WO2012064658A1 - Fusion proteins comprising an engineered knottin peptide and uses thereof - Google Patents

Fusion proteins comprising an engineered knottin peptide and uses thereof Download PDF

Info

Publication number
WO2012064658A1
WO2012064658A1 PCT/US2011/059599 US2011059599W WO2012064658A1 WO 2012064658 A1 WO2012064658 A1 WO 2012064658A1 US 2011059599 W US2011059599 W US 2011059599W WO 2012064658 A1 WO2012064658 A1 WO 2012064658A1
Authority
WO
WIPO (PCT)
Prior art keywords
binding
receptor
axl
knottin
eeti
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/059599
Other languages
English (en)
French (fr)
Inventor
Jennifer R. Cochran
Douglas S. Jones
Mihalis S. Kariolis
Ping-Chuan Tsai
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Leland Stanford Junior University
Original Assignee
Leland Stanford Junior University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP11839687.8A priority Critical patent/EP2638173B1/en
Priority to AU2011326164A priority patent/AU2011326164B2/en
Priority to JP2013537908A priority patent/JP6170435B2/ja
Priority to DK11839687.8T priority patent/DK2638173T3/da
Priority to CA2817197A priority patent/CA2817197C/en
Priority to EP19180924.3A priority patent/EP3604549A1/en
Priority to US13/883,216 priority patent/US10844106B2/en
Application filed by Leland Stanford Junior University filed Critical Leland Stanford Junior University
Publication of WO2012064658A1 publication Critical patent/WO2012064658A1/en
Anticipated expiration legal-status Critical
Priority to AU2016210712A priority patent/AU2016210712B2/en
Priority to AU2018200587A priority patent/AU2018200587B2/en
Priority to US17/066,167 priority patent/US11498952B2/en
Priority to US18/055,297 priority patent/US12240882B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • C07K14/43513Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae
    • C07K14/43518Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae from spiders
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/71Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/81Protease inhibitors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/81Protease inhibitors
    • C07K14/8107Endopeptidase (E.C. 3.4.21-99) inhibitors
    • C07K14/811Serine protease (E.C. 3.4.21) inhibitors
    • C07K14/8121Serpins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • the present invention relates to the field of protein engineering, and to the field of knottin peptides, i.e. peptides with particularly well-defined scaffolds and high stability, also referred to as cystine knot miniproteins in the art.
  • Directed evolution is an invaluable tool for optimizing proteins, however, in vitro evolution strategies generally focus on directly engineering the active site or binding site of the protein of interest. There are limited examples harnessing the power of gene duplication and combination in the directed evolution of protein function.
  • Knottins are described in the knottin database, http(colon slash slash)
  • knottin.cbs.cnrs.fr/ Knottins.php which provides sequences and structures of various knottin peptides.
  • the present invention comprises (a) a knottin polypeptide
  • binding loops are typically between constrained cysteine residues. These loops may be altered by preparing a library of
  • the knottin polypeptide contains a non-native sequence in its binding loop. That is, the sequence is not normally present in the knottin; preferably it has been selected by a screening procedure for high binding.
  • the fusion protein will contain a non-native sequence mediates attachment between a cell and the tissues surrounding it.
  • the knottin is not normally present in the knottin; preferably it has been selected by a screening procedure for high binding.
  • the fusion protein will contain a non-native sequence mediates attachment between a cell and the tissues surrounding it.
  • the fusion protein comprises a second polypeptide which is an extracellular domain of a receptor tyrosine kinase.
  • the second polypeptide is a receptor tyrosine kinase Igl domain.
  • Igl domain is from Axl, MuSK, or the FGF receptor.
  • the receptor tyrosine kinase is an Axl receptor.
  • the knottin polypeptide is selected from the group consisting of EETI-II, AgRP, and agatoxin.
  • the fusion protein has a binding loop domain is engineered to bind to one of ⁇ 5 ⁇ 1 integrin, ⁇ 3 integrin, or ⁇ 5 integrin.
  • the fusion protein comprises (a) an EETI-II or AgRP knottin polypeptide comprising a binding loop with high affinity to an integrin; and (b) a polypeptide selected from the group consisting of (i) an Axl extracellular domain and
  • Certain aspects of the invention comprise a method for preparing a fusion protein, comprising the steps of: (a) preparing a library having a number of DNA constructs encoding the fusion protein and a number of randomized DNA sequences within the DNA constructs; (b) expressing the DNA constructs in the library in yeast, wherein expressed DNA constructs
  • 0 are displayed as polypeptides with randomized sequences on the yeast surface; (c) screening the clones for binding of the expressed DNA constructs to the first target or the second target by contacting the clones with a target; (d) selecting clones that express translated DNA constructs that bind with high affinity to the target; and (e) obtaining the coding sequences of the selected clones, whereby said fusion protein may be prepared.
  • Certain aspects of the invention comprise a method for inhibiting binding of a ligand to a receptor, comprising the steps of: (a) administering an amount of a soluble fusion protein comprising (i) a polypeptide encoding an extracellular domain of a receptor to be inhibited and (ii) a knottin polypeptide having a loop domain engineered to bind to a cell surface receptor that is not the receptor to be inhibited.
  • the tyrosine kinase may be a TAM receptor tyrosine kinase.
  • the present invention comprises a method for preparing a bispecific, or multispecific, fusion protein that contains an engineered knottin portion and another binding portion that, preferably, is a receptor, receptor ligand, or a fragment thereof
  • the fusion protein thus prepared has two different binding portions, and two separate ligands.
  • the knottin portion is fused at its C- terminus to the N terminus of the binding portion. Alternatively, it may be fused at its N terminus to the C terminus of the binding portion.
  • the present invention comprises a method for preparing a fusion
  • a first polypeptide that binds to a first binding partner e.g. a receptor or receptor ligand
  • a second polypeptide e.g. a knottin having a loop domain engineered to bind with high affinity to a second binding partner
  • steps of: (a) preparing a library having a number of DNA constructs encoding the fusion protein and a number of randomized loop domains, wherein the library provides a degree of variation of binding and a number of tight binders to be selected from the library; (b) expressing the DNA constructs in the library as protein variants; (c) screening the library for binding of the protein variants to the second binding partner; (d) selecting clones that express DNA constructs that bind with high affinity to the second binding partner; and (e) obtaining the coding sequences
  • the second binding partner selected may be an entirely different molecule (protein, glycoprotein,
  • the present invention utilizes a first polypeptide that is a receptor fragment.
  • a cell For example, a cell
  • 0 surface receptor having various domains is used in the form of a fragment encoding an
  • the cell surface receptor may be a receptor tyrosine kinase.
  • the first polypeptide may be a receptor ligand, or a fragment of such a ligand that binds to a receptor.
  • the ligand may be an agonist or an antagonist.
  • the first polypeptide may have a sequence which is at least a portion of a
  • the second polypeptide is a knottin scaffold and may be selected from the group consisting of EETI-II, AgRP, and agatoxin. It is also contemplated that the knottin scaffold may be ⁇ -conotoxin.
  • the knottin loop domain is engineered to bind to an integrin.
  • the method comprises cloning a random yeast display library having loop portions that are selected for binding to the target of interest.
  • the present invention comprises a fusion protein comprising a '5 receptor ligand polypeptide, said receptor ligand binding to a receptor at a specific receptor binding site, fused to a knottin polypeptide having a loop domain engineered to bind with high affinity to a binding partner that is not the specific receptor binding site for the receptor ligand.
  • the receptor ligand polypeptide is a fragment of a native ligand.
  • the fusion protein 10 comprises a fragment that is a fragment of a growth factor, such as an NK1 fragment of
  • hepatocyte growth factor which consists of the HGF amino terminus through the first kringle domain.
  • Certain aspects of the present invention comprise a fusion protein comprising a receptor polypeptide, said receptor binding to a ligand at a specific ligand binding site, fused to a knottin polypeptide having a loop domain engineered to bind with high affinity to a binding partner that is not the specific ligand binding site.
  • the receptor may be is a receptor tyrosine kinase.
  • the receptor tyrosine kinase may be selected from the group consisting of Axl, a receptor tyrosine kinase involved in solid tumor progression and MET, which is the hepatocyte growth factor receptor. It may include closely receptor tyrosine kinases closely related to Axl, such as Tyro-3 and Mer.
  • the fusion protein comprises a knottin polypeptide selected from the group consisting of EETI-II, AgRP, and agatoxin.
  • the fusion protein comprises a loop domain engineered to bind to one of asfii integrin, ⁇ ⁇ ⁇ 3 integrin, or ⁇ ⁇ ⁇ 5 integrin.
  • the loop domain is engineered to bind to a ⁇ 3 integrin.
  • the loop domain is engineered to bind to an a v or ⁇ 3 integrin subunit.
  • Figure 1A is a schematic drawing of the Axl extracellular domain.
  • Figure IB is a ribbon rendering of an EETI-II crystal structure.
  • Figure 1C is a schematic drawing of the Axl-EETI-II fusion bound to the Gas6 ligand.
  • Figure ID is a representation of the EETI-II-axl fusion library creation and the screening to obtain fusions EA 7.01, 7.03, 7.05, 8.04 and 8.05. Both loops 1 and 2 can be seen to be randomized; only a portion of the Axil Igl sequence is represented. The sequences are truncated due to the length of the Axl Igl portion.
  • Figure 2A is a schematic drawing of the yeast display construct.
  • Figure 2B is a set of scatter plots showing comparison of binding by wild-type Axl Igl and the starting E-Axl library
  • Figure 3 is a set of scatter plots of results of EA-Axl library screening and sort progression.
  • Figure 4 is a graph that shows equilibrium binding of wild- type Axl Igl, wild- type EETI-Axl, and EA ("EETI-II- Axl") mutants to Gas6. Representative data of experiments performed in triplicate on separate days.
  • Figure 5 is a graph that shows kinetic dissociation of wild-type Axl Igl or EA mutants from soluble Gas6. Wild-type Axl Igl was well fit by a single exponential decay model, while EA mutants had to be fit with a double-exponential decay model.
  • FIG. 6A, 6B and 6C is a series of graphs that shows the contribution of individual loops in EA mutants. Reversion to wild-type for (6A) EA 7.01, (6B) EA 7.06, (6C) EA 8.04.
  • wtLl or wtL3 refers to wild-type EETI-II loop sequence for loop 1 or loop 3, respectively. Persistent binding for wtEETI-Axl is shown on each plot for reference and represents "reversion" of both loops 1 and loop 3 to wild-type EETI-II sequence. Data is average of
  • Figure 7A and 7B is a pair of bar graphs that shows the binding of surface displayed AgRP-Aras4 fusion protein against soluble ⁇ ⁇ ⁇ 3 integrin and Met protein compared with AgRP7A and NK1 mutant Aras4.
  • Figure 8 is a line graph that shows binding titrations of the fusion protein, AgRP7A- 5 Aras4 to cells that express ⁇ ⁇ ⁇ 3 integrin and Met receptor.
  • Figure 9A and 9B are a pair of graphs showing binding to Gas 6 (9 A) and alpha v beta 3 integrin (9B) of a Axl-EETI direct fusion protein.
  • Figure 10 is a graph that shows the inhibition of PC3 tumor cell adhesion to microtiter plates coated with vitronectin. Knottin 2.5F-Fc and 2.5D-Fc (knottin-integrin '.0 fused to Fc portions) inhibit PC3 cell adhesion with concentrations in the low nanomolar range. Negative control is an irrelevant protein.
  • the present invention comprises the creation of novel fusion proteins that include an engineered knottin peptide fused to a second, different peptide or protein which provides a different binding function.
