WO2011161244A1 - Homodimeric protein constructs - Google Patents

Homodimeric protein constructs Download PDF

Info

Publication number
WO2011161244A1
WO2011161244A1 PCT/EP2011/060628 EP2011060628W WO2011161244A1 WO 2011161244 A1 WO2011161244 A1 WO 2011161244A1 EP 2011060628 W EP2011060628 W EP 2011060628W WO 2011161244 A1 WO2011161244 A1 WO 2011161244A1
Authority
WO
WIPO (PCT)
Prior art keywords
homodimeric protein
protein according
cancer
unit
antigenic
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2011/060628
Other languages
English (en)
French (fr)
Inventor
Pier Adelchi Ruffini
Bjarne Bogen
Agnete Brunsvik Fredriksen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Nykode Therapeutics ASA
Original Assignee
Vaccibody AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to DK11727190.8T priority Critical patent/DK2585107T3/en
Priority to KR1020137002177A priority patent/KR20130087517A/ko
Priority to EP11727190.8A priority patent/EP2585107B1/en
Priority to CA2803058A priority patent/CA2803058C/en
Priority to US13/805,709 priority patent/US10590195B2/en
Priority to EP18195357.1A priority patent/EP3441085A1/en
Priority to BR112012032922-7A priority patent/BR112012032922B1/pt
Priority to CN201180031589.6A priority patent/CN102985109B/zh
Priority to ES11727190T priority patent/ES2706058T3/es
Application filed by Vaccibody AS filed Critical Vaccibody AS
Priority to AU2011268934A priority patent/AU2011268934B2/en
Priority to KR1020187024633A priority patent/KR102044948B1/ko
Priority to JP2013515914A priority patent/JP2013532971A/ja
Priority to RU2013103335A priority patent/RU2624041C2/ru
Publication of WO2011161244A1 publication Critical patent/WO2011161244A1/en
Anticipated expiration legal-status Critical
Priority to US16/784,778 priority patent/US11479605B2/en
Priority to US17/934,348 priority patent/US12516116B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001154Enzymes
    • A61K39/001157Telomerase or TERT [telomerase reverse transcriptase]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/00119Melanoma antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001193Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
    • A61K39/001194Prostate specific antigen [PSA]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/145Orthomyxoviridae, e.g. influenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • A61P31/06Antibacterial agents for tuberculosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • A61P31/22Antivirals for DNA viruses for herpes viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4748Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/44Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6056Antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/42Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a HA(hemagglutinin)-tag
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • C12N2760/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • the present invention relates to novel recombinant fusion proteins, such as human antibody- based molecules called Vaccibodies, which are able to trigger both a T cell- and B cell immune response.
  • the present invention also relates to a method of treating a cancer or an infectious disease e.g. multiple myeloma or influenza by means of these specific fusion proteins.
  • DNA vaccination is a technically simple way of inducing immune responses. However, success in small animals has not yet been reproduced in clinical trials. Several strategies are currently being pursued to increase efficacy of DNA vaccines.
  • Targeting of protein antigens to antigen-presenting cells can improve T- and B-cell responses.
  • Recombinant immunoglobulin (Ig) molecules are well suited for this purpose.
  • short antigenic epitopes can replace loops between ⁇ -strands in the Ig constant domains while targeted antigen delivery is obtained by equipping the recombinant Ig with variable (V) regions specific for surface molecules on APC.
  • V variable regions specific for surface molecules on APC.
  • V variable
  • recombinant Ig molecules with short T cell epitopes fail to elicit antibodies against conformational epitopes.
  • targeted Ig-based homodimeric DNA vaccines have been generated that express infectious or tumor antigens with a size of at least 550 aa. with maintenance of conformational epitopes.
  • Chemokine (C-C motif) ligand 3 is a protein that in humans is encoded by the CCL3 gene.
  • CCL3 also known as Macrophage inflammatory protein-la (MIP-la)
  • MIP-la Macrophage inflammatory protein-la
  • mouse CCL3 is a single copy gene encoding for a mature chemokine of 69 amino acids
  • the human homolog has been duplicated and mutated to generate two non-allelic variants, LD78a (CCL3) and ⁇ _ ⁇ 78 ⁇ (CCL3-L1), both showing a 74% homology with the mouse CCL3.
  • WO 2004/076489 relates to recombinant human antibody-based molecule called Vaccibodies, which are able to trigger both a T cell- and B cell immune response.
