WO2012049215A1 - Antimicrobial protein - Google Patents
Antimicrobial protein Download PDFInfo
- Publication number
- WO2012049215A1 WO2012049215A1 PCT/EP2011/067824 EP2011067824W WO2012049215A1 WO 2012049215 A1 WO2012049215 A1 WO 2012049215A1 EP 2011067824 W EP2011067824 W EP 2011067824W WO 2012049215 A1 WO2012049215 A1 WO 2012049215A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- blad
- composition
- human
- animal
- microorganism
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N37/00—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids
- A01N37/44—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids containing at least one carboxylic group or a thio analogue, or a derivative thereof, and a nitrogen atom attached to the same carbon skeleton by a single or double bond, this nitrogen atom not being a member of a derivative or of a thio analogue of a carboxylic group, e.g. amino-carboxylic acids
- A01N37/46—N-acyl derivatives
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N47/00—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom not being member of a ring and having no bond to a carbon or hydrogen atom, e.g. derivatives of carbonic acid
- A01N47/40—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom not being member of a ring and having no bond to a carbon or hydrogen atom, e.g. derivatives of carbonic acid the carbon atom having a double or triple bond to nitrogen, e.g. cyanates, cyanamides
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23B—PRESERVATION OF FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES; CHEMICAL RIPENING OF FRUIT OR VEGETABLES
- A23B2/00—Preservation of foods or foodstuffs, in general
- A23B2/70—Preservation of foods or foodstuffs, in general by treatment with chemicals
- A23B2/725—Preservation of foods or foodstuffs, in general by treatment with chemicals in the form of liquids or solids
- A23B2/729—Organic compounds; Microorganisms; Enzymes
- A23B2/7295—Antibiotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/168—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61L—METHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
- A61L2/00—Disinfection or sterilisation of materials or objects, in general; Accessories therefor
- A61L2/16—Disinfection or sterilisation of materials or objects, in general; Accessories therefor using chemical substances
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61L—METHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
- A61L2/00—Disinfection or sterilisation of materials or objects, in general; Accessories therefor
- A61L2/16—Disinfection or sterilisation of materials or objects, in general; Accessories therefor using chemical substances
- A61L2/18—Liquid substances
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K36/00—Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
- A61K36/18—Magnoliophyta (angiosperms)
- A61K36/185—Magnoliopsida (dicotyledons)
- A61K36/48—Fabaceae or Leguminosae (Pea or Legume family); Caesalpiniaceae; Mimosaceae; Papilionaceae
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61L—METHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
- A61L2103/00—Materials or objects being the target of disinfection or sterilisation
- A61L2103/05—Living organisms or biological materials
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61L—METHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
- A61L2103/00—Materials or objects being the target of disinfection or sterilisation
- A61L2103/15—Laboratory, medical or dentistry appliances, e.g. catheters or sharps
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the invention relates to the field of antimicrobial agents, and especially those that target human/animal pathogens.
- Bacteria are, by far, the most common aetiological agents of human infection. More than one-third of the world population is likely infected by bacterial pathogens, and two million fatalities occur per year from bacterial infections. According to the Centre for Disease Control (CDC) and the World Health Organization (WHO), the following bacterial infections are included in the list of the most common infectious diseases throughout the world today:
- Cholera this is a disease spread mostly through contaminated drinking water and unsanitary conditions. It is endemic in the Indian subcontinent, Russia, and sub-Saharan Africa. It is an acute infection of the intestine with the bacterium Vibrio cholerae. The main symptom is copious diarrhoea. Between 5% and 10% of those infected with the disease will develop severe symptoms, which include vomiting and leg cramps. In its severe form, cholera can cause death by dehydration. An estimated 200,000 cases are reported to the WHO annually. Meningitis: often known as spinal meningitis, this is an infection of the spinal cord. It is usually the result of a viral or bacterial infection.
- Bacterial meningitis is more severe than viral meningitis and may cause brain damage, hearing loss, and learning disabilities. It may be caused by, for example, Haemophilus influenzae type b, Neisseria meningitidis, or Streptococcus pneumoniae. An estimated 1.2 million cases of bacterial meningitis occur every year, over a tenth of which are fatal. Symptoms include severe headache, fever, nausea, vomiting, lethargy, delirium, photophobia, and a stiff neck.
- Pneumonia this has many possible causes, but it is usually an infection of Streptococcus or Mycoplasma bacteria. These bacteria can live in the human body without causing infection for years, and only surface when another illness has lowered the immunity to disease. Streptococcus pneumoniae causes streptococcal pneumonia, the most common kind, which is more severe than mycoplasmal pneumonia. S. pneumoniae is responsible for more than 100,000 hospitalizations for pneumonia annually, as well as 6 million cases of otitis media and over 60,000 cases of invasive diseases such as meningitis.
- Shigellosis this infection causes an estimated 600,000 deaths worldwide every year. It is most common in developing countries with poor sanitation. Shigella bacteria cause bacillary dysentery, or shigellosis. Symptoms include diarrhea with bloody stool, vomiting, and abdominal cramps.
- Strep Throat this is caused by Streptococcus bacteria.
- Streptococcus bacteria Several million cases of strep throat occur every year. Symptoms include a sore throat, fever, headache, fatigue, and nausea. Tuberculosis: this causes nearly 2 million deaths every year, and WHO estimates that nearly 1 billion people will be infected between 2000 and 2020 if more effective preventive procedures are not adopted.
- the TB bacteria e.g. Mycobacterium tuberculosis
- Other symptoms include fatigue, weight loss, appetite loss, chills, fever, and night sweats.
- Typhoid fever is caused by the bacterium Salmonella typhi, and causes an estimated 600,000 deaths annually, out of 12-17 million cases. It is usually spread through infected food or water. Symptoms include a sudden and sustained fever, severe headache, nausea, severe appetite loss, constipation, and sometimes diarrhoea. Accurate caseload numbers are, however, difficult to determine, especially because so many of these diseases are endemic to developing countries, where many people do not have access to modern medical care. Approximately half of all deaths caused by infectious diseases each year can be attributed to just three diseases: tuberculosis, malaria, and AIDS. Together, these diseases cause over 300 million illnesses and more than 5 million deaths each year.
- streptomycin can cause kidney damage and deafness and chloramphenicol may cause serious side effects (e.g. serious blood disorders, including anemia and leukemia).
- Methicillin was hailed as a major breakthrough in the fight against bacterial resistance to penicillin, but, unfortunately, that was not the case, and there are now bacteria that are resistant to methicillin.
- Ampicillin is also a derivative of penicillin. It was developed to broaden the range of infections that penicillin could treat and has now replaced penicillin to a great extent. It is often the first choice in the treatment of a whole range of infections, including respiratory and urinary tract infections.
- Amoxicillin is another widely used penicillin derivative. Like ampicillin, it has a broad range of activities. Gentamicin is in the same family of antibiotics as streptomycin (the anti-TB drug discovered in 1943). It is generally reserved for serious infections, as it can have severe toxic side effects on the ears and kidneys.
- quinolones also referred to as quinolones
- fluoroquinolones has been developed by pharmaceutical laboratories. In addition to being effective against a broad range of bacteria, these antibiotics can reach a high concentration in the bloodstream when taken orally. This means that many more infections that may once have required a hospital stay may now be treated at home. The fluoroquinolones are only used for patients that are seriously ill and/or when long courses of antibiotics (weeks to months) are required.
- MDR-TB multidrug-resistance tuberculosis
- MRSA methicillin-resistant Staphylococcus aureus
- VRE vancomycin-resistant strains of E. faecium
- VRE vancomycin-resistant strains of E. faecium
- Vancomycin resistance in enterococci is often plasmid mediated and may result from several unique resistance determinants.
- the combination of penicillin and glycopeptide resistance in E. faecium causes infections which cannot be effectively treated. Fortunately, most VRE cause colonization and not infection. When infection does occur, it may not be treatable with antibiotics. Resistance to quinolones can evolve rapidly, even during the course of a treatment.
- IFIs invasive fungal infections
- Candida species are the most frequent causative agents of IFIs with an average mortality rate of 30%.
- Candida albicans is responsible for about 50% of cases of invasive Candida infection, but there has been a steady increase in the relative frequencies of non-albicans species of Candida, namely of Candida glabrata, Candida parapsilosis, Candida tropicalis and Candida krusei.