  • the second polypeptide is a receptor or a receptor ligand.
  • the fusion proteins may comprise a knottin peptide
  • the present invention may be used to enhance receptor ligand binding.
  • Native proteins involved in ligand-receptor interactions are promising starting points for engineering therapeutic candidates.
  • Traditional approaches to engineering protein-protein interactions have focused on optimizing an existing interaction. In nature, however, protein-protein
  • domain addition and evolution in which enhancement is accomplished by expanding the binding interface through the addition and subsequent in vitro evolution of a synthetic binding
  • Figure 1 shows that the present fusions in effect add another epitope for receptor- ligand binding.
  • Fig. 1A shows that the Axl extracellular domain contains two
  • Fig. IB shows EETI-II crystal structure (PDB ID: 2ETI). Loops 1 and 3, which
  • EETI-II mutant library is linked to the N-terminus of Axl Igl (black ribbons to the bottom left of the structure) to screen for EETI-II mutants that bind to an adjacent epitope on the Gas6 ligand.
  • Axl-Gas6 structure adapted from PDB ID: 2C5D.
  • Fig. ID shows a listing of amino acid
  • Figure 2A and 2B shows the yeast display construct and evaluation of starting E-Axl library EETI-II mutants (randomized loops) linked to Axl.
  • (2A) Yeast-displayed E-Axl construct.
  • the protein of interest is expressed as a genetic fusion to the yeast Aga2 protein, '5 which is disulfide bonded to the yeast Agal protein.
  • the Agal protein is covalently linked to the yeast cell wall, thereby tethering the entire display construct to the yeast cell surface.
  • the use of Agal and Aga2 proteins in yeast display has been previously described in connection with surface display of antibodies. See, e.g. US patent 6423538 entitled "Yeast cell surface display of proteins and uses thereof," by K. Dane Wittrup et al.
  • HA and c-myc epitope tags flanking the protein of interest can be stained for relative yeast surface expression levels using commercially available antibodies (c-myc staining shown for reference).
  • Soluble Gas6 can be used to test binding to the yeast- displayed protein; Gas6 binding is illuminated with a fluorescently labeled antibody against the hexahistidine tag (SEQ ID NO: 77) on Gas6.
  • Fig. 2B presents scatter plots showing comparison of binding by wild-type Axl Igl and the starting E-Axl library.
  • the present invention comprises fusion proteins that are bispecific 5 or multispecific in that they can bind to and/or inhibit two or more receptors or receptor
  • ligands for increased therapeutic efficacy may comprise N-terminal or C- terminal knottins engineered to contain, as one example, an integrin-binding portion.
  • Integrin binding knottins are described in US 2009/0257952 by Cochran et al. entitled “Engineered Integrin Binding Peptides.” Engineered peptides that bind with high affinity (low
  • integrin integrin
  • vitronectin ⁇ ⁇ ⁇ 3 and ⁇ ⁇ ⁇ 5 integrins
  • Knottins with novel binding properties may be fused to generate hetero-oligomeric bispecific proteins.
  • This application is incorporated herein by reference, as provided in the concluding paragraph hereof, and may be consulted further for descriptions of integrin-binding knottins.
  • the specific integrin binding 5 partner used here may be specific as to both alpha and beta integrin chains, or only to a beta chain. In the latter case, the integrin binding will be multispecific in that different alpha -beta integrin combinations will exist.
  • an integrin-binding knottin - ligand fusion has been created using a fragment of a growth factor, NKl .
  • the integrin binding knottin contains a loop that has been
  • NKl is a fragment of the polypeptide growth factor HGF/SF which acts as agonist of the MET receptor. It is described more fully in US 2004/0236073 Al by Gherardi, entitled "Nkl fragment of hepatocyte growth factor/scatter factor (hgf/sf) and variants thereof, and their use.” Briefly, HGF/SF has a unique domain structure that resembles that of
  • the blood proteinase precursor plasminogen consists of six domains: an N-terminal (N) domain, homologous to plasminogen activation peptide, four copies of the kringle (K) domain and a catalytically inactive serine proteinase domain.
  • N N-terminal
  • K kringle
  • Two products of alternative splicing of the primary HGF/SF transcript encode NKl, a fragment containing the N and the first K domain, Kl, and NK2, a fragment containing the N, Kl and second kringle, K2,
  • Axl is a receptor tyrosine kinase with a structure of the extracellular region that juxtaposes IgL and FNIII repeats. It is involved in the stimulation of cell proliferation. It can bind to the vitamin K-dependent 5 protein Gas6, thereby transducing signals into the cytoplasm.
  • the extracellular domain of Axl can be cleaved and a soluble extracellular domain of 65 kDa can be released.
  • the Axl receptor has two Gas6 binding sites (Figure 1A): a major, high affinity site located in its Igl domain, and a weaker minor site in its Ig2 domain.
  • An active 2:2 signaling complex is formed when Gas6 associates with Axl via its high affinity site, after which association through the weak binding site results in receptor dimerization and activation. This is a therapeutically relevant ligand-receptor system as Axl overexpression results in
  • Fig. 1 shows that the sequences represent an outline of domain addition and evolution library generation and screening; first row shows the wild- type EETI-II sequence with cysteine bonds and loops between cysteines; second row
  • '.0 shows loops 1 and 3 where x residues are added; loops 1 and 3 of EETI-II are randomized to generate the loop library and fused to the N-terminus of Axl Igl; third row shows sequences of EETI-II-axl fusion mutants EA 7.01, EA 7.06, and EA 8.04; bottom row lists sequences from identification of a PGM, or P-G/T-M/K motif.
  • the Axl amino acid sequence may be found in NCBI UniGene 26362, and Genbank • 5 Accession Number P30530.
  • the receptor or other fusion protein fused to the knottin is also modified and mutated for binding purposes, in addition to being fused to a knottin that is mutated for binding purposes.
  • the receptor which is to be used as a decoy, is first truncated to an extracellular 10 domain.
  • Axl a portion of the signal peptide and a small portion of the
  • extracellular domain about 110 amino acids from the extracellular domain of about 426 amino acids were used.
  • mutations are introduced into the DNA sequence encoding the receptor fragment.
  • the resulting clones are screened for binding to the native ligand (Gas6 in the case of Axl), and tighter binders are selected, e.g. by cell sorting.
  • a variety of receptor constructs could be used.
  • This knottin- Axl fusion can function as a bispecific or multispecific molecule capable of concurrently antagonizing both integrin binding as well as the native Gas6/Axl
  • Gas6 is a soluble ligand whereas the integrins are cell surface receptors,
  • Binding of Gas6 will sequester the soluble ligand, preventing it from associating with, and subsequently activating endogenous Axl receptor. Binding to integrin receptors will prevent them from binding to extracellular matrix proteins.
  • fusion of an integrin -binding peptide to a growth receptor or a signal transducing receptor such as a receptor tyrosine kinase is advantageous in that there is significant crosstalk between integrin and growth factor receptor pathways. For example, strong cross-talk exists between integrins and Met receptor. An agent that targets both receptors will be better at inhibiting angiogenesis and metastasis. Integrin targeting by means of a fusion of a
  • 5 therapeutic protein and an integrin-binding knottin can also localize the second therapeutic agent to the tumor cells, increasing efficacy through avidity effects.
  • an imaging agent that can target two tumor receptors would generate an increased signal and can detect smaller tumors for earlier detection.
  • a fusion protein as described herein is a fusion between an integrin binding knottin and an Fc portion of a mouse antibody.
  • the Fc portion of an antibody is formed by the two carboxy terminal domains of the two heavy chains that make up an immunoglobin molecule.
  • the IgG molecule contains 2 heavy chains (-50 kDa each) and 2 light chains (-25 kDa each). The general structure of all antibodies is very
  • Fab hypervariable region
  • the hinge region that links the Fc and Fab portions of the antibody molecule is in reality a flexible tether, allowing independent movement of the two Fab arms, rather than a rigid hinge. This has been demonstrated by electron microscopy of antibodies bound to haptens.
  • the present fusion proteins can be made to contain two knottin peptides, one on each arm of the antibody fragment.
  • the Fc portion varies between antibody classes (and subclasses) but is identical
  • the C-terminal end of the heavy chains form the Fc region.
  • the Fc region plays an important role as a receptor binding portion.
  • the Fc portion of antibodies will bind to Fc receptors in two different ways. For example, after IgG and IgM bind to a pathogen by their Fab portion their Fc portions can bind to receptors on phagocytic cells (like
  • the present knottin-Fc fusions can be implemented such that the Fc portion is used to provide dual binding capability, and/or for half-life extension, for improving expression levels, etc.
  • a library of knottins having a randomized loop and fused to a receptor is screened and used as a platform to create improved ligand binding.
  • an EETI library was fused to Axl, and this library was screened to isolate EETI-Axl binders with increased affinity to Gas6 ligand.
  • knottins may be fused with '.0 an existing ligand (or receptor) as a general platform for increasing the affinity of a ligand- receptor interaction.
  • the domain addition and evolution strategy is a broad-based strategy for enhancing affinity of existing protein-protein interactions.
  • a synthetic binding domain can be fused to
  • binding proteins from “naive” libraries.
  • naive we mean libraries based off of proteins with no native binding affinity towards the target, e.g. the EETI-II knottin exhibits no native binding affinity towards Gas6.
  • EETI-II peptides engineered for binding tumor targets hold significant promise for in vivo molecular imaging applications.
  • identification of binding proteins from naive libraries is challenging, in part due to the requirement that the affinity of the identified protein must be high enough for detection. For example, in yeast surface display binding affinities in the single-digit ⁇ range are
  • Knottin peptides may be difficult to obtain in properly folded form. Chemical '.5 synthesis and refolding of peptides may be done, but requires extensive optimization. This problem can be mitigated by fusing the knottin to a protein.
  • EETI-II 2.5D (described below) could not be solubly expressed in yeast.
  • a protease cleavage site was introduced between EETI-II 2.5D and Axl to cut off the fusion partner.
  • This is a general 10 strategy where any fusion partner can be used for the expression, or it can be part of making a bispecific protein as described above. This will also have implications for fusing modifying domains, such as Fc, human serum albumin, etc. to increase half-life for therapeutic applications.
  • an effective amount means an amount of a fusion protein of the present invention that is capable of modulating binding of an engineered peptide to a cognate binding partner.
  • the effective amount will depend on the route of administration and the condition of '.0 the patient.
  • “Pharmaceutically acceptable” is meant to encompass any carrier, which does not interfere with the effectiveness of the biological activity of the active ingredient and that is not toxic to the host to which is administered.
  • the above active ingredients may be formulated in unit dosage form for injection in vehicles such '5 as saline, dextrose solution, serum albumin and Ringer's solution.
  • knottin protein means a structural family of small proteins, typically 25- 40 amino acids, which bind to a range of molecular targets like proteins, sugars and lipids. Their three-dimensional structure is essentially defined by a peculiar arrangement of three to five disulfide bonds. A characteristic knotted topology with one disulfide bridge crossing the 10 macro-cycle limited by the two other intra-chain disulfide bonds, which was found in several different microproteins with the same cysteine network, lent its name to this class of biomolecules. Although their secondary structure content is generally low, the knottins share a small triple-stranded antiparallel ⁇ -sheet, which is stabilized by the disulfide bond framework.