  • US20070298051 relates to the use of MIP-1-alpha for enhancing the immune response to an immunogen in a mammal.
  • EP920522 relates to a polynucleotide vector vaccine comprising a cDNA target product that comprises a nucleotide sequence encoding a cytokine or chemokine.
  • Fredriksen AB and Bogen B (Blood 2007;110: 1797-805) relates to mouse chemokine- idiotype fusion DNA vaccines.
  • fusion proteins which are able to trigger an efficient immune response for even weak antigens, such as idiotypic antigens derived from e.g. myeloma cells.
  • polynucleotides such as a DNA polynucleotide, encoding a fusion protein that trigger an efficient immune response against even weak antigens, such as idiotypic antigens derived from e.g. myeloma cells.
  • These polynucleotides may be used as an immunostimulating composition or vaccine against a cancer or an infectious disease, characterized by a disease specific or disease associated antigen.
  • human chemokine ⁇ _ ⁇ 78 ⁇ both full length and truncated versions thereof, are suited for use as targeting units that target antigenic epitopes to the surface of APC.
  • the chemokine, or its truncated version are bound to chemokine receptors on the surface of APC in the form of a homodimeric protein construct, which facilitate that two identical chemokines are bound to provide more efficient targeting and signalling.
  • the homodimeric construct further provide that two identical antigenic epitopes are delivered to the APC which in turn present them to T cells. Even with the relatively large size of the homodimeric protein constructs, cells are able to produce and export intact molecules.
  • the present invention relates to a homodimeric protein of two identical amino acid chains, each amino acid chain comprising a targeting unit comprising an amino acid sequence having at least 80 % sequence identity to the amino acid sequence 5-70 of SEQ ID NO: l, and an antigenic unit, the targeting unit and the antigenic unit being connected through a dimerization motif.
  • the present invention relates to a homodimeric protein of two identical amino acid chains, each amino acid chain comprising a targeting unit comprising amino acids 3-70 of SEQ ID NO: l, and an antigenic unit, the targeting unit and the antigenic unit being connected through a dimerization motif.
  • the present invention relates to a nucleic acid molecule encoding the monomeric protein which can form a homodimeric protein according to the invention.
  • the present invention relates to a homodimeric protein according to the invention; for use as a medicament.
  • the present invention relates to a nucleic acid molecule encoding the monomeric protein which can form a homodimeric protein according to the invention; for use as a medicament.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a homodimeric protein according to the invention.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a nucleic acid molecule encoding the monomeric protein which can form a homodimeric protein according to the invention.
  • the present invention relates to a host cell comprising a nucleic acid molecule encoding the monomeric protein which can form a homodimeric protein according to the invention.
  • the present invention relates to a method for preparing a homodimeric protein according to the invention, the method comprising a) transfecting the nucleic acid molecule according to the invention into a cell population;
  • the present invention relates to a vaccine against a cancer or an infectious disease comprising an immunologically effective amount of a homodimeric protein according to the invention or nucleic acid molecule encoding the monomeric protein which can form the homodimeric protein according to the invention, wherein said vaccine is able to trigger both a T-cell- and B-cell immune response and wherein said homodimeric protein contain an antigenic unit related to said cancer or infectious disease.
  • the present invention relates to an immunomodulating or
  • immunostimulating composition against a cancer or an infectious disease comprising an immunologically effective amount of a homodimeric protein according to the invention or nucleic acid molecule encoding the monomeric protein which can form the homodimeric protein according to the invention, wherein said immunomodulating or immunostimulating composition is able to trigger both a T-cell- and B-cell immune response and wherein said homodimeric protein contain an antigenic unit related to said cancer or infectious disease.
  • the present invention relates to a method of treating a cancer or an infectious disease in a patient, the method comprising administering to the patient in need thereof, a homodimeric protein according to the invention, or the nucleic acid molecule encoding the monomeric protein which can form the homodimeric protein according to the invention, wherein said homodimeric protein contain an antigenic unit related to said cancer or infectious disease.
  • FIG. 1 Fusion vaccines used in this study.
  • A Schematic structure of a homodimeric chemokine-antigen fusion protein (vaccibody). Targeting, dimerization and antigenic units are indicated as are moieties expressed in the various units. In all constructs, the dimerization unit and hinge are derived from human IgG3.