- Aspergillus species are the most commonly isolated invasive moulds, with a predominance of the species Aspergillus fumigatus. Like Candida infections, invasive aspergillosis is usually associated with critically ill patients, but its mortality rate is much higher, albeit dependent upon the specific individual infection considered: e.g. 85% or more for disseminated or central nervous system disease, and 60% for diffuse pulmonary disease.
- Candida IFIs are also increasing in the nosocomial setting, and a further increment is foreseen as the risk factors of these infections will continue to increase.
- Candida species account for 8 to 10% of all nosocomial IFIs and occur at a rate of 6 to 23 infections for 100,000 persons annually in the USA.
- the major concern with invasive candidiasis is not only its high mortality rate, but also the excessive length of hospital stay for infected patients, from 3 to 10 days, giving an overall estimated cost attributable to candidemia of about 1 billion dollars per year in the USA.
- a study recently published on the Portuguese population showed that there is an incidence of nosocomial fungemia of 2.7 per 1,000 hospital admissions, with a mortality rate of 39.3%.
- amphotericin B This compound targets and binds to sterols in the fungal cell membrane to create ionic pores, resulting in loss of membrane potential and subsequent collapse. Although it remains the broadest-spectrum fungicidal agent available, its high toxicity and requirement for parenteral administration has limited its use.
- the 1990s saw the introductions of lipid formulations of amphotericin B, as well as the triazoles, fluconazole and itraconazole. Triazoles act by affecting the synthesis of ergosterol through the inhibition of CYP-450-dependent lanosterol 14a-demethylase, which interferes with cell growth, eventually leading to cell death. Although these agents exhibited clear advantages over amphotericin B, they were limited by formulation, spectrum of activity and/or development of resistance.
- Echinocandins inhibit the synthesis of P-l,3-D-glucans, leading to destabilization of the fungal cell wall, cell lysis, and cell death. They are active, in vitro, against Candida and Aspergillus species, but not against a wide range of other emergent pathogenic fungi. Even among these new agents, there are still limitations like adverse drug effects
- Candida albicans colonization This yeast exhibits the capacity for biofilm growth, which displays increased intrinsic tolerance to antifungals such as azoles, polyenes and 5- fluorocytosine.
- candidiasis is often associated with indwelling medical devices (e.g., dental implants, catheters, heart valves, vascular bypass grafts, ocular lenses, artificial joints, and central nervous system shunts), which can act as substrates for biofilm growth.
- dental implants e.g., dental implants, catheters, heart valves, vascular bypass grafts, ocular lenses, artificial joints, and central nervous system shunts
- the inventors have surprisingly found that the Blad polypeptide from Lupinus shows potent antimicrobial activity against a large number of diverse bacterial and fungal organisms that are pathogenic to humans or animals.
- the inventors have also found that the Blad polypeptide is non-toxic to animals, therefore making Blad an excellent compound for use as an antimicrobial against human and animal pathogens in a range of settings.
- the inventors provide a composition comprising an antimicrobial polypeptide comprising Blad or an active variant thereof for use in a method of treatment of the human or animal body by therapy or prophylaxis.
- the inventors also provide said composition for use in a method of treating or preventing an infection in or on a subject by a microorganism.
- the composition further comprises a pharmaceutically acceptable carrier or diluent and/or a chelating agent.
- the composition is used in said method wherein the subject has a compromised immune system or is critically ill.
- the inventors also provide the use of a composition comprising an antimicrobial polypeptide comprising Blad or an active variant thereof to kill, or inhibit the growth of, a microorganism that is pathogenic to a human or an animal at a site that is not on or in the human or animal body.
- said composition is used to disinfect, with respect to a human or animal pathogenic microorganism, an article that is to be ingested by, or placed directly on or in, a human or animal, or a surface that is in need thereof, preferably wherein said article is a foodstuff or a medical device or instrument or wherein said surface is located within an environment where:
- composition further comprises a chelating agent.
- the microorganism is a bacterium or a fungus, preferably wherein:
- the bacterium is a pathogenic species from one of the following genera:
- Pseudomonas Listeria, Bacillus, Staphylococcus and Salmonella; or
- the fungus is a pathogenic species from one of the following genera: Candida, Aspergillus, Alternaria, Fusarium, Cryptococcus and Trichosporon, preferably wherein the fungus can cause invasive fungal infection, preferably C. albicans, A. fumigatus or Alternaria alternata.
- the inventors also provide:
- a method of treating a human or animal comprising administering to a subject in need thereof a composition comprising a therapeutically effective amount of an antimicrobial polypeptide comprising Blad or an active variant thereof;
- a method of preventing or treating an infection by a microorganism comprising administering to a subject in need thereof a composition comprising a therapeutically effective amount of an antimicrobial polypeptide comprising Blad or an active variant thereof;
- a method of killing, or inhibiting the growth of, a microorganism that is pathogenic to a human or an animal at a site that is not on or in the human or animal body comprising administering to said site a composition comprising an effective amount of an antimicrobial polypeptide comprising Blad or an active variant thereof.
- Figure 1 shows time-kill curves for Listeria monocytogenes and Pseudomonas aeruginosa
- Figures 2 shows inhibition halos for Staphylococcus aureus, Bacillus subtilis, P.
- Figure 3 A shows a time-kill curve for C. albicans
- Figures 3B and 4 show growth curves for C. albicans
- Figures 5 to 8 collectively show inhibition halos for C. albicans, Cryptococcus neoformans and A. fumigatus;
- Figure 9 shows time-kill curves for L. monocytogenes, P. aeruginosa and C. albicans;
- Figure 10 shows the Lupinus albus ⁇ -conglutin precursor encoding sequence (SEQ ID NO: 1);
- Figure 11 shows the internal fragment of the ⁇ -conglutin precursor encoding sequence that corresponds to Blad (SEQ ID NO: 3).
- Blad banda de Lupinus albus doce
- ⁇ -conglutin the major storage protein present in seeds of the Lupinus genus. It was characterised as a 20 kD polypeptide, composed of 173 amino acid residues, and encoded by an internal fragment (519 nucleotides, deposited in GenBank under the accession number ABB 13526) of the gene encoding the precursor of ⁇ -conglutin from Lupinus (1791 nucleotides, published in GenBank, under the accession number AAS97865).
- Blad terminal sequences When primers encoding Blad terminal sequences are used to amplify a sequence from genomic Lupinus DNA, a -620 bp product is obtained, indicating the presence of an intron in the gene fragment encoding Blad.
- Naturally-occurring Blad is the main component of a 210 kD glycooligomer which accumulates exclusively (following intensive limited proteolysis of ⁇ -conglutin) in the cotyledons of Lupinus species, between days 4 and 12 after the onset of germination. Whilst said oligomer is glycosylated, naturally-occurring Blad is non-glycosylated.
- the Blad-containing glycooligomer is composed of several polypeptides, the major ones exhibiting molecular masses of 14, 17, 20, 32, 36, 48 and 50 kD.
- the 20 kD polypetide, Blad is by far the most abundant polypeptide within the oligomer and appears to be the only one with lectin activity.
- Naturally-occurring Blad constitutes approximately 80% of the total cotyledonary protein in 8-day old plantlets.
- the L. albus ⁇ -conglutin precursor encoding sequence (SEQ ID NO: 1) is given in Figure 10.
- the ⁇ -conglutin parent subunit coding sequence is located at residues 70 to 1668.
- the encoded, 533 amino acid residue ⁇ -conglutin parent subunit (SEQ ID NO: 2) is:
- the internal fragment of the ⁇ -conglutin precursor encoding sequence that corresponds to Blad (SEQ ID NO: 3) is given in Figure 11.
- the Blad polypeptide (SEQ ID NO: 4) is: RRQRNPYHFSSQRFQTLYKNRNGKIRVLERFDQRTNRLENLQNYRIVEFQSKPNT LILPKHSDADYVLVVLNGRATI IVNPDRRQAYNLEYGDALRIPAGS SYILNPD DNQKLRWKLAI PINNPGYFYDFYPSS KDQQSYFSGFSRNTLEA FNTRYEEIQ RIILGNED
- the invention relates to a composition comprising an antimicrobial polypeptide comprising Blad or an active variant thereof.
- composition comprising an antimicrobial polypeptide comprising the polypeptide sequence of SEQ ID NO: 4 or an active variant thereof.