  • Biochemically well-defined members of the knottin family also called cysteine knot proteins, include the trypsin inhibitor EETI-II from Ecballium elaterium seeds, the neuronal N-type Ca2+ channel blocker ⁇ -conotoxin from the venom of the predatory cone
  • a suitable agatoxin sequence is given in US 2009/0257952, having a common inventor with the present application.
  • Another agatoxin sequence is given at GenBank® Accession number P37045,
  • Conotxins generally consist of peptides which are 10-30 residues in length.
  • PRIALT® ziconotide a synthetic equivalent of a naturally occurring conopeptide found in the piscivorous marine snail, Conus magus.
  • Ziconotide which is a 25 amino acid, polybasic peptide containing three disulfide bridges with a molecular weight of 2639 daltons and a molecular formula of C 1 02H 172 N36O32S7.
  • Knottin proteins have a characteristic disulfide linked structure. This structure is also '.0 illustrated in Gelly et al., "The KNOTTIN website and database: a new information system dedicated to the knottin scaffold," Nucleic Acids Research, 2004, Vol. 32, Database issue D156-D159. A triple-stranded ⁇ -sheet is present in many knottins. The cysteines involved in the knot are shown as connected by lines in Figure ID indicating which Cys residues are linked to each other. The spacing between Cys residues is important in the present invention, '.5 as is the molecular topology and conformation of the engineered loop. The engineered loop may contain RGD to provide an integrin binding loop. These attributes are critical for high affinity integrin binding.
  • the RGD mimic loop is inserted between knottin Cys residues, but the length of the loop must be adjusted for optimal integrin binding depending on the three- dimensional spacing between those Cys residues. For example, if the flanking Cys residues 10 are linked to each other, the optimal loop may be shorter than if the flanking Cys residues are linked to Cys residues separated in primary sequence. Otherwise, particular amino acid substitutions can be introduced that constrain a longer RGD-containing loop into an optimal conformation for high affinity integrin binding.
  • the present knottin proteins may contain certain modifications made to truncate the knottin, or to remove a loop or unnecessary cysteine residue or disulfide bond.
  • amino acid includes both naturally- occurring and synthetic amino acids and includes both the D and L form of the acids as well as the racemic form. More
  • amino acids contain up to ten carbon atoms. They may contain an additional carboxyl group, and heteroatoms such as nitrogen and sulfur.
  • the amino acids are a and ⁇ -amino acids.
  • a- amino acid refers to amino acids in which the amino group is attached to the carbon directly attached to the carboxyl group, which is the a-carbon.
  • ⁇ -amino acid refers to amino acids in which the amino group is attached to a carbon one
  • EETI Protein Data Bank Entry (PDB) 2ETI. Its entry in the Knottin database is EETI-II. It has the sequence
  • EETI-II has a 30 amino acid sequence with a final proline at position 30:
  • Loops 1 and 3 are in bold and underlined. These loops can also be varied and affect binding efficiency, as is demonstrated below. Other loops may be varied without affecting '.0 binding efficiency.
  • AgRP means PDB entry 1HYK. Its entry in the Knottin database is SwissProt AGRP_HUMAN, where the full-length sequence of 129 amino acids may be found. It comprises the sequence beginning at amino acid 87. An additional G is added to this construct. It also includes a CI 05 A mutation described in Jackson, et al. 2002 • 5 Biochemistry, 41, 7565.
  • the dashed portion shows a fragment omitted in the "mini" version, below.
  • the bold and underlined portion, from loop 4 is replaced by the RGD sequences described below. 10 Loops 1 and 3 are shown between brackets below: GC[VRLHES]CLGQQVPCC[DPCAT]CYCRFFNAFCYCR— KLGTAMNPCSRT (SEQ ID NO: 3)
  • mini in reference to AgRP means PDB entry 1MRO. It is also SwissProt AGRP_HUMAN. It has the sequence, similar to that given above,
  • GCVRLHESCLGOOVPCCDPAATCYCRFFNAFCYCR (SEQ ID NO: 4)
  • underlined "A” represents an amino acid substitution which eliminates a possible dimer forming cystine.
  • cysttine herein refers to the single amino acid; cysteine to the dimer.
  • the bold and underlined portion, from loop 4, is replaced by the below described RGD sequences.
  • a atoxin means omega agatoxin PDB 10MB and the SwissProt entry in the knottin database TOG4B_AGEAP. It has the sequence
  • EDN-CIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECT PRLIMEGLSFA (SEQ ID NO: 5)
  • the dashes indicate portions of the peptide omitted for the "mini" agatoxin.
  • An additional glycine is added to the N-terminus of the mini-construct.
  • the bold and underlined portion is replaced by the below described RGD sequences.
  • loop domain refers to an amino acid subsequence within a peptide chain that has no ordered secondary structure, and resides generally on the surface of the peptide.
  • loop is understood in the art as referring to secondary structures that are not ordered as in the form of an alpha helix, beta sheet, etc.
  • substantially identical in the context of a peptide indicates that a peptide comprises a sequence with at least 70% sequence identity to a reference sequence, preferably 80%, more preferably 85%, most preferably at least 90% or at least 95% sequence identity to the reference sequence over a specified comparison window, which in this case is either the entire peptide, a molecular scaffold portion, or a binding loop portion (-9-11 residues).
  • a specified comparison window which in this case is either the entire peptide, a molecular scaffold portion, or a binding loop portion (-9-11 residues).
  • optimal alignment is conducted using the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol., 48:443 453.
  • An indication that two peptide sequences are substantially identical is that one peptide is immunologically reactive with antibodies raised against the second peptide.
  • a sequence is substantially identical to a specific sequence explicitly exemplified is that the sequence in question will have an integrin binding affinity at least as high as the reference sequence.
  • a peptide is substantially identical to a second peptide, for example, where the two peptides differ only by a conservative substitution. "Conservative substitutions" are well known, and exemplified, e.g., by the PAM 250 scoring matrix.
  • sequence identity or “identity” in the context of two nucleic acid or polypeptide sequences makes reference to the residues in the two sequences that are the same when aligned for maximum correspondence over a specified comparison window.
  • Sequences that differ by such conservative substitutions are said to have "sequence similarity” or “similarity.” Means for making this adjustment are well known to those of skill in the art. Typically this involves scoring a conservative substitution as a partial rather than a full mismatch, thereby increasing the percentage sequence identity. Thus, for example, where an identical amino acid is given
  • substitution is given a score between zero and 1.
  • the scoring of conservative substitutions is calculated, e.g., as implemented in the NIH Multiple alignment workshop
  • Three-dimensional tools may also be used for sequence comparison.
  • percentage of sequence identity means the value determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is
  • TAM receptor tyrosine kinase refers to the TAM family of receptor kinases, including tyro3, Axl and MerTK. These are characterized by a conserved sequence within the kinase domain and adhesion molecule-like extracellular domains, and are
  • TAM receptor tyrosine kinases biologic functions
  • knottin portion is used for specific binding to a predetermined ligand.
  • the knottin binding is preferably engineered by replacing a native solvent exposed loop with a short (e.g. 5-12 amino acid) sequence that has been selected for binding to the predetermined ligand.
  • the solvent-exposed (i.e. on the surface) loop will generally be anchored by disulfide- linked cysteine residues.
  • 5 replacement amino acid sequence is preferably obtained by randomizing codons in the loop portion, expressing the engineered peptide, and selecting the mutants with the highest binding to the predetermined ligand. This selection step may be repeated several times, taking the tightest binding proteins from the previous step and re-randomizing the loops.
  • the EETI-II knottin peptide contains a disulfide knotted topology and possesses '.0 multiple solvent-exposed loops that are amenable to mutagenesis. To evolve a binding
  • knottin peptides may be used in the present fusion proteins.
  • the following mutants bind to ⁇ ⁇ ⁇ 3 integrin about 2-3x better than a mutant with the RGD sequence from fibronectin.
  • Table 1 EETI sequences wherein the RGD motif (in italics in 1.4A) is found in the insert at positions 4-6.
  • the above engineered knottins contain the RGD binding loop and bind specifically to integrins, as described in copending application Ser. No. 12/418,376, filed 04/03/2009. As described there, these loops may be varied in the non-RGD residues to a certain degree without affecting binding specificity and potency. For example, if three of the eleven residues were varied, one would have about 70% identity to 2.5D.
  • the above engineered knottins have been shown to bind specifically to ⁇ ⁇ ⁇ 3 , ⁇ ⁇ ⁇ 5 , and asfii integrins
  • FIG. 1 Another example of a knottin peptide engineered to bind to integrins is AgRP.
  • Table 2 shows sequences of AgRP mutants isolated by flow cytometry and having an RGD sequence and flanking residues in loop 4, as indicated by the bolded residues:
  • AgRP engineered knottins can be made as described in the above- referenced US 2009/0257952 to Cochran et al.
  • AgRP knottin fusions can be prepared using AgRP loops 1, 2 and 3, as well as loop 4 as exemplified above.
  • the engineered knottin is fused to another protein.
  • the protein will to some extent enter into the design of the engineered knottin according to the present description. That is, the fusion partner and the knottin binding partner will have a logical relationship in that they are in the same biological pathway, they are directed to targets which may be brought together to improve a therapeutic result, etc.
  • the fusion may be engineered to bind to a ligand for the tyrosine kinase.
  • the fusion is administered and allowed to bind to the ligand, thereby acting as a decoy to prevent the native ligand from binding to the tyrosine kinase receptor.
  • the entire tyrosine kinase receptor is not used; only portions that bind to a native ligand, preferably an agonist.
  • Axl the Igl and Ig2 portions of the Axl receptor that bind to the Gas6 ligand are used.
  • Gas 6, growth arrest-specific 6) belongs to the family of plasma vitamin K-dependent proteins. Gas 6 shares high structural homology with an anticoagulant protein, but has growth factor- like properties through its interaction with receptor tyrosine kinases of the TAM family, tyro3, Axl and MerTK.
  • knottin-protein fusion Another example of an engineered knottin-protein fusion is one where the fusion partner is a growth factor or active fragment of a growth factor, and the knottin is engineered to bind to endothelial cells such as may be present in the vasculature or on tumors.
  • a knottin AgRP
  • AgRP knottin
  • Interaction between ⁇ ⁇ ⁇ 3 integrin and extracellular matrix is crucial for endothelial cells sprouting from capillaries and for angiogenesis.
  • inte grin-mediated outside-in signals co-operate with growth factor receptors to promote cell proliferation and motility.
  • VEGFFR-2 vascular endothelial growth factor receptor-2
  • binding partner selection is a fusion of an engineered knottin that
  • NKl a fragment of the polypeptide growth factor HGF/SF which acts as agonist of the MET receptor.
  • HGF/SF polypeptide growth factor/SF
  • EETI-II Ecballium elaterium trypsin inhibitor II
  • EETI-II serves as a synthetic binding domain to increase binding of its fusion partner.
  • EETI-II is a member of the knottin family of peptides which contain a characteristic interwoven disulfide-bonded framework that provides extraordinar stability properties (Figure IB).