  • a G 3 S 2 G 3 SG linker connects hinge exons hl+h4 to the CH3 domain.
  • a GLSGL linker connects CH3 and the antigenic unit, whereas a (G 4 S) 3 linker connects V H and V L in the antigenic unit.
  • B NH2 terminal sequences (aa.
  • C11S human CCL3 isoforms, and their point mutated control (C11S, indicated in bold). Slash indicates deletion .
  • C11S point mutation putatively destroys a S-S bridge in the chemokine structure (right) .
  • FIG. 1 Characterization of LD78 -expressing vaccibodies by ELISA and Western blot.
  • scFv 315 encoding vaccibodies with indicated targeting units were evaluated by binding to DNP-BSA coat (binds scFv 315 ) and detection with biotinylated H P6017 (binds CH3 dimerization motif) .
  • CKCK-encoding vaccibodies were evaluated by binding to 187.1 mAb (binds mouse CK) coat and detection with biotinylated 187.1 mAb
  • C HA- encoding vaccibodies, with indicated targeting units, were evaluated by binding to MCA878-G (anti -CH3 dimerization motif) and detection with biotinylated anti -HA mAb H36-4-52
  • D Western blot of vaccibodies probed with biotinylated H P6017 under non-reducing conditions. Left to right, (LD78 Fv 315 )2, (LD78 Cl lSFv 315 )2 and (LD78 -2Fv 315 )2.
  • FIG. 3 ⁇ 78 ⁇ vaccibody proteins bind chemokine receptors on human cells.
  • the indicated homodimeric vaccibody proteins at 25 ⁇ g/mL were admixed with H EK 293 cells stably transfected with either human CCR5 (A, B), or human CCRl (C, D) .
  • Bound vaccibody proteins were detected by biotinylated Ab2.1-4 mAb specific for the scFv 315 antigenic unit, followed by PE-streptavidin .
  • Bold lines (LD78 Fv 315 )2 (A, C) and (LD78 -2Fv 315 )2 (B, D) vaccibodies.
  • Dashed line in (A) (LD78 (Cl lS) Fv 315 )2.
  • Shaded histogram biotinylated Ab2.1-4 mAb and PE-streptavidin alone.
  • FIG. 4 ⁇ 78 ⁇ vaccibody proteins bind mouse chemokine receptors and induce chemotaxis of murine cells.
  • (LD78 Fv 315 )2 vaccibody (open histogram), but not the C11S variant (shaded histogram), binds to CD l lb+ BALB/c splenocytes (A) and displays chemotactic activity on lymphocytic Esb/MP cells (B) .
  • Vaccibody with ⁇ 78 ⁇ targeting unit efficiently delivers antigen to mouse (A) and human (B) APC for M HC class II-restricted presentation to CD4+ T cells.
  • A Different amounts of purified vaccibodies having scFv 315 as antigenic unit were admixed with irradiated (8 gy) BALB/c splenocytes, followed by addition of Id (A2 315 )-specific Th2 T cells from TCR transgenic mice. After 48 hrs cultures were pulsed with 3H thymidine for 24 hrs.
  • B Different amounts of mouse CK-containing vaccibody supernatants (expressed as molar concentration (M) of CKCK) from transiently transfected 293E cells were admixed with DR4*01 PBMCs which were then irradiated and admixed with mouse CK-specific T18 T cells.
  • mice per group Mean of up to 7 mice per group is shown, p values refer to ⁇ _ ⁇ 78 ⁇ vs ⁇ _ ⁇ 78 ⁇ (C11S) (*), and to ⁇ _ ⁇ 78 ⁇ vs (FvNIP)2 vaccibody (**) at week 4.
  • ⁇ _ ⁇ 78 ⁇ vaccibodies binds to rhesus macaque CCR5. Vaccibody proteins at 25 ⁇ g/mL were admixed with HEK 293 stably transfected with Rhesus macaque CCR5. Bound vaccibody proteins were detected by biotinylated Ab2.1-4 mAb specific for the scFv 315 antigenic unit followed by PE-streptavidin.
  • Bold line indicates vaccibodies (LD78 Fv 315 )2 in (A) and (LD78 -2Fv 315 )2 in (B). Dashed line in (A) indicates (LD78 (CllS)Fv 315 )2 vaccibody. In both A and B shaded histograms indicate biotinylated Ab2.1-4 mAb and PE-streptavidin alone.
  • FIG. 9 Protection against a lethal challenge with influenza.