- the composition consists essentially of an antimicrobial polypeptide comprising Blad or an active variant thereof and/or the antimicrobial polypeptide consists essentially of Blad or an active variant thereof.
- the antimicrobial polypeptide comprising (or consisting essentially of) Blad or an active variant thereof may be used in isolated form.
- An active variant of Blad is a variant of Blad that retains the ability to act as an antimicrobial (i.e. has antimicrobial activity - see below for a description of the level of such activity and how to measure it).
- "An active variant of Blad” includes within its scope a fragment of SEQ ID NO: 4.
- a fragment of SEQ ID NO: 4 is selected that is at least 10% of the length of SEQ NO: 4, preferably at least 20%, preferably at least 30%, preferably at least 40%, preferably at least 50%, preferably at least 60%), preferably at least 70%, preferably at least 80%, preferably at least 90% and most preferably at least 95% of the length of SEQ NO: 4.
- Blad or a variant thereof generally has a length of at least 10 amino acid residues, such as at least 20, 25, 30, 40, 50, 60, 80, 100, 120, 140, 160 or 173 amino acid residues.
- An active variant of Blad also includes within its scope a polypeptide sequence that has homology with SEQ ID NO: 4, such as at least 40% identity, preferably at least 60%, preferably at least 70%, preferably at least 80%, preferably at least 85%, preferably at least 90%), preferably at least 95%, preferably at least 97%, and most preferably at least 99% identity, for example over the full sequence or over a region of at least 20, preferably at least 30, preferably at least 40, preferably at least 50, preferably at least 60, preferably at least 80, preferably at least 100, preferably at least 120, preferably at least 140, and most preferably at least 160 or more contiguous amino acid residues.
- Methods of measuring protein homology are well known in the art and it will be understood by those of skill in the art that in the present context, homology is calculated on the basis of amino acid identity (sometimes referred to as "hard homology").
- the homologous active Blad variant typically differs from the polypeptide sequence of SEQ ID NO: 4 by substitution, insertion or deletion, for example from 1, 2, 3, 4, 5 to 8 or more substitutions, deletions or insertions.
- the substitutions are preferably 'conservative', that is to say that an amino acid may be substituted with a similar amino acid, whereby similar amino acids share one of the following groups: aromatic residues (F/H/W/Y), non- polar aliphatic residues (G/A/P/I/L/V), polar-uncharged aliphatics (C/S/T/M/N/Q) and polar-charged aliphatics (D/E/K/R).
- Preferred sub-groups comprise: G/A/P; I/L/V;
- An antimicrobial polypeptide comprising Blad or an active variant thereof may consist of Blad or an active variant thereof with any number of amino acid residues added to the N-terminus and/or the C-terminus provided that the polypeptide retains antimicrobial activity (again, see below for a description of the level of such activity and how to measure it).
- no more than 300 amino acid residues are added to either or both ends of Blad or an active variant thereof, more preferably no more than 200 amino acid residues, preferably no more than 150 amino acid residues, preferably no more than 100 amino acid residues, preferably no more than 80, 60 or 40 amino acid residues, most preferably no more than 20 amino acide residues.
- An antimicrobial polypeptide comprising (or consisting essentially of) Blad or an active variant thereof (as described above) may be utilised in the invention in the form of a purified (e.g. removed from a plant, animal or microbial source) and/or recombinant protein. Production of a recombinant form enables the production of active variants of Blad.
- a suitable source of naturally-occurring Blad is a plant of the Lupinus genus, such as Lupinus albus, preferably a cotyledon of said plant, preferably harvested between about 4 and about 14 days after the onset of germination, more preferably harvested 6 to 12 days after the onset of germination (such as 8 days after the onset of germination).
- Methods are disclosed in the art for a total protein extraction leading to a crude extract comprising Blad, and for a protein purification of such an extract leading to a partially purified extract, e.g. comprising the Blad-containing glycooligomer that comprises Blad.
- RP reverse phase
- An alternative way of obtaining a partially purified extract comprising the glycooligomer that comprises Blad is to utilise the chitin binding activity of Blad.
- the glycooligomer binds in a very strong manner to a chitin column as part of a chitin affinity
- Cotyledons from eight-day old lupin plants were harvested and homogenized in Milli-Q plus water (pH adjusted to 8.0), containing 10 mM CaCl 2 and 10 mM MgCl 2 .
- the homogenate was filtered through cheesecloth and centrifuged at 30,000 g for 1 h at 4 °C.
- the pellet was subsequently suspended in 100 mM Tris-HCl buffer, pH 7.5, containing 10% (w/v) NaCl, 10 mM EDTA and 10 mM EGTA, agitated for 1 h at 4 °C, and centrifuged at 30,000 g for 1 h at 4 °C.
- the pellet obtained was dissolved in 50 mM Tris-HCl buffer, pH 7.5, desalted in PD-10 columns equilibrated in the same buffer and passed through a chitin-affinity chromatography column pre-equilibrated in the same buffer.
- the eluted fractions were immediately neutralized with 2 M Tris and the peak fractions pooled, lyophilized and analyzed by SDS-PAGE.
- chitin column For the preparation of the chitin column, crude chitin was obtained from Sigma and processed as follows: the chitin sample was washed extensively with Milli-Q plus water, followed by 0.05 N HCl. It was then washed with 1% (w/v) sodium carbonate and then with ethanol, until the absorbance of the wash was less than 0.05. Chitin was then packed into a pipette tip and equilibrated with 50 mM Tris-HCl buffer, pH 7.5. Methods of producing recombinant proteins are well known in the art.
- Such methods as applied here will involve inserting the polynucleotide encoding a polypeptide comprising Blad or an active variant thereof into a suitable expression vector - enabling the juxtaposition of said polynucleotide with one or more promoters (e.g. an inducible promoter, such as T71ac) and with other polynucleotides or genes of interest - introducing the expression vector into a suitable cell or organism (e.g. Escherichia coli), expressing the polypeptide in the transformed cell or organism and removing the expressed recombinant polypeptide from that cell or organism.
- promoters e.g. an inducible promoter, such as T71ac
- the expression vector may be constructed such that the polynucleotide additionally encodes, for example, a terminal tag that can assist purification: e.g., a tag of histidine residues for affinity purification.
- a terminal tag that can assist purification: e.g., a tag of histidine residues for affinity purification.
- composition comprising an antimicrobial polypeptide comprising (or consisting essentially of) Blad or an active variant thereof, said polypeptide is preferably in partially purified form, more preferably in purified form.
- Said polypeptide is partially purified when it is present in an environment lacking one or more other polypeptides with which it is naturally associated and/or is represented by at least about 10% of the total protein present.
- Said polypeptide is purified when it is present in an environment lacking all, or most, other polypeptides with which it is naturally associated.
- purified Blad means that Blad represents at least about 50%, at least about 60%>, at least about 70%, at least about 75%, at least about 80%>, at least about 85%>, at least about 90%, at least about 95%), at least about 97%, at least about 98%, or at least about 99% of the total protein in a composition.
- the Lupinus protein content may consist essentially of the Blad-containing glycooligomer that comprises a polypeptide that comprises (or consist essentially of) Blad or an active variant thereof.
- a composition comprising an antimicrobial polypeptide comprising (or consisting essentially of) Blad may also be a formulation comprising another compound(s) added to the composition by the skilled person.
- such a formulation is a pharmaceutical formulation comprising an antimicrobial polypeptide comprising (or consisting essentially of) Blad and a pharmaceutically acceptable carrier or diluent.
- the invention relates to the use of Blad as an antimicrobial compound, i.e. to inhibit the growth of or kill microorganisms that are pathogenic to humans or animals.
- microorganisms include, in particular, bacteria and fungi.
- pathogenic bacteria include, in particular, bacteria and fungi.
- microorganisms are capable of causing infectious disease or any other ill-health (e.g. food poisoning, allergy) in humans and/or animals, and may affect or infect, for example, the eyes, the skin, burns, wounds, the upper respiratory tract, the lungs, the gastrointestinal tract, the genitourinary tract, the kidneys, the liver, the nervous system and/or the cardiovascular system (e.g. the bloodstream).
- infectious disease or any other ill-health e.g. food poisoning, allergy
- Such pathogenic microorganisms may be inherently pathogenic or may be opportunistic (i.e. do not cause disease in a healthy host but can do in a host with a compromised immune system).