  • Figure IB The solvent exposed loops of EETI-II are tolerant to mutagenesis and have previously been individually
  • Wild-type loops 1 and 3 were concurrently replaced with randomized sequences of 7 - 10 and 6 - 8 amino acids ( Figure ID), respectively, using NNS codons.
  • the NNS codon strategy permits the inclusion of all 20 amino acids in the engineered loops while limiting the frequency of stop codons by encoding for only one stop
  • Direct fusion was achieved by inclusion of an Avrll (CCTAG,G) site, which encodes for a proline-arginine dipeptide, prior to Axl Igl amino acid Gly22 in the yeast display pCT '.0 plasmid.
  • the EETI-II loop library was designed to replace the first base pair of the
  • the cDNA for the EETI-II loop library was synthesized using standard PCR assembly techniques and the yeast display E-Axl library was generated by homologous recombination
  • This library is hereto referred to as the E-Axl library; it comprised 1.2 x 10 individual transformants as determined by dilution plating and colony counting. Sequence analysis of randomly selected individual clones confirmed intended fusion strategy, loop length distribution, and a lack of mutation to the Axl Igl sequence. Approximately 30% of the clones contained full loop sequences without stop
  • EETI-II mutants developed here exhibit weak binding affinity towards Gas6 that are below the limits of detection when the knottin mutants are expressed in the absence of Axl.
  • Figure 2A shows the aga toxin component Aga lp and Aga 2p extending in that order from the yeast
  • Figure 3 shows that when sorting the library, the first sorts were conducted by 10 screening for binding to soluble Gas6. Subsequent sorts used Off-rate' sorts where binding to Gas6 was followed by incubation in the presence of excess competitor to impart selective pressure on enhanced kinetic dissociation. In the 6 th round of sorting we conducted a negative sort to clear mutants that were binding to secondary anti-His antibody. Sort 6 products (below) show these were completely eliminated with a single round of sorting. Final sort products retained binding after a 46 h unbinding (Off ) step.
  • Example 8 Described in Example 8 is the preparation of a fusion between a knottin (AgRP) engineered to bind ⁇ ⁇ ⁇ 3 integrins, and a fragment comprising the N-terminal and first kringle domains of HGF (termed NKl). This portion of HGF (hepatocyte growth factor) binds to the 5 Met receptor.
  • c-Met MET or MNNG HOS Transforming gene
  • HGFR hepatocyte growth factor receptor
  • the hepatocyte growth factor receptor protein possesses tyrosine-kinase activity.
  • the primary single chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide linked to form the mature receptor.
  • the ⁇ ⁇ ⁇ 3 integrin receptor is over-expressed on many solid tumor cells making it an important cancer target.
  • the Agouti related protein (AgRP) a cystine-knot peptide, contains four disulfide bonds and four solvent-exposed loops. It was engineered to target ⁇ ⁇ ⁇ 3 integrin receptors with pM binding affinity.
  • the AgRP mutant, 7A was shown to have the tightest binding affinity.
  • the K D values of the 7A mutant against U87MG and ⁇ 562- ⁇ ⁇ ⁇ 3 cells are
  • the Met receptor tyrosine kinase and its ligand hepatocyte growth factor (HGF) play an important role in mediating both tumor progression and tissue regeneration.
  • the N- terminal and first kringle domains (NKl) of HGF is a naturally occurring splice variant that retains the ability to activate the Met receptor.
  • NKl is a weak agonist and is 10 relatively unstable, limiting its therapeutic potential.
  • NKl for enhanced stability and recombinant expression yield using yeast surface display.
  • the NKl mutants isolated from our library screens functioned as weak Met receptor antagonists, due to mutation of a residue which mediates NKl homodimerization.
  • the best antagonists exhibited melting temperatures up to ⁇ 64 °C, a 15 °C improvement over antagonists derived from wild-type NKl, and up to a 40-fold improvement in expression yield.
  • a dual-specific protein that targets and inhibits both ⁇ ⁇ ⁇ 3 integrin and Met receptors has promise as an effective cancer therapeutic, especially compared to single receptor targeting agents.
  • RTK Receptor Tyrosine Kinase
  • the present fusion proteins may include a variety of receptor tyrosine kinases. These proteins have been well characterized as to their extracellular and ligand-binding motifs. They include RTK class I (EGF receptor family) (ErbB family); RTK class II (Insulin receptor family); RTK class III (PDGF receptor family); RTK class IV (FGF receptor family); RTK class V (VEGF receptors family); RTK class VI (HGF receptor family); RTK
  • the receptor i.e. containing the extracellular N-terminal region, which exhibits a variety of conserved elements including immunoglobulin (Ig)-like or epidermal growth factor (EGF)-like domains, fibronectin type III repeats, or cysteine-rich regions that are
  • intracellular C-terminal region displays the highest level of conservation and comprises catalytic domains responsible for the kinase activity of these receptors, which catalyses receptor autophosphorylation and tyrosine phosphorylation of RTK substrates.
  • Receptor tyrosine kinase sequences are available from a variety of sources, including Genbank. Exemplary sequences that may be used to create fragments and fusion proteins according to the present invention are given, e.g. in Rand et al., "Sequence survey of receptor tyrosine kinases reveals mutations in glioblastomas.” Proc. Nat. Acad. Sci. October 4, 2005 vol. 102 no. 40 14344-14349. The following list is taken from that publication.
  • NM_005012 Tyrosine-protein kinase transmembrane receptor
  • NM_004560 Tyrosine-protein kinase transmembrane receptor
  • NM_004304 ALK tyrosine kinase receptor precursor
  • NM_006180 BDNF/NT-3 growth factors receptor precursor
  • NM 023110 Basic fibroblast growth factor receptor 1 precursor.
  • nucleotide sequences may be obtained from Genbank by searching on the name of the peptide or protein.
  • Knottin DNA sequences may be obtained from the given amino acid sequences, using any codon assignment; codon assignment may be selected based on the expression vector used, such as yeast.
  • An EETI nucleotide sequence is given in WO0234906, GenBank AX497055; an AGRP nucleotide sequence may be found at NG_011501; an agatoxin nucleotide sequence may be found at Genbank M95540.1.
  • Another knottin amino acid and nucleic acid sequence may be found in J. Microbiol. Biotechnol. (2010), 20(4), 708-711, relating to the knottin Psacotheasin.
  • hepatocyte growth factor also termed c-met
  • NK1 fragment This fragment of HGF is known as the NK1 fragment.
  • SEQ ID NO: 66 An exemplary sequence is given in SEQ ID NO: 66. This sequence contains portions of sequences in the PAN_Apple super family and of the KR superfamily.
  • compositions could be expanded to include hepatocyte growth factor- like proteins; pplasminogen domain containing proteins; macrophage stimulating factor 1; and other plasminogen-related growth factors such as RON ("recepteur d'rare Nantais").
  • hepatocyte growth factor is a homolog of serine proteases but it has lost its proteolytic activity.
  • Administration of bispecific proteins bispecific proteins
  • the present fusion proteins may be administered in vitro, such as in cell culture studies, or to cells intended for transplant, but may also be administered in vivo.
  • a variety of formulations and dosing regiments used for therapeutic proteins may be employed.
  • the pharmaceutical compositions may contain, in addition to the CFP, suitable pharmaceutically acceptable carriers, biologically compatible vehicles and additives which are suitable for administration to an animal (for example, physiological saline) and eventually comprising auxiliaries (like excipients, stabilizers or diluents) which facilitate the processing of the active fusion proteins into preparations which can be used pharmaceutically.
  • auxiliaries like excipients, stabilizers or diluents
  • Such compositions can be eventually combined with another therapeutic composition acting synergically or in a coordinated manner with the chimeric proteins of the invention.
  • the other composition can be based with a fusion protein known to be therapeutically active against the specific disease (e.g. herceptin for breast cancer).
  • the pharmaceutical compositions comprising the soluble can be combined into a "cocktail" for use in the various treatment regimens.
  • compositions may be formulated in any acceptable way to meet the needs of the mode of administration.
  • the use of biomaterials and other polymers for drug delivery, as well the different techniques and models to validate a specific mode of administration, are disclosed in literature (Luo B and Prestwich G D, 2001; Cleland J L et al., 2001).
  • Any accepted mode of administration can be used and determined by those skilled in the art to establish the desired blood levels of then fusion protein. For example,
  • administration may be by various parenteral routes such as subcutaneous, intravenous, epidural, topical, intradermal, intrathecal, direct intraventricular, intraperitoneal, transdermal (e.g. in slow release formulations), intramuscular, intraperitoneal, intranasal, intrapulmonary (inhaled), intraocular, oral, or buccal routes.
  • parenteral routes such as subcutaneous, intravenous, epidural, topical, intradermal, intrathecal, direct intraventricular, intraperitoneal, transdermal (e.g. in slow release formulations), intramuscular, intraperitoneal, intranasal, intrapulmonary (inhaled), intraocular, oral, or buccal routes.
  • Parenteral administration can be by bolus injection or by gradual perfusion over time.
  • Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions, which may contain auxiliary agents or excipients known in the art, and can be prepared according to routine methods.
  • suspension of the active fusion proteins as appropriate oily injection suspensions may be administered.
  • Suitable lipophilic solvents or vehicles include fatty oils, for example, sesame oil, or synthetic fatty acid esters, for example, sesame oil, or synthetic fatty acid esters, for example, ethyl oleate or triglycerides.
  • Aqueous injection suspensions that may contain substances increasing the
  • compositions include suitable solutions for administration by injection, and contain from about 0.01 to 99 percent, preferably from about 20 to 75 percent of active fusion protein together with the excipient.
  • Compositions that can be administered rectally include
  • the active protein(s) can be formulated as a solution, suspension, emulsion or lyophilised powder in association with a pharmaceutically acceptable parenteral vehicle (e.g. water, saline, dextrose solution) and additives that maintain is otonicity (e.g. mannitol) or chemical stability
  • a pharmaceutically acceptable parenteral vehicle e.g. water, saline, dextrose solution
  • additives that maintain is otonicity e.g. mannitol
  • is otonicity e.g. mannitol
  • the formulation is sterilized by commonly used techniques.
  • penetrants appropriate to the barrier to be permeated are used in the formulation.
  • penetrants are generally known in the art.
  • compositions that can be taken orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and
  • the push-fit capsules can contain the active
  • ingredients in admixture with fillers such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
  • fillers such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
  • the active fusion proteins may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols.
  • stabilizers may be added. All
  • '.5 formulations for oral administration should be in dosages suitable for such administration.
  • the fusion proteins may be formulated for parenteral administration by injection, e.g., by bolus injection or continuous infusion.
  • Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative.
  • the compositions may take such forms as suspensions, solutions or emulsions in aqueous
  • 10 vehicles may contain formulatory agents such as suspending, stabilizing and/or
  • the active ingredient may be in powder or lyophilized form for constitution with a suitable vehicle, such as sterile pyrogen-free water, before use.
  • a suitable vehicle such as sterile pyrogen-free water
  • the fusion proteins may also be formulated as a depot preparation. Such long acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection.
  • the fusion proteins may be formulated with suitable polymeric or