  • Efficacy of DNA vaccines needs to be increased.
  • a promising strategy in mice is to construct DNA encoding a fusion protein that target antigen to antigen-presenting cells (APC) via chemokine receptors. It is crucial to extend this strategy for improved DNA vaccines to large animals and humans.
  • human MIP- ⁇ chemokines may be fused with different antigenic units.
  • the fusion proteins retain functional activity and conformational correctness of targeting and antigenic units, respectively. Fusion proteins may improve responses of cloned human CD4+ T cells.
  • ⁇ _ ⁇ 78 ⁇ fusion proteins binds mouse chemokine receptors, human DNA vaccines can be tested in mice.
  • ⁇ _ ⁇ 78 ⁇ DNA fusion vaccines according to the present invention induced improved T cell and antibody responses in mice following plasmid injection and skin electroporation. CD8+ T cell responses are particularly enhanced, indicating efficient cross-priming.
  • a two amino acid NH 2 -truncated version of ⁇ _ ⁇ 78 ⁇ is by the present inventors proved to have superior binding to mouse cells compared to the full length ⁇ _ ⁇ 78 ⁇ in vitro. Surprisingly the full length version of LD78 ⁇ have showed superior effect in an in vivo mouse model.
  • LD78 ⁇ -vaccine proteins was found by the inventors of the present invention to bind Rhesus macaque CCR5, setting the stage for targeted DNA immunization in non human primates.
  • Vaccibodies according to the present invention may be recombinant Ig-based homodimeric vaccines, each chain being composed of a targeting unit directly attached to Ig hinge and CH3, the combination of which induces covalent homodimerization (Fig. 1A).
  • mouse CCL3 is a single copy gene encoding for a mature chemokine of 69 aa.
  • the human homolog has been duplicated and mutated to generate two non-allelic variants, LD78a (CCL3) and ⁇ _ ⁇ 78 ⁇ (CCL3-L1), both showing a 74% homology with the mouse CCL3.
  • the two variants share a 96% homology, the differences being S or P at position 2 and a swap between G and S at positions 39 and 47 .
  • human CCL3 variants and different antigenic units may be constructed and expressed as functional proteins.
  • the present invention relates to the utilization of ⁇ _ ⁇ 78 ⁇ and its natural isoforms in fusion vaccines to target antigen delivery to antigen-presenting cells.
  • the vaccibodies according to the present invention aims at improving the immunogenicity of vaccines (immunostimulating compositions). Included within the present invention are DNA vaccines encoding a fusion protein that targets antigen delivery to ⁇ _ ⁇ 78 ⁇ receptors on professional antigen-presenting cells.
  • Vaccibodies equipped with ⁇ _ ⁇ 78 ⁇ or NH 2 -truncated versions hereof were by the inventors of the present invention found to bind cells expressing murine or Rhesus macaque or human CCR1 and/or CCR5 (receptors for ⁇ _ ⁇ 78 ⁇ ) in vitro and afforded augmented antigen delivery in vitro as well as increased humoral and cellular immune responses in vivo following DNA injection and electroporation, as compared with control, non-targeted vaccibodies.
  • the recombinant proteins according to the present invention may be human antibody-like molecules useful in the treatment of many types of cancer or infectious diseases, including multiple myeloma. These molecules, also referred to as Vaccibodies, bind APC and are able to trigger both T cell and B cell immune response. Moreover, Vaccibodies bind divalently to APC to promote a more efficient induction of a strong immune response. Vaccibodies comprise a dimer of a monomeric unit that consists of a targeting unit with specificity for a surface molecule on APC, connected through a dimerization motif, such as a hinge region and a Cy3 domain, to an antigenic unit, the later being in the COOH-terminal or NH 2 -terminal end.
  • the present invention also relates to a DNA sequence coding for this recombinant protein, to expression vectors comprising these DNA sequences, cell lines comprising said expression vectors, to treatment of mammals preferentially by immunization by means of Vaccibody DNA, Vaccibody RNA, or Vaccibody protein, and finally to pharmaceuticals and a kit comprising the said molecules.
  • the dimerization motif in the proteins according to the present invention may be constructed to include a hinge region and an immunoglobulin domain (e.g. Cy3 domain), e.g.