- infectious disease or any other ill-health e.g. food poisoning, allergy
- Such pathogenic microorganisms may be inherently pathogenic or may be opportunistic (i.e. do not cause disease in a healthy host but can do in a host with a compromised immune system
- microorganisms may additionally or alternatively cause ill-health by releasing compounds that are toxic to humans or animals.
- Blad can be used as an antimicrobial against both Gram-positive and Gram-negative bacterial pathogens.
- Particularly preferred bacterial targets include pathogenic
- Pseudomonas species such as P. aeruginosa, Pseudomonas oryzihabitans and
- Pseudomonas plecoglossicida (most preferably P. aeruginosa), pathogenic Listeria species, such as L. monocytogenes and Listeria ivanovii (most preferably L.
- pathogenic Bacillus species such as B. subtilis, Bacillus anthracis and Bacillus cereus (most preferably B. subtilis), pathogenic Staphylococcus species, such as S. aureus (including Methicillin-resistant Staphylococcus aureus [MRSA]),
- Staphylococcus pseudintermedius Staphylococcus epidermidis, Staphylococcus saprophyticus, Staphylococcus lugdunensis, Staphylococcus schleiferi and
- Staphylococcus caprae (most preferably S. aureus), pathogenic Salmonella species, such as Salmonella enterica subspecies such as Salmonella arizonae, Salmonella choleraesuis, Salmonella enter itidis, Salmonella paratyphi A, Salmonella paratyphi B, Salmonella typhi, Salmonella typhimurium, Salmonella dublin, Salmonella typhisuis and Salmonella brandenburg (most preferably S. enteritidis or S. typhi) and pathogenic Campylobacter species such as Campylobacter jejuni and Campylobacter coli (most preferably C jejuni).
- Salmonella enterica subspecies such as Salmonella arizonae, Salmonella choleraesuis, Salmonella enter itidis, Salmonella paratyphi A, Salmonella paratyphi B, Salmonella typhi, Salmonella typhimurium, Salmonella dublin, Salmonella typhisuis and Salmonella brandenburg (most preferably
- Blad is used against pathogens that can cause generalised inflammation and sepsis (e.g. P. aeruginosa), Cholera (e.g. V. cholerae), Meningitis (e.g. L. monocytogenes, Haemophilus influenzae type b, Neisseria meningitidis, or
- Streptococcus pneumoniae Pneumonia (e.g. S. pneumoniae, Streptococcus agalactiae or S. aureus), Shigellosis (e.g. Shigella boydii, Shigella dysenteriae, Shigella flexneri or Shigella sonnei), Strep throat (e.g. Streptococcus pyogenes), Tuberculosis (e.g.
- Mycobacterium canetti and Mycobacterium microti), Typhoid (S. typhi), or food poisoning e.g. pathogenic species from one of the following genera: Listeria,
- Candida can be used as an antimicrobial against both unicellular (yeast) and multicellular (filamentous, mold) fungal pathogens.
- Particularly preferred fungal targets include pathogenic Candida species, such as C. albicans, Candida glabrata, Candida lusitaneae, Candida parapsilosis, Candida tropicalis, Candida krusei and Candida dubliniensis, pathogenic Alternaria species, such as A. alternata and Alternaria molesta, pathogenic Aspergillus species, such as A.
- Cryptococcus species such as Cryptococcus neoformans, Cryptococcus laurentii, Cryptococcus albidus and Cryptococcus gattii
- pathogenic Trichosporon species such as Trichosporon ovoides, Trichosporon inkin, Trichosporon asahii, Trichosporon mucoides, Trichosporon asteroides, and Trichosporon cutaneum (all previuosly considered under the general name of Trichosporon beigelii), and Trichosporon dermatis, Trichosporon dohaense and Trichosporon loubieri.
- Blad is used against pathogens that can cause invasive fungal infection (IFI), which is usually defined as a systemic, generalized and visceral fungal infection that is often severe and/or life-threatening (in contrast to superficial, local, benign, self-limiting fungal diseases).
- IFI invasive fungal infection
- Particularly preferred IFI causing fungi include pathogenic Candida, Aspergillus or Alternaria species as defined above, preferably C. albicans, A. fumigatus or A. alternata, most preferably C. albicans or A. fumigatus.
- Blad is used at a concentration of at least 1 ⁇ g/ml, at least 5 ⁇ g/ml, at least 10 ⁇ g/ml, at least 20 ⁇ g/ml, at least 50 ⁇ g/ml, or at least 100 ⁇ g/ml, and up to 500 ⁇ g/ml, up to 600 ⁇ g/ml, up to 1 mg/ml, up to 2.5 mg/ml, up to 5 mg/ml or up to 10 mg/ml.
- the concentration of Blad selected is between 10 ⁇ g/ml and 5 mg/ml, more preferably between 50 ⁇ g/ml and 2.5 mg/ml, more preferably between 100 ⁇ g/ml and 1 mg/ml, and even more preferably between 100 ⁇ g/ml and 600 ⁇ g/ml (such as about 250 ⁇ g/ml).
- the inventors have provided evidence (see Examples 4 and 5) that Blad is non-toxic to the host up to at least 400 ⁇ g/ml.
- a combination of Blad with a chelating agent produces a synergistic antimicrobial effect. Therefore, preferably, a chelating agent is used to improve the antimicrobial activity of a polypeptide comprising (or consisting essentially of) Blad (or an active variant thereof), and the use of such a chelating agent may decrease the concentration of said antimicrobial polypeptide required to achieve a particular level of antimicrobial activity.
- a chelating agent also known as a chelant, a chelator or a sequestering agent
- Suitable chelating agents include polyamino carboxylates such as EDTA (ethyl enediaminetetraacetic acid) and EGTA (ethyleneglycol bis(P-aminoethyl ethe ⁇ -N ⁇ A ⁇ /V-tetraacetic acid).
- EDTA is used as the chelating agent, preferably at a concentration of at least 10 ⁇ g/ml, at least 50 ⁇ g/ml, or at least 100 ⁇ g/ml, and up to 500 ⁇ g/ml, up to 1 mg/ml, up to 5 mg/ml, up to 10 mg/ml, or up to 20 mg/ml.
- EDTA is used at a concentration of between 0.1 mg/ml and 1 mg/ml.
- the antimicrobial polypeptide comprising (or consisting essentially of) Blad may be used to inhibit the growth of a human/animal pathogenic microorganism (meaning that it has microbistatic activity) and/or to kill said
- the antimicrobial polypeptide when used as a microbistatic agent, reduces the rate of growth by 10%, more preferably by 50%, more preferably by 75%, more preferably by 90%, more preferably by 95%, more preferably by 98%, more preferably by 99%), and even more preferably by 99.9% in comparison to equivalent conditions where the antimicrobial polypeptide is not present. Most preferably the antimicrobial polypeptide prevents any growth of the microorganism.
- the antimicrobial polypeptide kills 10% of the population of the microorganisms, more preferably 50% of said population, more preferably 75% of said population, more preferably 90% of said population, more preferably 95% of said population, more preferably 98% of said population, more preferably 99% of said population, and even more preferably by 99.9% of said population in comparison to equivalent conditions where the antimicrobial polypeptide is not present. Most preferably the antimicrobial polypeptide kills all of the population of the microorganisms, more preferably 50% of said population, more preferably 75% of said population, more preferably 90% of said population, more preferably 95% of said population, more preferably 98% of said population, more preferably 99% of said population, and even more preferably by 99.9% of said population in comparison to equivalent conditions where the antimicrobial polypeptide is not present. Most preferably the antimicrobial polypeptide kills all of the population of the
- the antimicrobial polypeptide When used to prevent or treat an infection in or on a human or animal the antimicrobial polypeptide is preferably used in a therapeutically effective amount, that is to say an amount that provides a level of growth inhibition and/or killing of a microorganism such that a clinically detectable level of infection prevention or abrogation is achieved.
- the therapeutically effective amount of the antimicrobial polypeptide is nontoxic to the human or animal subject. It is intended that said therapeutically effective amount of the antimicrobial polypeptide is therapeutically effective when administered as part of a composition comprising the antimicrobial polypeptide.
- Blad is approximately as potent as amphotericin B and more potent than fluconazole against C. albicans and A. fumigatus (in terms of fungicidal and fungistatic activity). This is a striking result given (i) the much greater molecular mass of Blad in comparison to the relatively small organic molecules of amphotericin B and fluconazole and (ii) the nontoxic and edible nature of Blad to humans and other animals.