  • hydrophobic materials for example as an emulsion in an acceptable oil
  • ion exchange resins for example, as a sparingly soluble derivatives, for example, as a sparingly soluble salt.
  • the fusion proteins may be delivered using a sustained release system, such as semipermeable matrices of solid hydrophobic polymers containing the therapeutic agent.
  • sustained-release materials have been established and are well known by those skilled in the art.
  • Sustained release capsules may, depending on their chemical nature,
  • the dosage administered will be dependent upon the age, sex, health, and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment, and the nature of the effect desired.
  • the dosage will be tailored to the individual
  • the total dose required for each treatment may be administered by multiple doses or in a single dose.
  • the pharmaceutical composition of the present invention may be administered alone or in conjunction with other therapeutics directed to the condition, or directed to other symptoms of the condition.
  • a daily dosage of active protein is comprised between 0.01 to 100
  • Second or subsequent administrations can be performed at a dosage, which is the same, less than, or greater than the initial or previous dose administered to the individual.
  • the substances of the invention can be administered prophylactically or
  • '5 therapeutically to an individual prior to, simultaneously or sequentially with other therapeutic regimens or agents (e.g. multiple drug regimens), in a therapeutically effective amount.
  • Active agents that are administered simultaneously with other therapeutic agents can be administered in the same or different compositions.
  • the therapeutically effective dose for any protein used in the method of the invention, the therapeutically effective dose
  • a dose can be formulated in animal models to achieve a circulating concentration range that includes or encompasses a concentration point or range shown to decrease cytokine expression in an in vitro system. Such information can be used to more accurately determine useful doses in humans.
  • a therapeutically effective dose refers to that amount of the fusion protein that results in amelioration of symptoms in a patient. Toxicity and therapeutic efficacy of such fusion proteins can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50, (the dose lethal to 50% of the test population) and the ED50 (the dose therapeutically effective in 50% of the population).
  • Fusion proteins that exhibit high therapeutic indices are preferred.
  • the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
  • the dosage of such fusion proteins lies preferably within a range of circulating concentrations that include the ED50,
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition.
  • the identified protein must be high enough for detection.
  • yeast surface energy For example, in yeast surface
  • the EETI- II mutants developed here exhibit weak binding affinity towards Gas6 that are below the limits of detection when the knottin mutants are expressed in the absence of Axl. Subsequent affinity maturation through traditional strategies or further domain addition and evolution can be used to generate fully synthetic binding agents with high affinity.
  • ⁇ 3/ ⁇ 5 integrin was directly fused to the N-terminus of wt Axl Igl.
  • the concept of this multi- specific fusion protein was validated using yeast-surface display by showing that EETI 2.5D - Axl bound to ⁇ 3 integrin and Gas6 at levels comparable to the mono-specific proteins EETI 2.5D and Axl, respectively. Furthermore, binding of ⁇ 3 integrin or Gas6 was
  • EETI 2.5D - Axl is capable of simultaneously interacting with both ⁇ 3 integrin and Gas6.
  • the EETI 2.5D - Axl fusion protein was able to be produced recombinantly in microbial hosts on a scale of 35 mg/L.
  • the resulting protein displayed high affinity (K D ⁇ 2 nM) to ⁇ 3 integrin expressed on the cell surface.
  • SD-CAA media contained 20 g/L glucose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na2HP04, 8.6 g/L NaH2P04 « H20, and 5 g/L Bacto casamino acids; SG-CAA media was identical, except glucose was substituted with 20 g/L galactose.
  • SD-CAA pH 4.5 media was identical to SD-CAA, except phosphates were replaced with 13.7 g/L sodium 10 citrate dihydrate, 8.4 g/L citric acid anhydrous, and adjusted to pH 4.5.
  • Phosphate buffered saline is composed of 11.9 mM sodium phosphate pH 7.4, 137 mM sodium chloride, 2.7 mM potassium chloride.
  • PBS/BSA consisted of PBS with 1 mg/mL bovine serum albumin.
  • EXAMPLE 2 Yeast Surface Display Library generation: EETI /Axl fusions
  • EETI- II amino acid sequence is Genbank Accession No. P12071; DBNA sequences are given in copending US 12/418,376, filed 4/3/2009, also incorporated by reference. DNA sequences may designed as desired by reverse translation of the amino acid sequences given.
  • Fig 1 D The amino acid sequences of EETI- II and the randomized loop 1 and loop 3, as well as the loops randomized in Axl are shown in Fig 1 D.
  • the four forward primers were pooled and used at 1 ⁇ each, and each of the three reverse primers were pooled and used at 1.33 ⁇ each, with IX KOD polymerase buffer, 0.2 mM dNTPs, 1.5 mM MgCl 2 , 1 M Betaine, and 2.5 units KOD polymerase (Novagen).
  • Thermocyling parameters were: Step 1- 95 °C for 2 min; Step 2- 95 °C for 30 sec, 55 °C for 30 sec, 72 °C for 1 min (30 cycles); Step 3- 72 °C for 10 min.
  • Assembled DNA (0.6 ⁇ ) was amplified using 2 ⁇ forward and reverse amplification primers, IX Pfx50 buffer, 0.2 mM dNTPs, and 5 units Pfx50 DNA polymerase (Invitrogen).
  • Forward amplification primer had 50 bp homology to the pCT backbone, while the reverse amplification primer contained 50
  • Plasmid backbone for library synthesis was generated by digesting pCT Avr-Axl with Nhel and Avrll restriction enzymes. A total of ⁇ 50 ⁇ g of cDNA insert and ⁇ 25 ⁇ g of restriction digested pCT Avr-Axl backbone was transformed into EBY100 by electroporation and
  • nucleotides used for homology to the plasmid backbone are shown at the 5' end up to the first slash.
  • the part of the primer between the first slash and the double slash and the triple slash and the 3' end correspond to residues of EETI-II.
  • N stands for any nucleotide and S is a mixture of G and C.
  • the part of the primer between the 0 double slash and the triple slash are nucleotides used to produce randomized residues for EETI-II loop 1 or loop 3.
  • the 5' end up to the first slash was homologous to nucleotides encoding the N terminus of the Axl receptor construct, which is 10 also part of the acceptor plasmid backbone.
  • the region between the first slash and the double slash and the triple slash and the 3' end correspond to residues of EETI-II.
  • N stands for any nucleotide and S is a mixture of G and C.
  • the library was amplified using the amplification primers below, which contain -50 base pairs of homology to the plasmid backbone (underlined, which comprises homology to the Axl sequence for the case of the reverse amplification primer).
  • the -50 base pairs of homology allows for assembly of the library insert and plasmid backbone as described by "Raymond CK, Pownder TA, Sexson SL. 1999. General method for plasmid construction using homologous recombination. Biotechniques 26: 134-138, 140-131.”
  • the first round of sorting by FACS consisted of three separate sorts for a total of approximately 8 x 10 sorted cells, while subsequent sort rounds analyzed at least lOx the number of yeast collected in the previous round to ensure sufficient sampling of remaining library diversity. Sort stringency was increased by decreasing the concentration of
  • Gas6 (0.05 - 400 nM) was added to 5 x 10 4 yeast cells displaying protein of interest in PBS/BSA at room temperature, using volumes, cell numbers, and incubation times experimentally determined to avoid ligand depletion and reach binding equilibrium.
  • Cells were pelleted and washed with ice cold PBS/BSA and resuspended in PBS/BSA containing 1:250 dilution of chicken anti-cmyc and incubated on ice for 40 min. Cells were pelleted, washed and resuspended in PBS/BSA containing a 1: 100 dilution of goat anti-chicken and mouse anti-His secondary antibodies for 20 min on ice. Cells were washed and analyzed
  • Binding titrations were fit to a four-parameter sigmoidal curve using Kaleidagraph software to determine the equilibrium binding constant (K D ).
  • K D equilibrium binding constant
  • # rpt number of times that clone occurred in the randomly selected clones for sequencing.
  • yeast display In order to use yeast display to characterize the binding interactions between Gas6 and the engineered EA mutants, we first sought to confirm that yeast display allows accurate affinity measurements of the Gas6-Axl interaction. Using yeast displayed Axl we were able to recapitulate previously reported binding affinities of Axl variants determined by surface plasmon resonance and solid phase binding (Table 4). This validates that yeast-displayed Axl is similar to recombinant versions of the receptor. Table 4: Comparison of affinity of Axl point mutants by yeast surface display (YSD) to values reported in the literature.
  • Table 5 Affinity of wt EETI-Axl and EA (EETI-II-axl fusion) mutants.
  • 2.5D and 2.5F are both variants of the Ecballium elaterium trypsin inhibitor-II (EETI-II) knottin. These knottins were engineered to specifically bind to the ⁇ ⁇ ⁇ 3 , ⁇ ⁇ ⁇ 5 and ⁇ ⁇ ⁇ , ⁇ ⁇ ⁇ 5 ,
  • integrin recognition tripeptide motif RGD.
  • FACS fluorescence activated cell sorting
  • Axl overexpression has been linked to invasive and metastatic phenotypes of a variety of cancers, suggesting that antagonizing the interaction between Axl and its native ligand, Gas6, could be of therapeutic value.
  • Axl S6-1 and S6-2 are engineered versions of Axl Igl that bind to Axl's native ligand, Gas6, with higher affinity than wild-type.
  • mutants were introduced 10 into the wild-type Axl Igl gene and the resulting mutant DNA library was expressed on the surface of yeast.
  • FACS FACS, clones with improved binding to Gas6 were isolated.
  • Clones S6-1 and S6-2 display 20- and 12-fold improvements in equilibrium binding over wild- type, respectively, with improvements largely coming from enhanced off-rates.
  • S6-1 has a 13°C improvement in melting temperature over wild- type 5 representing a significant enhancement in stability.
  • Table 7 shows the various peptides (EETI-II) and the Axl mutants used.
  • EETI-II mutant 2.5D ⁇ 3, ⁇ 5 Loop 1 CPQGRGDWAPTSC 59
  • Axl Igl consists of the first Ig domain, encompassing amino acids 19-132 of full-length Axl
  • the genes encoding for the EETI-II mutant and Axl Igl were assembled into a single genetic construct coding for the fusion protein.
  • the EETI-II domain was fused to the N-terminus of Axl Igl, resulting a fusion protein consisting of an N-terminal knottin domain followed by the Axl Igl domain.
  • the final proline of EETI-II and the initial alanine and proline of Axl were removed.
  • the DNA encoding for the fusion protein was then ligated into both yeast expression and secretion plasmids. This fusion protein has been expressed on the surface of yeast to allow for binding studies, as well as produced solubly.
  • yeast displayed 2.5D-Axl was used to test whether this fusion was functional.
  • the fusion's ability to binding to soluble ⁇ ⁇ ⁇ 3 integrin and Gas6 was measured and compared to binding levels seen in 2.5D and Axl alone.
  • the fusion displayed ⁇ ⁇ ⁇ binding affinities that matched that of 2.5D, while it maintained wild-type Axl's affinity for Gas6, validating the fusion construct.
  • binding of each soluble target was tested in the presence of a saturating amount of the second target to test the fusion's ability to concurrently bind both ⁇ ⁇ ⁇ integrin and Gas6. These binding levels were the same as when they were measured individually, suggesting that the fusion can indeed simultaneously bind to both of its targets.
  • This knottin- Axl fusion will function as a multispecific molecule capable of concurrently antagonizing both integrin binding as well as the native Gas6/Axl interactions.
  • Gas6 is a soluble ligand whereas the integrins are cell surface receptors, allowing both targets to be bound at the same time. Binding of Gas6 will sequester the soluble ligand, preventing it from associating with, and subsequently activating endogenous Axl receptor. Binding to integrin receptors will prevent them from binding to extracellular matrix proteins.
  • EXAMPLE 7 Knottin fusions to improve yields of engineered knottins