  • the hinge region may be Ig derived and contributes to the dimerization through the formation of an interchain covalent bond(s), e.g. disulfide bridge(s). In addition, it functions as a flexible spacer between the domains allowing the two targeting units to bind simultaneously to two target molecules on APC expressed with variable distances.
  • the immunoglobulin domains contribute to homodimerization through noncovalent interactions, e.g. hydrophobic interactions.
  • the C H 3 domain is derived from IgG.
  • These dimerization motifs may be exchanged with other multimerization moieties (e.g. from other Ig isotypes/subclasses).
  • the dimerization motif is derived from native human proteins, such as human IgG.
  • the dimerization motif may have any orientation with respect to antigenic unit and targeting unit.
  • the antigenic unit is in the COOH- terminal end of the dimerization motif with the targeting unit in the N-terminal end of the dimerization motif.
  • the antigenic unit is in the N-terminal end of the dimerization motif with the targeting unit in the COOH-terminal end of the dimerization motif.
  • the proteins according to the present invention may be suitable for induction of an immune response against any polypeptide of any origin.
  • Any antigenic sequence of sufficient length that include a specific epitope may be used as the antigenic unit in the proteins according to the invention.
  • the minimal length of such antigenic unit may be around 9 amino acids.
  • the antigenic unit comprises an amino acid sequence of at least 9 amino acids corresponding to at least about 27 nucleotides in a nucleic acids sequence encoding such antigenic unit.
  • an antigenic sequence may be derived from cancer proteins or infectious agents. Examples of such cancer sequences are telomerase, more specifically hTERT, tyrosinase, TRP-1/ TRP-2 melanoma antigen, prostate specific antigen and idiotypes.
  • the infectious agents can be of bacterial, e.g. tuberculosis antigens and OMP31 from brucellosis, or viral origin, more specifically HIV derived sequences like e.g. gpl20 derived sequences, glycoprotein D from HSV-2, and influenza virus antigens like
  • the antigenic unit may be antibodies or fragments thereof, such as the C-terminal scFv derived from the monoclonal Ig produced by myeloma or lymphoma cells, also called the myeloma/lymphoma M component in patients with B cell lymphoma or multiple myeloma.
  • scFv represents idiotypic antigen.
  • the antigenic unit of the protein according to the present invention is the scFv of the myeloma protein M315 derived from the BALB/c plasmacytoma MOPC315.4.
  • the ⁇ 2 315 light chain of M315 harbors three defined somatic mutations in the CDR3 loop and functions as a model idiotypic T cell epitope in a well defined system (Bogen, Malissen et al. 1986; Bogen and Lambris 1989).
  • the targeting unit of the proteins according to the invention targets the protein to APC through binding to chemokine receptors.
  • the proteins according to the present invention may be genetically assembled, and the DNA transfected into a suitable host cell, such as NSO cells, 293E cells, CHO cells or COS-7 cells. Transfectants produce and secrete the recombinant proteins.
  • the present invention relates to a pharmaceutical comprising the above described
  • this pharmaceutical additionally comprises a pharmaceutically compatible carrier.
  • Suitable carriers and the formulation of such pharmaceuticals are known to a person skilled in the art. Suitable carriers are e.g phosphate-buffered common salt solutions, water, emulsions, e.g. oil/water emulsions, wetting agents, sterile solutions etc.
  • the pharmaceuticals may be administered orally or parenterally.
  • the methods of parenteral administration comprise the topical, intra-arterial, intramuscular, subcutaneous, intramedullary, intrathekal, intraventricular, intravenous, intraperitoneal or intranasal administration.
  • the suitable dose is determined by the attending physician and depends on different factors, e.g. the patient's age, sex and weight, the kind of administration etc.
  • the present invention relates to a vaccine composition or immunostimulating compositions against cancer or infectious diseases comprising an immunologically effective amount of the nucleic acid encoding the molecule of the invention or degenerate variants thereof, wherein said composition is able to trigger both a T-cell- and B-cell immune response.
  • the present invention also relates to a kit comprising Vaccibody DNA, RNA, or protein for diagnostic, medical or scientific purposes.
  • the invention further relates to a method of preparing the recombinant molecule of the invention comprising, transfecting the vector comprising the molecule of the invention into a cell population; culturing the cell population; collecting recombinant protein expressed from the cell population; and purifying the expressed protein.
  • the above described nucleotide sequences may preferably be inserted into a vector suited for gene therapy, e.g. under the control of a specific promoter, and introduced into the cells.