- the inventors provide a composition comprising an antimicrobial polypeptide comprising Blad or an active variant thereof for use in a method of treatment of the human or animal body by therapy or prophylaxis. To this end they also provide a method of treating a human or animal comprising administering to a subject in need thereof a composition comprising a therapeutically effective amount of an antimicrobial polypeptide comprising Blad or an active variant thereof. The inventors also provide a composition comprising an antimicrobial polypeptide comprising Blad or an active variant thereof for use in a method of preventing or treating an infection in or on a human or animal subject by a microorganism. To this end they also provide:
- a method of preventing or treating an infection by a microorganism comprising administering to a subject in need thereof a composition comprising a therapeutically effective amount of an antimicrobial polypeptide comprising Blad or an active variant thereof;
- composition comprising an antimicrobial polypeptide comprising Blad or an active variant thereof in the manufacture of a medicament for preventing or treating an infection in or on a human or animal subject by a microorganism.
- Said composition may be administered by injection (such as intradermal, subcutaneous, intramuscular, intravenous, intraosseous, and intraperitoneal), transdermal particle delivery, inhalation, topically, orally or transmucosally (such as nasal, sublingual, vaginal or rectal).
- said composition comprises a pharmaceutically acceptable carrier or diluent.
- a pharmaceutical composition may be formulated as a conventional pharmaceutical preparation. This can be done using standard pharmaceutical formulation chemistries and methodologies, which are available to those skilled in the art. For example, an
- antimicrobial polypeptide comprising Blad can be combined with one or more pharmaceutically acceptable carriers or diluents to provide a liquid preparation.
- pharmaceutically acceptable carriers include, but are not limited to, liquids such as water, saline, polyethyleneglycol, hyaluronic acid, glycerol and ethanol.
- compositions comprising a polypeptide like Blad.
- suitable carriers that also act as stabilizers for polypeptides include, without limitation, pharmaceutical grades of dextrose, sucrose, lactose, trehalose, mannitol, sorbitol, inositol, dextran, and the like.
- compositions can be delivered to a subject in vivo using a variety of known routes and techniques.
- the liquid preparations can be provided as an injectable solution, suspension or emulsion and administered via parenteral,
- Liquid preparations can also be administered topically to the eyes, to skin, hair or mucosal tissue (e.g. nasal, sublingual, vaginal or rectal), or provided as a finely divided spray suitable for respiratory or pulmonary administration.
- Other modes of administration include oral administration, suppositories, and active or passive transdermal delivery techniques.
- the antimicrobial polypeptide is formulated into a composition suitable as a topical lotion, hand-cream, eye-drop solution, shampoo or conditioner.
- the subject in need of the antimicrobial polypeptide may be any human or animal individual.
- the antimicrobial polypeptide may be used to prevent infection in subjects at particular risk of acquiring an infection by a
- microorganism and/or to treat infection in subjects at particular risk of being unable to clear a microbial infection without medical intervention such as the young (such as an individual below the age of 16 years, such as an individual below the age of 5 years, 3 years, 2 years, 1 year, 6 months or 1 month), the elderly (such as an individual above the age of 70 years, such as an individual above the age of 80 years or 90 years), those with a compromised immune system (such as those with a primary immunodeficiency, those with an acquired immunodeficiency (e.g.
- the inventors also provide the use of a composition comprising an antimicrobial polypeptide comprising Blad or an active variant thereof to kill, or inhibit the growth of, a microorganism that is pathogenic to a human or an animal at a site that is not on or in the human or animal body.
- a method of killing or inhibiting the growth of a microorganism that is pathogenic to a human or an animal at a site that is not on or in the human or animal body comprising administering to said site a composition comprising an effective amount of an antimicrobial polypeptide comprising Blad or an active variant thereof.
- Said effective amount is an amount that provides a level of growth inhibition and/or killing of a microorganism such that a detectable level of prevention or abrogation of microbial colonisation is achieved.
- the effective amount of the antimicrobial polypeptide is non-toxic to the human or animal subject. It is intended that said effective amount of the antimicrobial polypeptide is effective when administered as part of a composition comprising the antimicrobial polypeptide.
- the antimicrobial polypeptide is used as a disinfectant to prevent the growth of and/or kill a pathogenic microorganism on an article that is to be ingested by, or placed directly on or in, a human or animal, or a surface that is in need thereof (e.g. a surface that may, directly or indirectly, come into contact with a human or animal) so that the risk is of:
- the antimicrobial polypeptide is used within or on a foodstuff to prevent the growth of a human/animal pathogenic microorganism on or within that foodstuff or to kill a human/animal pathogenic microorganism already present on or within that foodstuff. In this way the antimicrobial polypeptide can be used to reduce the risk of a human or animal becoming infected with a pathogenic microorganism, or of a human or animal ingesting a toxin released by a pathogenic microorganism, as a result of ingesting that foodstuff.
- said pathogenic microorganism is capable of causing food poisoning (e.g. directly or via a released toxin).
- foodstuff it is intended to mean any liquid or solid substance intended for consumption for nutritional or pleasurable reasons.
- the composition comprising the antimicrobial polypeptide can for example be mixed with other components of the foodstuff during the preparation for the foodstuff or may for example be applied to the surface of the foodstuff (for example as a liquid film or a spray).
- Particular foodstuffs considered in these embodiments include water, soft drinks such as fruit juices, alcoholic drinks, raw meat, cooked poultry meat, eggs, milk, cream, ice-cream, cheese, raw vegetables and fruits, processed foods (particularly relevant to e.g. L.
- V. cholerae monocytogenes
- pathogenic Staphylococcus species pathogenic Salmonella species and pathogenic Campylobacter species
- nuts and starchy foods such as bread, rice and potatoes (particularly relevant for pathogenic Aspergillus species).
- the antimicrobial polypeptide is used within or on a medical device or instrument - any device placed on or within the body to carry out a diagnostic, therapeutic or surgical function - such as artificial body tissue, pacemakers, stents, scaffolds, valves, thermometers, syringes, hypodermic needles, monitoring equipment, ventilators, cardiac defibrillators, heart lung machines, EEG and ECG units, ultrasound devices, drills, saws, knives, scalpels, tongues, scissors, clips and stitches and the like.
- a diagnostic, therapeutic or surgical function such as artificial body tissue, pacemakers, stents, scaffolds, valves, thermometers, syringes, hypodermic needles, monitoring equipment, ventilators, cardiac defibrillators, heart lung machines, EEG and ECG units, ultrasound devices, drills, saws, knives, scalpels, tongues, scissors, clips and stitches and the like.
- the antimicrobial polypeptide is used on a surface that is in need thereof (e.g. a surface that may, directly or indirectly, come into contact with a human or animal).
- a surface that is in need thereof e.g. a surface that may, directly or indirectly, come into contact with a human or animal.
- the surface to which the antimicrobial polypeptide may be applied may be located within an environment where:
- Examples of such surfaces include any within an industrial food factory and
- the surface to which the antimicrobial polypeptide may be applied may be a floor or wall of a building (or a room thereof) or a surface of an article within said room or building.
- Particular buildings envisaged include hospitals and other healthcare buildings, schools and other child-care centres, elderly care buildings, restaurants and other eateries, places of food preparation, processing and/or storage (e.g. markets, foodstores, supermarkets, and industrial food factories), and private dwellings.
- Particular rooms envisaged include all of those within a healthcare setting, especially operating theatres, accident and emergency departments, intensive care and patient wards, as well as kitchens, bathrooms, toilets, restaurants and food preparation/processing halls.
- BLAD denotes the naturally-occurring Blad-containing glycooligomer comprising the 20 kD Blad polypeptide, purified as per Ramos et al.
- MIC - Minimum Inhibitory Concentration the lowest concentration of an antimicrobial that inhibits the visible growth of a microorganism.
- MFC MBC Minimum Fungi cidal/Bactericidal Concentration (or Minimal Lethal Concentration): the lowest concentration of an antimicrobial agent needed to kill 99.9% of the initial inoculum after 24 h under a standardized set of conditions.
