校法人近畿大学 抗がん剤による末梢神経障害の予防、治療、または軽減剤
EP3248986A2 (en) 2014-05-16 2017-11-29 Ablynx NV Immunoglobulin variable domains
EP3693386A1 (en) 2014-05-16 2020-08-12 Ablynx NV Immunoglobulin variable domains
EP3702369A1 (en) 2014-05-16 2020-09-02 Ablynx NV Immunoglobulin variable domains
EP4707303A2 (en) 2014-05-16 2026-03-11 Ablynx NV Improved immunoglobulin variable domains
US11851480B2 (en) 2016-02-12 2023-12-26 Ablynx N.V. Method for the production of immunoglobulin single variable domains
WO2024133935A1 (en) 2022-12-23 2024-06-27 Ablynx Nv Protein-based conjugation carriers
WO2024170756A1 (en) 2023-02-17 2024-08-22 Ablynx N.V. Polypeptides binding to the neonatal fc receptor

Also Published As

Publication number Publication date
EP2691418A1 (en) 2014-02-05
CN103917560B (zh) 2017-05-24
JP6181040B2 (ja) 2017-08-16
US20150158948A9 (en) 2015-06-11
US20180355048A1 (en) 2018-12-13
US9994639B2 (en) 2018-06-12
AU2012234284A1 (en) 2013-03-28
US20140227270A1 (en) 2014-08-14
CA2831415A1 (en) 2012-10-04
US20140178390A1 (en) 2014-06-26
CN103917560A (zh) 2014-07-09
JP2014511680A (ja) 2014-05-19
AU2012234284B2 (en) 2015-10-08

Similar Documents

Publication Publication Date Title
US9758584B2 (en) Biological materials related to CXCR7
AU2020217351B2 (en) CXCR2 binding polypeptides
US9994639B2 (en) Biological materials related to CXCR7
JP6034023B2 (ja) Cxcr4及び他のgpcrに指向性を有するアミノ酸配列及びそれを含む化合物
US10385134B2 (en) CX3CR1-binding polypeptides comprising immunoglobulin single variable domains
JP6120767B2 (ja) Her3に関連する生物学的材料
US10618964B2 (en) Nanobody against IL-6R
JP2009529339A (ja) Il−6を標的とするアミノ酸配列およびそれを含みil−6介在シグナル伝達に関連する疾患および疾病を治療するポリペプチド
JP2010500876A (ja) Il−6媒介性シグナル伝達に関連する疾患及び障害の治療のための、il−6rに指向性を有するアミノ酸配列及びこれを含むポリペプチド
AU2015264802B2 (en) Biological materials related to HER3

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 12713656

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2012234284

Country of ref document: AU

Date of ref document: 20120328

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2831415

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2014501588

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2012713656

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2012713656

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 14008011

Country of ref document: US