  • knottins can be difficult to produce recombinantly. By fusing them to a well-expressing protein, they can be expressed in high yields. Cleavage of the 5 knottin can be accomplished by the inclusion of a protease site between the protein domains.
  • the genes encoding for the EETI-II mutant and Axl Igl were assembled into a single genetic construct coding for the fusion protein. Both N and C-terminal knottin fusions were created, with the Tobacco Etch Virus (TEV) recognition 0 site, ENLYFQG (SEQ ID NO: 80), being inserted between the protein domains. The gene was then ligated into a yeast expression plasmid and transformed into the yeast Pichia pastoris.
  • TSV Tobacco Etch Virus
  • the EETI portion is underlined.
  • the TEV recognition site is in bold.
  • Both N and C-terminal fusions were produced with purified yields of -50 mg per 15 liter.
  • the purified fusions were then subjected to proteolytic cleavage by TEV, which
  • HGF HGF (NKl) that binds the Met receptor
  • a dual-specific fusion protein was constructed by linking the AgRP mutant, 7 A, with one of the tightest binding NKl fragments, named Aras4.
  • Aras4 is linked at the C-terminus of AgRP7A and there is no amino acid linker between two domains.
  • Figure 7 show that the fusion proteins have comparable binding affinities with the AgRP and NKl mutants towards ⁇ ⁇ ⁇ 3 integrin and Met receptors, respectively. This indicates that the fusion protein can be expressed and their individual components bind to their respective targets without steric interference.
  • the fusion protein was expressed in yeast culture according to the manufacturer's instructions (Invitrogen), then purified by metal chelating chromatography through the hexahistidine tag (SEQ ID NO: 77).
  • the scheme of the gene of this fusion protein is show in the box below.
  • the protein sequence of the fusion protein, AgRP7A-Aras4 is listed in Table 8 and listed below.
  • NKl fragment Variant sequences of the NKl fragment could be used, and are described, e.g., in Hartman et al., "A functional domain in the heavy chain of scatter factor/hepatocyte growth factor binds the c-Met receptor and induces cell dissociation but not mitogenesis," Proc. Nat. Acad. Sci. USA Vol. 89, pp. 11574-11578, December 1992.
  • K562 leukemia cells were previously transfected with ⁇ ⁇ ⁇ 3 integrin (Blystone, S. D. (1994). J. Cell Biol. 127, 1129-1137). We also showed by flow cytometry 5 that these cell lines also naturally express Met receptor (data not shown).
  • Knottins EETI2.5F and AgRp7A
  • NKl fusion proteins were created and purified for the study of in vitro biological characteristics.
  • Three different NKl variants were fused to C- terminus of the two distinct knottin proteins, including M2.2, M2.2(D127A) and Aras4. Therefore, six proteins composed of the following variations: AgRp7A-Aras4, EETI2.5F- 0 Aras4, AgRp7A-M2.2, EETI2.5F-M2.2, AgRp7A-M2.2(D127A) and EETI2.5F-
  • M2.2(D127A) were constructed and used for the in vitro assays.
  • M2.2 was from the second round of directed evolution
  • Aras4 was from the third round of directed evolution from our previous NKl filing.
  • D127A is a point mutant that has previously been shown to modulate antagonistic activity).
  • HUVECs express medium levels of the ⁇ ⁇ ⁇ 3 , ⁇ ⁇ ⁇ 5 integrins, the Met receptor, and a high level of the ⁇ 5 ⁇ 1 integrin.
  • Serum stability of AgRp7A-M2.2(D127A) and EETI2.5F-M2.2(D127A) was shown when the proteins were incubated with 40% human serum at 37°C for over several days. Samples were analyzed by Western Blot and detected with an antibody against the FLAG epitope tag. No significant decrease in the amount of intact fusion protein was observed over 7 days, indicating stability of the knottin fusion proteins to serum proteases and elevated temperatures.
  • a HUVEC proliferation assay was performed where cells were stimulated with 0.5 nM HGF. AgRp7A, EETI2.5F, AgRp7A-M2.2(D 127A), or EETI2.5F-M2.2(D127A) proteins were added to observe their effects on the inhibition of HUVEC proliferation.
  • AgRp7A had little inhibitory effect on HUVECs proliferation.
  • the knottin fusion proteins AgRp7A-M2.2(D127A) and EETI2.5F-M2.2(D127A) showed higher inhibitory effects on cell proliferation compared AgRp7A and EETI2.5F, approaching inhibition levels equivalent to that of the negative control.
  • Met receptor phosphorylation assay was performed in PC3 (prostate cancer cells). Met receptor phosphorylation was assayed by Western blot after stimulation with 0.3 nM HGF. AgRp7A, Aras4 and AgRp7A-Aras4 proteins were added to observe their effects on the inhibition of Met phosphorylation. AgRp7A did not show inhibition of Met
  • Inhibition of PC3 cell adhesion to vitronectin was performed by coating human vitronectin onto the wells of a microtiter plate and seeding cells in the presence of varying concentrations of Aras4, AgRp7A, EETI2.5F, AgRp7A-Aras4, or EETI2.5F-Aras4.
  • Half- maximal inhibitor concentration values for all constructs were similar and in the low nM range (-20-40 nM), except for Aras4, which did not inhibit PC3 cell adhesion, as expected.
  • Example 6 a direct fusion of the EETI knottin/integrin binding peptide to an Axl membrane bound kinase receptor was prepared.
  • the Axl Igl domain, amino acids 21- 132 was used.
  • EETI 2.5D By fusing EETI 2.5D to Axl Igl, a multi- specific molecule was formed, capable of binding ⁇ 3/ ⁇ 5 integrins and Gas6.
  • the sequence is given below, where the knottin portion, 2.5D is underlined, and the Axl portion begins with the sequence RGT....
  • GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCGS /RGTQAEESPFVGNPGNITGARGLTGTL RCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQ CLVFLGHQTFVSQPGYVGLEGLP SEQ ID NO: 84.
  • the ability of the fusion protein to bind to either ⁇ 3 integrin or Gas6 was tested using the yeast display platform, wherein the EETI 2.5D-Axl fusion protein was cloned into a yeast
  • '.0 fusion protein binds to integrin or Gas6 with affinities similar to its corresponding monospecific components.
  • yeast-surface display binding data Referring to Figure 9, yeast-surface display binding data.
  • yeast were
  • EETI 2.5D - Axl is capable of simultaneously binding to both targets.
  • the EETI 2.5D - Axl fusion protein was then cloned into the pPic9K yeast secretion vector and soluble protein was recombinantly produced in the yeast strain P. pastoris according to the manufacturer's manual (Invitrogen). Protein was purified from culture supernatant using nickel affinity chromatography and heterogeneous yeast glycosylations were cleaved by treating the protein with endoglycosidase (endoH). Monomeric EETI 2.5D - Axl protein was further purified using size exclusion chromatography. The purity of the final product was analyzed using SDS-PAGE, and analytical size exclusion chromatography. Highly pure, monomeric EETI 2.5D - Axl fusion protein was obtained at an approximate yield of 35 milligrams per liter.
  • EETI 2.5D - Axl Recombinantly produced EETI 2.5D - Axl was tested for its ability to bind cell- surface ⁇ 3 integrin.
  • K562 leukemia cells that have been transfected to overexpress ⁇ 3 integrin ⁇ 562- ⁇ 3 cells
  • EETI 2.5D - Axl excess EETI 2.5D - Axl was removed by washing and cells were resuspended in a solution containing a fluorescently labeled antibody against the FLAG epitope tag on the recombinant multispecific protein.
  • Flow cytometry was then used to quantify the amount of bound EETI 2.5D - Axl by detecting the fluorescent anti- FLAG antibody.
  • the affinity (Kd) of the EETI 2.5D - Axl fusion protein to the ⁇ 562- ⁇ 3 cells was determined to be 1.72 nM. Additionally, circular dichroism spectroscopy was used to analyze the thermal stability of the EETI 2.5D - Axl fusion protein as compared to wt Axl. Wild-type Axl Igl was found to have a melting temperature (Tm) of 41°C. By fusing EETI 2.5D to the N-terminus of Axl, an improvement of 11 oC in stability was observed (Tm ⁇ 52 °C). The results of these binding studies and CD experiments are summarized in the table below.
  • knottins are difficult to produce recombinantly as they produce high order 0 oligomers rather than properly folded monomers.
  • we have demonstrated robust methods for chemical synthesis and in vitro folding of EETI 2.5D using solid phase peptide synthesis we have not been able to recombinantly express this knottin in a yeast- based expression system.
  • TEV Tobacco Etch Virus
  • SENLYFQS or GENLYFQG (SEQ ID NO: 82) wherein glycine (G) may be substituted with serine (S) in the amino acid sequence.
  • TEV then cuts just prior to the last G/S. This cleavage '.0 site was placed at the C-terminus of the TEV protease, followed by EETI 2.5D.
  • the first amino acid in EETI 2.5D is a glycine (G), thus to eliminate extra residues from being left post-cleavage, that glycine was removed.
  • the protease portion of the fusion protein can interact with the cleavage sites of another fusion, cutting it and thereby generating free EETI 2.5D knottin.
  • this autocleaving construct is a viable method to recombinantly express knottins which are difficult to produce in standard microbial systems.
  • the autocleaving construct permits recombinant production of knottins otherwise incapable of being produced in microbial systems.
  • This strategy could also be used to 5 produce proteins besides knottins.
  • a fusion partner such as Axl could be used to facilitate recombinant expression of knottins, with a protease cleavage site introduced in between the knottin and Axl proteins.
  • a mouse antibody Fc portion is fused to an integrin binding knottin, 0 EETI as described above.
  • Knottin-Fc fusions were created by molecular cloning and
  • modified knottin proteins will have long circulation times (days) compared to unmodified knottins, which have half-lives on the order of minutes.
  • EETI-based knottin peptides 2.5D and 2.5F, and wild-type EETI-II can be fused to an Fc domain of mouse Ig2a (SEQ ID NO: 83), and recombinantly 5 expressed knottin-Fc fusion proteins in mammalian human embryonic kidney (HEK) cells.
  • the Fc domain is a known sequence, see, e.g. Accession NM_010184.2 for an mRNA sequence.
  • the knottin peptides were purified and run on a NuPAGE 4-12% Bis-Tris gel. The results showed the expected sizes of non-reduced (NR) and reduced (R) knottin 2.5D-Fc.
  • the knottin proteins were then analyzed by gel filtration chromatography in which the purified '.0 knottin-Fc protein 2.5D showed no tendency to aggregate.
  • knottin-Fc proteins The binding of the knottin-Fc proteins to tumor cell lines were then measured.
  • the knottin 2.5F-Fc peptide was found to bind with a greater affinity to sk0v3 cells compared to the knottin 2.5D-Fc peptide when measured against wild-type EETII-Fc.
  • knottin 2.5-Fc and 2.5D-Fc bound with similar affinity to K562 leukemia cells transfected with ⁇ 3 '5 integrin.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Insects & Arthropods (AREA)
  • Cell Biology (AREA)
  • Immunology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2011/059599 2010-11-08 2011-11-07 Fusion proteins comprising an engineered knottin peptide and uses thereof Ceased WO2012064658A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
US13/883,216 US10844106B2 (en) 2010-11-08 2011-11-07 Fusion proteins comprising an engineered knottin peptide and uses thereof
JP2013537908A JP6170435B2 (ja) 2010-11-08 2011-11-07 改変ノッチンペプチドを含む融合タンパク質及びその使用
DK11839687.8T DK2638173T3 (da) 2010-11-08 2011-11-07 Fusionsproteiner omfattende et manipuleret knottin-peptid og anvendelser deraf
CA2817197A CA2817197C (en) 2010-11-08 2011-11-07 Fusion proteins comprising an engineered knottin peptide and uses thereof
EP19180924.3A EP3604549A1 (en) 2010-11-08 2011-11-07 Fusion proteins comprising an engineered knottin peptide and uses thereof
EP11839687.8A EP2638173B1 (en) 2010-11-08 2011-11-07 Fusion proteins comprising an engineered knottin peptide and uses thereof
AU2011326164A AU2011326164B2 (en) 2010-11-08 2011-11-07 Fusion proteins comprising an engineered knottin peptide and uses thereof
AU2016210712A AU2016210712B2 (en) 2010-11-08 2016-08-04 Fusion proteins comprising an engineered knottin peptide and uses thereof
AU2018200587A AU2018200587B2 (en) 2010-11-08 2018-01-24 Fusion proteins comprising an engineered knottin peptide and uses thereof
US17/066,167 US11498952B2 (en) 2010-11-08 2020-10-08 Fusion proteins comprising an engineered knottin peptide and uses thereof
US18/055,297 US12240882B2 (en) 2010-11-08 2022-11-14 Fusion proteins comprising an engineered knottin peptide and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US41135010P 2010-11-08 2010-11-08
US61/411,350 2010-11-08