- Time-kill curves - Determination of the "killing" of an isolate over time by one or more antimicrobial agents under controlled conditions is known as the time-kill method. It is a broth based method where the rate of killing of a fixed inoculum is determined by sampling control (organism, no drug) and antimicrobial agent- containing tubes or flasks, at certain time intervals, and determining the survivor colony count (cfu/ml) by spreading each sample onto an agar plate.
- Example 1 Bactericidal activity of BLAD.
- Against J. monocytogenes and 5 . aeruginosa BLAD is bacteriostatic at 100 ⁇ g/ml and bactericidal at 250 ⁇ g/ml.
- Example 2 Fungicidal activity of BLAD. MIC and MFC of BLAD for Candida species (using RPMI medium)
- Candida tropicalis 4 4-16 MIC and MFC of BLAD for various filamentous fungi using RPMI medium
- Against C. albicans BLAD is fungistatic at 10 ⁇ g/ml and fungicidal at 100 ⁇ g/ml.
- C. albicans BLAD and amphotericin B are fungistatic at 10 ⁇ g/ml. At 100 ⁇ g/ml fluconazole merely delays growth.
- Time-kill curves for BLAD and/or EDTA with (A) Listeria monocytogenes, (B) Pseudomonas aeruginosa and (C) Candida albicans: see Figure 9.
- L. monocytogenes neither BLAD at 10 ⁇ g/ml nor EDTA at 0.1 mg/ml inhibits growth but a combination of the two is bacteriostatic.
- P. aeruginosa BLAD at 50 ⁇ g/ml or EDTA at 1 mg/ml inhibits growth (i.e. both are bacteriostatic) but a combination of the two is bactericidal.
- C. albicans BLAD at 10 ⁇ g/ml or EDTA at 0.1 mg/ml inhibits growth (i.e. both are fungistatic) but a combination of the two is fungicidal.
- Example 4 Dermal toxicity study of BLAD in guinea pigs. Confidential study carried out at the Faculty of Veterinary Medicine, Technical University of Lisbon, on behalf of Instituto Superior de Agronomia (July 18, 2006 - August 1, 2006) using OECD Guideline for testing of chemicals, No. 402, Acute Dermal Toxicity. The study was conducted in accordance with good laboratory practice and animal welfare. The acute dermal toxicity of BLAD was evaluated after single dose exposure in guinea pigs, which are widely accepted as suitable animals for dermal toxicity studies. BLAD was applied to the glabrous skin in two groups of 10 animals each, with dosing at 200 ⁇ g/ml and 400 ⁇ g/ml respectively. After exposure the animals were kept under observation for a period of 15 days, during which body mass, morbidity and mortality were recorded.
- Test item BLAD was supplied at 5 mg/ml (yellowish opaque liquid, 0-4 °C) and stored at -80 °C.
- Lodging the animals were individually placed in polyethylene boxes with sterilized wood shavings (Lignocel).
- Photoperiod cycles of light/dark for 12 h in 12 h.
- Controlled environment an average temperature of 19/22 °C and average humidity of 60%.
- mice were shaved 48 h before the test and only animals that had lesion-free skin were taken forward in the study. An aliquot of 1 ml (at either 200 ⁇ g/ml or 400 ⁇ g/ml) was applied to the shaved skin of each animal.
- Study design the 30 animals of the study were divided into four groups, two groups of ten animals each and two groups with five animals each.
- a group of ten animals was exposed to BLAD at 200 ⁇ g/ml (test group 1) and another group of ten animals was exposed to BLAD at 400 ⁇ g/ml (test group 2).
- the two groups of five animals served as controls: one group was exposed to water (1 ml aliquot) whilst another group was not subjected to any administration but handled as per all the other groups.
- BLAD acute oral toxicity of BLAD was evaluated after single dose exposure in rats, which are widely accepted as suitable animals for oral toxicity studies.
- BLAD was administered by gavage in two groups of 10 animals each, with dosing at 200 ⁇ g/ml and 400 ⁇ g/ml respectively. After exposure the animals were kept under observation for a period of 15 days, during which body mass, morbidity and mortality were recorded. After the observation period the animals were euthanized and underwent necropsy. Materials and Methods - 1. Materials
- Test item BLAD was supplied at 5 mg/ml (yellowish opaque liquid, 0-4 °C) and stored at -80 °C.
- Lodging the animals were individually placed in polyethylene boxes with sterilized wood shavings (Lignocel).
- Controlled environment an average temperature of 19/22 °C and average humidity of
- administration was carried out with a metal probe appropriate to the species of animal used. The animals were subjected to fasting for 18 h prior to administration and fed 3 h following administration.
- Study design the 30 animals of the study were divided into four groups, two groups of ten animals each and two groups with five animals each.
- a group of ten animals was exposed to BLAD at 200 ⁇ g/ml (test group 1) and another group of ten animals was exposed to BLAD at 400 ⁇ g/ml (test group 2).
- the two groups of five animals served as controls: one group was exposed to water (1 ml aliquot) whilst another group was not subjected to any administration but handled as per all the other groups.
- Necropsy/macroscopic observation of the organs of the thoracic and abdominal cavity revealed no changes thereto.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Botany (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Agronomy & Crop Science (AREA)
- Pest Control & Pesticides (AREA)
- Environmental Sciences (AREA)
- Dentistry (AREA)
- Plant Pathology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Immunology (AREA)
- Polymers & Plastics (AREA)
- Food Science & Technology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Infusion, Injection, And Reservoir Apparatuses (AREA)
- Surgical Instruments (AREA)
Priority Applications (23)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/879,151 US10421792B2 (en) | 2010-10-12 | 2011-10-12 | Antimicrobial protein |
| EP11769866.2A EP2627201B1 (en) | 2010-10-12 | 2011-10-12 | Antimicrobial protein |
| MX2013004047A MX344183B (es) | 2010-10-12 | 2011-10-12 | Proteina antimicrobiana. |
| CN201180049655.2A CN103228160B (zh) | 2010-10-12 | 2011-10-12 | 抗菌蛋白 |
| CA2814428A CA2814428C (en) | 2010-10-12 | 2011-10-12 | Antimicrobial protein |
| SG2013027677A SG189379A1 (en) | 2010-10-12 | 2011-10-12 | Antimicrobial protein |
| BR112013008772-2A BR112013008772A2 (pt) | 2010-10-12 | 2011-10-12 | proteína antimicrobiana |
| JP2013533203A JP5934225B2 (ja) | 2010-10-12 | 2011-10-12 | 抗微生物タンパク質 |
| DK11769866.2T DK2627201T3 (en) | 2010-10-12 | 2011-10-12 | Antimicrobial protein |
| NO11769866A NO2627201T3 (https=) | 2010-10-12 | 2011-10-12 | |
| PL11769866T PL2627201T3 (pl) | 2010-10-12 | 2011-10-12 | Kompozycja zawierająca polipeptyd przeciwdrobnoustrojowy |
| PH1/2013/500692A PH12013500692A1 (en) | 2010-10-12 | 2011-10-12 | Antimicrobial protein |
| NZ610400A NZ610400A (en) | 2010-10-12 | 2011-10-12 | Antimicrobial protein |
| ES11769866.2T ES2658086T3 (es) | 2010-10-12 | 2011-10-12 | Proteína antimicrobiana |
| EA201390487A EA034221B1 (ru) | 2010-10-12 | 2011-10-12 | Композиция на основе полипептида blad, обладающая фунгицидным и бактерицидным действием, и ее применение |
| AU2011315525A AU2011315525B2 (en) | 2010-10-12 | 2011-10-12 | Antimicrobial protein |
| CN201910628294.5A CN110227145B (zh) | 2010-10-12 | 2011-10-12 | 抗菌蛋白 |
| HUE11769866A HUE036578T2 (hu) | 2010-10-12 | 2011-10-12 | Antimikrobiális fehérje |
| UAA201305362A UA113151C2 (xx) | 2010-10-12 | 2011-12-10 | Застосування композиції, що містить антимікробний поліпептид, у виробництві лікарського засобу |
| IL225495A IL225495B (en) | 2010-10-12 | 2013-04-02 | Antimicrobial protein |
| CY20181100271T CY1120003T1 (el) | 2010-10-12 | 2018-03-05 | Αντιμικροβιακη πρωτεϊνη |
| US16/274,271 US11161885B2 (en) | 2010-10-12 | 2019-02-13 | Antimicrobial protein |
| US17/485,346 US20220048959A1 (en) | 2010-10-12 | 2021-09-25 | Antimicrobial protein |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PT105330 | 2010-10-12 | ||
| PT10533010A PT105330A (pt) | 2010-10-12 | 2010-10-12 | Proteína antimicrobiana |
| GB1017284.9A GB2484509A (en) | 2010-10-13 | 2010-10-13 | Lupin beta-conglutin derived protein fragment Blad as an antimicrobial agent |
| GB1017284.9 | 2010-10-13 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/879,151 A-371-Of-International US10421792B2 (en) | 2010-10-12 | 2011-10-12 | Antimicrobial protein |
| US16/274,271 Continuation US11161885B2 (en) | 2010-10-12 | 2019-02-13 | Antimicrobial protein |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2012049215A1 true WO2012049215A1 (en) | 2012-04-19 |
Family
ID=44800036
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2011/067824 Ceased WO2012049215A1 (en) | 2010-10-12 | 2011-10-12 | Antimicrobial protein |
Country Status (25)
| Country | Link |
|---|---|
| US (3) | US10421792B2 (https=) |
| EP (1) | EP2627201B1 (https=) |
| JP (1) | JP5934225B2 (https=) |
| CN (2) | CN110227145B (https=) |
| AU (1) | AU2011315525B2 (https=) |
| BR (1) | BR112013008772A2 (https=) |
| CA (1) | CA2814428C (https=) |
| CL (1) | CL2013000991A1 (https=) |
| CO (1) | CO6761349A2 (https=) |
| CY (1) | CY1120003T1 (https=) |
| DK (1) | DK2627201T3 (https=) |
| EA (1) | EA034221B1 (https=) |
| ES (1) | ES2658086T3 (https=) |
| HU (1) | HUE036578T2 (https=) |
| IL (1) | IL225495B (https=) |
| MX (1) | MX344183B (https=) |
| NO (1) | NO2627201T3 (https=) |
| NZ (1) | NZ610400A (https=) |
| PE (1) | PE20140589A1 (https=) |
| PH (1) | PH12013500692A1 (https=) |
| PL (1) | PL2627201T3 (https=) |
| PT (1) | PT2627201T (https=) |
| SG (1) | SG189379A1 (https=) |
| UA (1) | UA113151C2 (https=) |
| WO (1) | WO2012049215A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2018060528A3 (en) * | 2016-09-30 | 2018-07-05 | Instituto Superior De Agronomia | Therapeutic protein |
| EP4154714A2 (en) | 2013-10-03 | 2023-03-29 | Syngenta Participations Ag | Fungicidal compositions |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PT105332A (pt) * | 2010-10-12 | 2012-04-12 | Cev Biotecnologia Das Plantas S A | Agentes para utilização com antimicrobianos |
| AU2011315525B2 (en) * | 2010-10-12 | 2016-05-12 | Consumo Em Verde - Biotecnologia Das Plantas, S.A. | Antimicrobial protein |
| CN108633921A (zh) * | 2018-04-19 | 2018-10-12 | 张友兰 | 含有β-羽扇豆球蛋白多肽和啶菌噁唑的杀菌组合物 |
| CN112724257B (zh) * | 2019-10-14 | 2023-09-19 | 江西缘生生物科技有限公司 | 具有强杀菌效果的杂合抗菌蛋白及其应用 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004071521A1 (en) * | 2003-02-11 | 2004-08-26 | Indena S.P.A. | The use of lupin conglutin for the treatment of type ii diabetes |
| WO2006003110A1 (en) * | 2004-06-29 | 2006-01-12 | Fraunhofer-Gesellschaft Zur Foerderung Der Angewandten Forschung E.V. | Process for the purification of protein fractions from lupin seeds, active on lipid metabolism |
| US7067624B2 (en) * | 1996-12-20 | 2006-06-27 | Commonwealth Scientific And Industrial Research Organisation | Antimicrobial proteins |
| WO2007010459A2 (en) * | 2005-07-21 | 2007-01-25 | Instituto Superior De Agronomia | Protein extracted from plants of the genus lupinus or produced in recombinant form, nucleotide sequence encoding it and its use in animal nutrition, as a plant growth promoter and in the fight against pathogenic fungi |
| FR2921836A1 (fr) * | 2007-10-05 | 2009-04-10 | Limousine D Applic Biolog Dite | Utilisation d'un principe actif combinant des principes actifs issus de medicago sativa et de lupinus albus pour lutter contre les poches sous les yeux |
Family Cites Families (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1993011783A1 (en) * | 1991-12-09 | 1993-06-24 | Magainin Pharmaceuticals Inc. | Composition and treatment with biologically active peptides and chelating agents |
| FR2762512B1 (fr) | 1997-04-24 | 2000-10-13 | Pharmascience Lab | Compositions a base d'huile de lupin, notamment a base d'huile de lupin et d'huile de germe de ble et leur utilisation en cosmetologie, en pharmacie et en tant que complement alimentaire |
| FR2792202B1 (fr) | 1999-04-19 | 2003-06-13 | Pharmascience Lab | Extrait peptidique de lupin et composition pharmaceutique ou cosmetique ou nutraceutique comprenant un tel extrait |
| JP3757268B2 (ja) * | 2001-08-22 | 2006-03-22 | 独立行政法人農業・生物系特定産業技術研究機構 | ペプチドとキレート剤を含む殺菌性組成物 |
| SE0102864D0 (sv) * | 2001-08-29 | 2001-08-29 | Svenska Miljoebolaget Svv Ab | Antimicrorobial agent |
| US20040138176A1 (en) * | 2002-05-31 | 2004-07-15 | Cjb Industries, Inc. | Adjuvant for pesticides |
| JP2004131500A (ja) | 2002-09-19 | 2004-04-30 | Fancl Corp | 皮膚老化防止剤又は改善剤 |
| EA200500804A1 (ru) * | 2002-12-10 | 2005-12-29 | Биосинексус Инкорпорейтед | Топические противоинфекционные композиции |
| US20070259087A1 (en) * | 2003-06-11 | 2007-11-08 | Novozymes A/S | Antimicrobial Peptides |
| FR2865647B1 (fr) | 2004-02-02 | 2006-04-07 | Silab Sa | Activites d'un principe actif obtenu a partir de poudre de semences d'alfalfa (medicago sativa), principe actif utilise et peocede d'obtention |
| FR2868703B1 (fr) | 2004-04-08 | 2008-06-13 | Expanscience Sa Lab | Extrait total de lupin constitue d'un extrait de sucres de lupin et d'un extrait peptidique de lupin, procede d'obtention et utilisation |
| US20070258996A1 (en) | 2005-12-23 | 2007-11-08 | The Sterilex Corporation | Antimicrobial compositions |
| WO2007122421A2 (en) | 2006-04-13 | 2007-11-01 | The Boots Company Plc | Composition and uses thereof |
| JP2008099635A (ja) * | 2006-10-20 | 2008-05-01 | Nissan Chem Ind Ltd | 新規抗菌タンパク質、その製造方法およびその用途 |
| US7790188B2 (en) * | 2006-12-27 | 2010-09-07 | Food Industry Research And Development Institute | Antifungal protein and usage thereof |
| JP5071940B2 (ja) * | 2008-12-25 | 2012-11-14 | 独立行政法人産業技術総合研究所 | 抗真菌剤 |
| PT105331A (pt) * | 2010-10-12 | 2012-04-12 | Cev Biotecnologia Das Plantas S A | Conservante alimentar |
| PT105332A (pt) * | 2010-10-12 | 2012-04-12 | Cev Biotecnologia Das Plantas S A | Agentes para utilização com antimicrobianos |
| AU2011315525B2 (en) * | 2010-10-12 | 2016-05-12 | Consumo Em Verde - Biotecnologia Das Plantas, S.A. | Antimicrobial protein |
| JP5564023B2 (ja) * | 2011-09-08 | 2014-07-30 | 株式会社東芝 | 不揮発性記憶装置の製造方法 |
-
2011
- 2011-10-12 AU AU2011315525A patent/AU2011315525B2/en active Active
- 2011-10-12 EP EP11769866.2A patent/EP2627201B1/en active Active
- 2011-10-12 MX MX2013004047A patent/MX344183B/es active IP Right Grant
- 2011-10-12 CN CN201910628294.5A patent/CN110227145B/zh active Active
- 2011-10-12 NO NO11769866A patent/NO2627201T3/no unknown