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/883,216 A-371-Of-International US10844106B2 (en) 2010-11-08 2011-11-07 Fusion proteins comprising an engineered knottin peptide and uses thereof
US17/066,167 Continuation US11498952B2 (en) 2010-11-08 2020-10-08 Fusion proteins comprising an engineered knottin peptide and uses thereof

Publications (1)

Publication Number Publication Date
WO2012064658A1 true WO2012064658A1 (en) 2012-05-18

Family

ID=46051256

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/059599 Ceased WO2012064658A1 (en) 2010-11-08 2011-11-07 Fusion proteins comprising an engineered knottin peptide and uses thereof

Country Status (7)

Country Link
US (3) US10844106B2 (https=)
EP (2) EP3604549A1 (https=)
JP (2) JP6170435B2 (https=)
AU (3) AU2011326164B2 (https=)
CA (1) CA2817197C (https=)
DK (1) DK2638173T3 (https=)
WO (1) WO2012064658A1 (https=)

Cited By (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014063012A1 (en) * 2012-10-19 2014-04-24 The Board Of Trustees Of The Leland Stanford Junior University Conjugated knottin mini-proteins containing non-natural amino acids
WO2016025642A1 (en) * 2014-08-12 2016-02-18 Massachusetts Institute Of Technology Synergistic tumor treatment with il-2 and integrin-binding-fc-fusion protein
JP2016505251A (ja) * 2012-12-10 2016-02-25 フレッド ハッチンソン キャンサー リサーチ センター リポカリン融合パートナー
WO2017049009A1 (en) * 2015-09-15 2017-03-23 Genentech, Inc. Cystine knot scaffold platform
WO2017118761A1 (en) * 2016-01-08 2017-07-13 Iontas Ltd Binding members with altered diversity scaffold domains
WO2017139570A1 (en) * 2016-02-12 2017-08-17 Massachusetts Intitute Of Technology Synergistic tumor treatment with il-2, an integrin-binding-fc fusion protein, and a cancer vaccinne
US9844582B2 (en) 2012-05-22 2017-12-19 Massachusetts Institute Of Technology Synergistic tumor treatment with extended-PK IL-2 and therapeutic agents
WO2018044234A1 (en) * 2016-08-31 2018-03-08 Nanyang Technological University Cysteine-rich polypeptides and conjugates and methods of using the same
EP3313427A4 (en) * 2015-06-26 2018-12-26 Fred Hutchinson Cancer Research Center Therapeutic peptides and methods of use thereof
WO2019012014A1 (en) 2017-07-12 2019-01-17 Iontas Limited SODIUM CHANNEL INHIBITORS
WO2019023156A1 (en) * 2017-07-24 2019-01-31 Rutgers, The State University Of New Jersey PHOSPHATIDYLSERIN-TARGETING FUSION MOLECULES AND METHODS OF USE
US10350266B2 (en) 2017-01-10 2019-07-16 Nodus Therapeutics, Inc. Method of treating cancer with a multiple integrin binding Fc fusion protein
EP3604549A1 (en) 2010-11-08 2020-02-05 The Board of Trustees of the Leland Stanford Junior University Fusion proteins comprising an engineered knottin peptide and uses thereof
US10603358B2 (en) 2017-01-10 2020-03-31 Nodus Therapeutics Combination tumor treatment with an integrin-binding-Fc fusion protein and immune stimulator
US10765625B2 (en) 2016-03-15 2020-09-08 The Board Of Trustees Of The Leland Stanford Junior University Knottin-drug conjugates and methods of using the same
US11013814B2 (en) 2017-03-16 2021-05-25 Blaze Bioscience, Inc. Cartilage-homing peptide conjugates and methods of use thereof
AU2019210662B2 (en) * 2012-12-14 2021-07-01 Aravive Biologics, Inc. Modified AXL peptides and their use in inhibition of AXL signaling in anti-metastatic therapy
US11090358B2 (en) 2015-09-09 2021-08-17 Fred Hutchinson Cancer Research Center Cartilage-homing peptides
US11235032B2 (en) 2019-01-23 2022-02-01 Massachusetts Institute Of Technology Combination immunotherapy dosing regimen for immune checkpoint blockade
US11331393B2 (en) 2017-06-15 2022-05-17 Blaze Bioscience, Inc. Renal-homing peptide conjugates and methods of use thereof
WO2022114946A1 (es) * 2020-11-27 2022-06-02 Centro De Investigación Científica Y De Educación Superior De Ensenada, Baja California (Cicese) Proteína andamio para la generación de proteínas quiméricas de unión a antígeno
RU2778694C2 (ru) * 2016-01-08 2022-08-23 Максион Терапьютикс Лимитед Связывающие элементы с измененными диверсифицированными доменами остова
US11548923B2 (en) 2017-01-18 2023-01-10 Fred Hutchinson Cancer Center Peptide compositions and methods of use thereof for disrupting TEAD interactions
EP3962511A4 (en) * 2019-04-29 2023-01-18 The Board of Trustees of the Leland Stanford Junior University METHODS OF OCULAR TREATMENT USING A GENETICALLY MODIFIED HEPATOCYTE GROWTH FACTOR DIMERIC FRAGMENT
US11559580B1 (en) 2013-09-17 2023-01-24 Blaze Bioscience, Inc. Tissue-homing peptide conjugates and methods of use thereof
US11866466B2 (en) 2017-12-19 2024-01-09 Blaze Bioscience, Inc. Tumor homing and cell penetrating peptide-immuno-oncology agent complexes and methods of use thereof

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008045252A2 (en) * 2006-10-04 2008-04-17 The Board Of Trustees Of The Leland Stanford Junior University Engineered integrin binding peptides
WO2013078250A2 (en) 2011-11-22 2013-05-30 The Board Of Trustees Of The Leland Stanford Junior University Cystine knot peptides that bind alpha-v-beta-6 integrin
WO2016025647A1 (en) 2014-08-12 2016-02-18 Massachusetts Institute Of Technology Synergistic tumor treatment with il-2, a therapeutic antibody, and a cancer vaccine
CN113661240B (zh) * 2019-04-02 2024-11-05 伊莱利利公司 选择和检测结合肽的方法
JP2022533671A (ja) * 2019-05-22 2022-07-25 ザ ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティー 薬物複合体およびその使用方法
AU2020357806A1 (en) * 2019-09-30 2022-05-26 The Board Of Trustees Of The Leland Stanford Junior University Knottin-immunostimulant conjugates and related compositions and methods
WO2022026906A2 (en) * 2020-07-30 2022-02-03 The Board Of Trustees Of The Leland Stanford Junior University Lysosomal targeting molecules comprising knottin peptides and related compositions and methods
WO2025255080A1 (en) * 2024-06-04 2025-12-11 The Children's Hospital Of Philadelphia Hypoxia inducible high-fidelity circuit

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5468634A (en) * 1991-06-24 1995-11-21 The University Of North Carolina At Chapel Hill Axl oncogene
WO2008045252A2 (en) 2006-10-04 2008-04-17 The Board Of Trustees Of The Leland Stanford Junior University Engineered integrin binding peptides
WO2010048588A2 (en) 2008-10-23 2010-04-29 Massachusetts Institute Of Technology Directed engagement of activating fc receptors
US20110136740A1 (en) * 2009-11-06 2011-06-09 The Board Of Trustees Of The Leland Stanford Junior University CYSTINE KNOT PEPTIDES BINDING TO ALPHA IIb BETA 3 INTEGRINS AND METHODS OF USE

Family Cites Families (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6699658B1 (en) 1996-05-31 2004-03-02 Board Of Trustees Of The University Of Illinois Yeast cell surface display of proteins and uses thereof
US6303749B1 (en) * 1999-01-29 2001-10-16 Amgen Inc. Agouti and agouti-related peptide analogs
DE10053224A1 (de) 2000-10-26 2002-05-08 Univ Goettingen Georg August Verfahren zur Exposition von Peptiden und Polypeptiden auf der Zelloberfläche von Bakterien
US20040132634A1 (en) 2001-01-31 2004-07-08 Frank Sicheri Compositions and methods for regulating the kinase domain of receptor tyrosine kinases
GB0110430D0 (en) 2001-04-27 2001-06-20 Medical Res Council Protein variants and uses thereof
EP1737971B1 (en) 2004-01-20 2017-08-16 Merus N.V. Mixtures of binding proteins
EP1778726A4 (en) * 2004-08-16 2009-03-18 Medimmune Inc INTEGRIN ANTAGONISTS WITH IMPROVED ANTIBODY-DEPENDENT CELL-ASSAYED CYTOTOXICITY ACTIVITY
WO2007100358A2 (en) 2005-10-07 2007-09-07 University Of Chicago Convergent synthesis of proteins by kinetically controlled ligation
US7666622B2 (en) * 2005-10-19 2010-02-23 Regeneron Pharmaceuticals, Inc. Monomeric self-associating fusion polypeptides and therapeutic uses thereof
EP1958957A1 (en) 2007-02-16 2008-08-20 NascaCell Technologies AG Polypeptide comprising a knottin protein moiety
CA2692320A1 (en) * 2007-07-02 2009-01-08 Wyeth Methods of treating bone disorders with modulators of axl
KR20100058509A (ko) 2007-07-31 2010-06-03 메디뮨 엘엘씨 다중특이적 에피토프 결합 단백질 및 이의 용도
WO2009097017A2 (en) * 2007-09-18 2009-08-06 The Jackson Laboratory Antibodies and fc fusion protein modifications with enhanced persistence or pharmacokinetic stability in vivo and methods of use thereof
WO2009061853A2 (en) * 2007-11-05 2009-05-14 Massachusetts Institute Of Technology Mutant interleukin-2 (il-2) polypeptides
US8329826B2 (en) 2008-11-06 2012-12-11 The Board Of Trustees Of The Leland Stanford Junior University Surface modification of interpenetrating polymer networks
PT2525824T (pt) 2010-01-22 2017-07-13 Univ Leland Stanford Junior Inibição da sinalização de axl em terapêutica antimetastática
US10844106B2 (en) * 2010-11-08 2020-11-24 The Board Of Trustees Of The Leland Stanford Junior University Fusion proteins comprising an engineered knottin peptide and uses thereof
US10350266B2 (en) * 2017-01-10 2019-07-16 Nodus Therapeutics, Inc. Method of treating cancer with a multiple integrin binding Fc fusion protein

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5468634A (en) * 1991-06-24 1995-11-21 The University Of North Carolina At Chapel Hill Axl oncogene
WO2008045252A2 (en) 2006-10-04 2008-04-17 The Board Of Trustees Of The Leland Stanford Junior University Engineered integrin binding peptides
US20090257952A1 (en) * 2006-10-04 2009-10-15 The Board Of Trustees Of The Leland Stanford Junior University Engineered Integrin Binding Peptides
WO2010048588A2 (en) 2008-10-23 2010-04-29 Massachusetts Institute Of Technology Directed engagement of activating fc receptors
US20110136740A1 (en) * 2009-11-06 2011-06-09 The Board Of Trustees Of The Leland Stanford Junior University CYSTINE KNOT PEPTIDES BINDING TO ALPHA IIb BETA 3 INTEGRINS AND METHODS OF USE

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
HOLLAND ET AL.: "Multiple roles for the receptor tyrosine kinase axl in tumor formation.", CANCER RES., vol. 65, no. 20, 15 October 2005 (2005-10-15), pages 9294 - 303, XP009111560 *
HUANG ET AL., THE JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS, vol. 316, 2006, pages 983 - 991
See also references of EP2638173A4

Cited By (59)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3604549A1 (en) 2010-11-08 2020-02-05 The Board of Trustees of the Leland Stanford Junior University Fusion proteins comprising an engineered knottin peptide and uses thereof
US9844582B2 (en) 2012-05-22 2017-12-19 Massachusetts Institute Of Technology Synergistic tumor treatment with extended-PK IL-2 and therapeutic agents
WO2014063012A1 (en) * 2012-10-19 2014-04-24 The Board Of Trustees Of The Leland Stanford Junior University Conjugated knottin mini-proteins containing non-natural amino acids
US10407477B2 (en) 2012-10-19 2019-09-10 The Board Of Trustees Of The Leland Stanford Junior University Conjugated knottin mini-proteins containing non-natural amino acids
US9587001B2 (en) 2012-10-19 2017-03-07 The Board Of Trustees Of The Leland Stanford Junior University Conjugated knottin mini-proteins containing non-natural amino acids
US11466063B2 (en) 2012-10-19 2022-10-11 The Board Of Trustees Of The Leland Stanford Junior University Conjugated knottin mini-proteins containing non-natural amino acids
JP2016505251A (ja) * 2012-12-10 2016-02-25 フレッド ハッチンソン キャンサー リサーチ センター リポカリン融合パートナー
US10156559B2 (en) 2012-12-10 2018-12-18 Fred Hutchinson Cancer Research Center Lipocalin fusion partners
US11136563B2 (en) 2012-12-14 2021-10-05 The Board Of Trustees Of The Leland Stanford Junior University Modified AXL peptides and their use in inhibition of AXL signaling in anti-metastatic therapy
AU2019210662B2 (en) * 2012-12-14 2021-07-01 Aravive Biologics, Inc. Modified AXL peptides and their use in inhibition of AXL signaling in anti-metastatic therapy
US11559580B1 (en) 2013-09-17 2023-01-24 Blaze Bioscience, Inc. Tissue-homing peptide conjugates and methods of use thereof
AU2015301753B2 (en) * 2014-08-12 2021-04-08 Massachusetts Institute Of Technology Synergistic tumor treatment with IL-2 and integrin-binding-Fc-fusion protein
EP3646879A1 (en) * 2014-08-12 2020-05-06 Massachusetts Institute Of Technology Synergistic tumor treatment with il-2 and integrin-binding-fc-fusion protein
US20170216402A1 (en) * 2014-08-12 2017-08-03 Massacusetts Institute Of Technology Synergistic tumor treatment with il-2 and integrin-binding-fc-fusion protein
US10166273B2 (en) 2014-08-12 2019-01-01 The Board Of Trustees Of The Leland Stanford Junior University Synergistic tumor treatment with antibodies targeting PD-1, PD-L1 or CTLA4 and integrin-binding-Fc-fusion protein
US11096989B2 (en) 2014-08-12 2021-08-24 The Board Of Trustees Of The Leland Stanford Junior University Synergistic tumor treatment with an extended pharmacokinetic IL-2 and integrin-binding-Fc fusion protein
WO2016025642A1 (en) * 2014-08-12 2016-02-18 Massachusetts Institute Of Technology Synergistic tumor treatment with il-2 and integrin-binding-fc-fusion protein
EP3313427A4 (en) * 2015-06-26 2018-12-26 Fred Hutchinson Cancer Research Center Therapeutic peptides and methods of use thereof
US11090358B2 (en) 2015-09-09 2021-08-17 Fred Hutchinson Cancer Research Center Cartilage-homing peptides
US11648290B2 (en) 2015-09-09 2023-05-16 Fred Hutchinson Cancer Center Cartilage-homing peptides
CN108026162A (zh) * 2015-09-15 2018-05-11 豪夫迈·罗氏有限公司 胱氨酸结支架平台
RU2770384C2 (ru) * 2015-09-15 2022-04-15 Дженентек, Инк. Платформа на основе каркаса цистинового узла
US10428125B2 (en) 2015-09-15 2019-10-01 Genentech, Inc. Cystine knot scaffold platform
TWI799366B (zh) * 2015-09-15 2023-04-21 美商建南德克公司 胱胺酸結骨架平臺
CN108026162B (zh) * 2015-09-15 2022-04-05 豪夫迈·罗氏有限公司 胱氨酸结支架平台
US11155586B2 (en) 2015-09-15 2021-10-26 Genentech, Inc. Cystine knot scaffold platform
US10696721B2 (en) 2015-09-15 2020-06-30 Genentech, Inc. Cystine knot scaffold platform
WO2017049009A1 (en) * 2015-09-15 2017-03-23 Genentech, Inc. Cystine knot scaffold platform
US11078243B2 (en) 2015-09-15 2021-08-03 Genentech, Inc. Cystine knot scaffold platform
US11407794B2 (en) 2015-09-15 2022-08-09 Genetech, Inc. Cystine knot scaffold platform
AU2016323445B2 (en) * 2015-09-15 2021-04-01 Genentech, Inc. Cystine knot scaffold platform
AU2021204400B2 (en) * 2015-09-15 2023-02-02 Genentech, Inc. Cystine knot scaffold platform
EP3786292A1 (en) * 2016-01-08 2021-03-03 Maxion Therapeutics Limited Binding members with altered diversity scaffold domains
CN108473987B (zh) * 2016-01-08 2024-01-02 马可讯治疗有限公司 具有改变的多样性支架结构域的结合成员
CN108473987A (zh) * 2016-01-08 2018-08-31 艾恩塔斯有限公司 具有改变的多样性支架结构域的结合成员
KR102888509B1 (ko) 2016-01-08 2025-11-20 맥시온 테라퓨틱스 리미티드 변형된 다양성 스캐폴드 도메인을 갖는 결합 멤버
WO2017118761A1 (en) * 2016-01-08 2017-07-13 Iontas Ltd Binding members with altered diversity scaffold domains
RU2778694C2 (ru) * 2016-01-08 2022-08-23 Максион Терапьютикс Лимитед Связывающие элементы с измененными диверсифицированными доменами остова
KR20180100132A (ko) * 2016-01-08 2018-09-07 이온타스 엘티디 변형된 다양성 스캐폴드 도메인을 갖는 결합 멤버
GB2562933B (en) * 2016-01-08 2022-06-29 Maxion Therapeutics Ltd Binding members with altered diversity scaffold domains
GB2562933A (en) * 2016-01-08 2018-11-28 Iontas Ltd Binding members with altered diversity scaffold domains
US10888603B2 (en) 2016-02-12 2021-01-12 The Board Of Trustees Of The Leland Stanford Junior University Methods of treating cancer cells expressing tumor-associated integrins
WO2017139570A1 (en) * 2016-02-12 2017-08-17 Massachusetts Intitute Of Technology Synergistic tumor treatment with il-2, an integrin-binding-fc fusion protein, and a cancer vaccinne
US20190054145A1 (en) * 2016-02-12 2019-02-21 Massachusetts Institute Of Technology Synergistic tumor treatment with il-2, an integrin-binding-fc fusion protein, and a cancer vaccine
US10765625B2 (en) 2016-03-15 2020-09-08 The Board Of Trustees Of The Leland Stanford Junior University Knottin-drug conjugates and methods of using the same
WO2018044234A1 (en) * 2016-08-31 2018-03-08 Nanyang Technological University Cysteine-rich polypeptides and conjugates and methods of using the same
US10350266B2 (en) 2017-01-10 2019-07-16 Nodus Therapeutics, Inc. Method of treating cancer with a multiple integrin binding Fc fusion protein
US10603358B2 (en) 2017-01-10 2020-03-31 Nodus Therapeutics Combination tumor treatment with an integrin-binding-Fc fusion protein and immune stimulator
US11548923B2 (en) 2017-01-18 2023-01-10 Fred Hutchinson Cancer Center Peptide compositions and methods of use thereof for disrupting TEAD interactions
US11013814B2 (en) 2017-03-16 2021-05-25 Blaze Bioscience, Inc. Cartilage-homing peptide conjugates and methods of use thereof
US11331393B2 (en) 2017-06-15 2022-05-17 Blaze Bioscience, Inc. Renal-homing peptide conjugates and methods of use thereof
WO2019012014A1 (en) 2017-07-12 2019-01-17 Iontas Limited SODIUM CHANNEL INHIBITORS
US11932673B2 (en) 2017-07-12 2024-03-19 Maxion Therapeutics Limited Sodium channel inhibitors
WO2019023156A1 (en) * 2017-07-24 2019-01-31 Rutgers, The State University Of New Jersey PHOSPHATIDYLSERIN-TARGETING FUSION MOLECULES AND METHODS OF USE
US11352404B2 (en) 2017-07-24 2022-06-07 Rutgers, The State University Of New Jersey Phosphatidylserine targeting fusion molecules and methods for their use
US11866466B2 (en) 2017-12-19 2024-01-09 Blaze Bioscience, Inc. Tumor homing and cell penetrating peptide-immuno-oncology agent complexes and methods of use thereof
US11235032B2 (en) 2019-01-23 2022-02-01 Massachusetts Institute Of Technology Combination immunotherapy dosing regimen for immune checkpoint blockade
EP3962511A4 (en) * 2019-04-29 2023-01-18 The Board of Trustees of the Leland Stanford Junior University METHODS OF OCULAR TREATMENT USING A GENETICALLY MODIFIED HEPATOCYTE GROWTH FACTOR DIMERIC FRAGMENT
WO2022114946A1 (es) * 2020-11-27 2022-06-02 Centro De Investigación Científica Y De Educación Superior De Ensenada, Baja California (Cicese) Proteína andamio para la generación de proteínas quiméricas de unión a antígeno

Also Published As

Publication number Publication date
JP6535361B2 (ja) 2019-06-26
CA2817197C (en) 2020-08-04
CA2817197A1 (en) 2012-05-18
EP2638173B1 (en) 2019-06-19
EP3604549A1 (en) 2020-02-05
AU2016210712A1 (en) 2016-09-08
EP2638173A1 (en) 2013-09-18
US11498952B2 (en) 2022-11-15
US20230227523A1 (en) 2023-07-20
JP6170435B2 (ja) 2017-07-26
US10844106B2 (en) 2020-11-24
DK2638173T3 (da) 2019-09-30
AU2016210712B2 (en) 2017-10-26
US12240882B2 (en) 2025-03-04
AU2018200587A1 (en) 2018-02-15
JP2017160222A (ja) 2017-09-14
US20140073518A1 (en) 2014-03-13
US20210206824A1 (en) 2021-07-08
AU2011326164B2 (en) 2016-05-05
JP2014504270A (ja) 2014-02-20
AU2018200587B2 (en) 2019-12-12
AU2011326164A1 (en) 2013-05-30
EP2638173A4 (en) 2014-03-26

Similar Documents

Publication Publication Date Title
US12240882B2 (en) Fusion proteins comprising an engineered knottin peptide and uses thereof
US7691366B2 (en) Chimeric CMP-Ang1 molecule
EA022983B1 (ru) Белки на основе структурного домена фибронектина, связывающие pcsk9
KR102717638B1 (ko) 뉴레귤린-4 화합물 및 사용 방법
TW201107471A (en) Polypeptides selective for αvβ3 integrin conjugated with a variant of human serum albumin (HSA) and pharmaceutical uses thereof
WO2010014830A2 (en) Peptide therapeutics that bind vegf and methods of use thereof
AU2011347327A1 (en) uPAR-antagonists and uses thereof
KR101263424B1 (ko) 세포투과성 엔도스타틴 재조합 단백질, 이를 코딩하는 폴리뉴클레오티드 및 이를 유효성분으로 함유하는 항암 조성물
EP2162463B1 (en) Vegf-d mutants and their use
WO2018109771A1 (en) Fusion proteins for treatment of cancer
CA2481253A1 (en) Vegf peptides and their use
Lohmeyer et al. Characterization of chimeric proteins constructed from human epidermal growth factor (EGF) and the Drosophila EGF-receptor antagonist argos
Kramer Epidermal growth factor signalling studied by EGF/TGF-a chimeric proteins: rational design for the development of EGF-receptor antagonists

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11839687

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2013537908

Country of ref document: JP

Kind code of ref document: A

Ref document number: 2817197

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2011326164

Country of ref document: AU

Date of ref document: 20111107

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2011839687

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 13883216

Country of ref document: US