- 2011-10-12 WO PCT/EP2011/067824 patent/WO2012049215A1/en not_active Ceased
- 2011-10-12 PE PE2013000853A patent/PE20140589A1/es not_active Application Discontinuation
- 2011-10-12 CN CN201180049655.2A patent/CN103228160B/zh active Active
- 2011-10-12 PT PT117698662T patent/PT2627201T/pt unknown
- 2011-10-12 US US13/879,151 patent/US10421792B2/en active Active - Reinstated
- 2011-10-12 JP JP2013533203A patent/JP5934225B2/ja active Active
- 2011-10-12 CA CA2814428A patent/CA2814428C/en active Active
- 2011-10-12 PL PL11769866T patent/PL2627201T3/pl unknown
- 2011-10-12 PH PH1/2013/500692A patent/PH12013500692A1/en unknown
- 2011-10-12 SG SG2013027677A patent/SG189379A1/en unknown
- 2011-10-12 NZ NZ610400A patent/NZ610400A/en unknown
- 2011-10-12 BR BR112013008772-2A patent/BR112013008772A2/pt not_active Application Discontinuation
- 2011-10-12 ES ES11769866.2T patent/ES2658086T3/es active Active
- 2011-10-12 DK DK11769866.2T patent/DK2627201T3/en active
- 2011-10-12 HU HUE11769866A patent/HUE036578T2/hu unknown
- 2011-10-12 EA EA201390487A patent/EA034221B1/ru not_active IP Right Cessation
- 2011-12-10 UA UAA201305362A patent/UA113151C2/uk unknown
-
2013
- 2013-04-02 IL IL225495A patent/IL225495B/en active IP Right Grant
- 2013-04-11 CL CL2013000991A patent/CL2013000991A1/es unknown
- 2013-05-10 CO CO13117694A patent/CO6761349A2/es unknown
-
2018
- 2018-03-05 CY CY20181100271T patent/CY1120003T1/el unknown
-
2019
- 2019-02-13 US US16/274,271 patent/US11161885B2/en active Active
-
2021
- 2021-09-25 US US17/485,346 patent/US20220048959A1/en active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7067624B2 (en) * | 1996-12-20 | 2006-06-27 | Commonwealth Scientific And Industrial Research Organisation | Antimicrobial proteins |
| WO2004071521A1 (en) * | 2003-02-11 | 2004-08-26 | Indena S.P.A. | The use of lupin conglutin for the treatment of type ii diabetes |
| WO2006003110A1 (en) * | 2004-06-29 | 2006-01-12 | Fraunhofer-Gesellschaft Zur Foerderung Der Angewandten Forschung E.V. | Process for the purification of protein fractions from lupin seeds, active on lipid metabolism |
| WO2007010459A2 (en) * | 2005-07-21 | 2007-01-25 | Instituto Superior De Agronomia | Protein extracted from plants of the genus lupinus or produced in recombinant form, nucleotide sequence encoding it and its use in animal nutrition, as a plant growth promoter and in the fight against pathogenic fungi |
| FR2921836A1 (fr) * | 2007-10-05 | 2009-04-10 | Limousine D Applic Biolog Dite | Utilisation d'un principe actif combinant des principes actifs issus de medicago sativa et de lupinus albus pour lutter contre les poches sous les yeux |
Non-Patent Citations (6)
| Title |
|---|
| M.D.L. OLIVEIRA ET AL: "Purification of a lectin from Eugenia uniflora L. seeds and its potential antibacterial activity", LETTERS IN APPLIED MICROBIOLOGY, vol. 46, no. 3, 1 March 2008 (2008-03-01), pages 371 - 376, XP055014526, ISSN: 0266-8254, DOI: 10.1111/j.1472-765X.2007.02319.x * |
| MONTEIRO ET AL., PLOS ONE, vol. 5, no. 1, 2010, pages E8542 |
| RAMOS ET AL., PLANTA, vol. 203, no. 1, 1997, pages 26 - 34 |
| RIBEIRO, ANA CRISTINA FERREIRA DA CONCEIÇÃO: "Thesis: Análise molecular de lectinas em sementes de leguminosas", 2009, XP002666464, Retrieved from the Internet <URL:http://repositorio.ul.pt/handle/10451/257> [retrieved on 20111229] * |
| ROBIN WAIT ET AL: "Analysis of Lupinus albus Storage Proteins by Two-Dimensional Electrophoresis and Mass Spectrometry", JOURNAL OF AGRICULTURAL AND FOOD CHEMISTRY, vol. 53, no. 11, 1 June 2005 (2005-06-01), pages 4599 - 4606, XP055015516, ISSN: 0021-8561, DOI: 10.1021/jf050021i * |
| WOLDEMICHAEL G M ET AL: "Triterpene glycosides of Lupinus angustifolius", PHYTOCHEMISTRY, PERGAMON PRESS, GB, vol. 60, no. 4, 1 June 2002 (2002-06-01), pages 323 - 327, XP004354728, ISSN: 0031-9422, DOI: 10.1016/S0031-9422(02)00112-7 * |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4154714A2 (en) | 2013-10-03 | 2023-03-29 | Syngenta Participations Ag | Fungicidal compositions |
| WO2018060528A3 (en) * | 2016-09-30 | 2018-07-05 | Instituto Superior De Agronomia | Therapeutic protein |
| CN110214017A (zh) * | 2016-09-30 | 2019-09-06 | 农学高等教育学院 | 治疗性蛋白质 |
| AU2017334047B2 (en) * | 2016-09-30 | 2025-01-23 | Instituto Superior De Agronomia | Therapeutic protein |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11161885B2 (en) | Antimicrobial protein | |
| Didehdar et al. | Cinnamomum: the new therapeutic agents for inhibition of bacterial and fungal biofilm-associated infection | |
| JP6672441B2 (ja) | 新規なバチルス・ベレゼンシスcjbv及びそれを含む抗菌組成物 | |
| CN109640977B (zh) | 大麻二酚组合物及其用途 | |
| US11214594B2 (en) | Antimicrobial peptide having synergistic antibacterial effect with antibiotics on multidrug resistant bacteria, and use thereof | |
| KR101899552B1 (ko) | 전복에서 유래한 항균 펩타이드 유사체 및 이를 포함하는 항균용 약학 조성물 | |
| EP2627202B1 (en) | Use of a composition comprising an antimicrobial peptide as a food preservative | |
| KR102224929B1 (ko) | 해삼에서 분리한 항균 펩타이드로부터 유래한 신규 항균 펩타이드 및 이의 용도 | |
| Fernandes et al. | Candida auris, a singular emergent pathogenic yeast: its resistance and new therapeutic alternatives | |
| WO2012049217A1 (en) | Use of chelating agent and peptide antimicrobial compounds | |
| CN107735083A (zh) | 抗菌组合物 | |
| JP2000154109A (ja) | 天然物由来殺菌剤 | |
| GB2484509A (en) | Lupin beta-conglutin derived protein fragment Blad as an antimicrobial agent | |
| NL2024839B1 (en) | Antimicrobial peptide for treatment and controlling skin disorders relating to microbial infection | |
| KR20220141946A (ko) | 태평양굴에서 유래한 항균 펩타이드 및 이의 용도 | |
| EP3845237A2 (en) | Use of recombinant antibacterial protein ablysin for effectively killing multidrug-resistant pathogenic bacteria | |
| KR102275801B1 (ko) | 시스-자스몬을 포함하는 바이오필름 형성 억제용 조성물 | |
| Al-Janabi et al. | Detection of antimicrobial activity of solanum melogena L.(Egg plant) against pathogenic microorganisms | |
| PT105330A (pt) | Proteína antimicrobiana | |
| CN101123974A (zh) | 银离子化的植物提取液及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11769866 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2013533203 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 225495 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2814428 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013000991 Country of ref document: CL Ref document number: MX/A/2013/004047 Country of ref document: MX Ref document number: 12013500692 Country of ref document: PH |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 000853-2013 Country of ref document: PE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201390487 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011769866 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13117694 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A201305362 Country of ref document: UA |
|
| ENP | Entry into the national phase |
Ref document number: 2011315525 Country of ref document: AU Date of ref document: 20111012 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112013008772 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13879151 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 112013008772 Country of ref document: BR Kind code of ref document: A2 Effective date: 20130410 |