  • the vector comprising said DNA sequence is a virus, e.g an adenovirus, vaccinia virus or an adeno-associated virus.
  • Retroviruses are particularly preferred. Examples of suitable retroviruses are e.g. MoMuLV or HaMuSV.
  • the DNA/RNA sequences according to the invention can also be transported to the target cells in the form of colloidal dispersions. They comprise e.g. liposomes or lipoplexes.
  • the present invention also encompasses the use of polypeptides or domains or motifs within the polypeptides having a degree of sequence identity or sequence homology with amino acid sequence(s) defined herein or with a polypeptide having the specific properties defined herein.
  • the present invention encompasses, in particular, peptides having a degree of sequence identity with SEQ ID NO: 1, or homologues thereof.
  • the term "homologue” means an entity having sequence identity with the subject amino acid sequences or the subject nucleotide sequences, where the subject amino acid sequence preferably is SEQ ID NO: 1.
  • the homologous amino acid sequence and/or nucleotide sequence should provide and/or encode a polypeptide which retains the functional activity and/or enhances the activity of a polypeptide of SEQ ID NO: 1.
  • a homologous sequence is taken to include an amino acid sequence which may be at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%, identical to the subject sequence.
  • the homologues will comprise the same active sites etc. as the subject amino acid sequence.
  • homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity.
  • Sequence identity comparisons can be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs use complex comparison algorithms to align two or more sequences that best reflect the evolutionary events that might have led to the difference(s) between the two or more sequences. Therefore, these algorithms operate with a scoring system rewarding alignment of identical or similar amino acids and penalising the insertion of gaps, gap extensions and alignment of non-similar amino acids.
  • the scoring system of the comparison algorithms include: i) assignment of a penalty score each time a gap is inserted (gap penalty score), ii) assignment of a penalty score each time an existing gap is extended with an extra position (extension penalty score), iii) assignment of high scores upon alignment of identical amino acids, and iv) assignment of variable scores upon alignment of non-identical amino acids.
  • the scores given for alignment of non-identical amino acids are assigned according to a scoring matrix also called a substitution matrix.
  • the scores provided in such substitution matrices are reflecting the fact that the likelihood of one amino acid being substituted with another during evolution varies and depends on the physical/chemical nature of the amino acid to be substituted. For example, the likelihood of a polar amino acid being substituted with another polar amino acid is higher compared to being substituted with a hydrophobic amino acid. Therefore, the scoring matrix will assign the highest score for identical amino acids, lower score for non-identical but similar amino acids and even lower score for non- identical non-similar amino acids.
  • the most frequently used scoring matrices are the PAM matrices (Dayhoff et al. (1978), Jones et al.
  • Suitable computer programs for carrying out such an alignment include, but are not limited to, Vector NTI (Invitrogen Corp.) and the ClustalV, ClustalW and ClustalW2 programs (Higgins DG & Sharp PM (1988), Higgins et al. (1992), Thompson et al . (1994), Larkin et al . (2007) .
  • a selection of different alignment tools is available from the ExPASy Proteomics server at vvvvw.expasy.org .
  • Another example of software that can perform sequence alignment is BLAST (Basic Local Alignment Search Tool), which is available from the webpage of National Center for Biotechnology Information which can currently be found at
  • ClustalW software for performing sequence alignments.
  • alignment with ClustalW is performed with the following parameters for pairwise alignment:
  • ClustalW2 is for example made available on the internet by the European Bioinformatics Institute at the EMBL-EBI webpage www.ebi .ac.uk under tools - sequence analysis - ClustalW2. Currently, the exact address of the ClustalW2 tool is
  • Gap opening penalty 10 Gap extension penalty: 0.05
  • the present invention also encompasses the use of variants, homologues and derivatives of any amino acid sequence of a protein, polypeptide, motif or domain as defined herein, particularly those of SEQ ID NO: 1.
  • sequences may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent substance.
  • Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues as long as the secondary binding activity of the substance is retained.
  • negatively charged amino acids include aspartic acid and glutamic acid; positively charged amino acids include lysine and arginine; and amino acids with uncharged polar head groups having similar hydrophilicity values include leucine, isoleucine, valine, glycine, alanine, asparagine, glutamine, serine, threonine, phenylalanine, and tyrosine.
  • the present invention also encompasses conservative substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue, with an alternative residue) that may occur i.e. like-for-like substitution such as basic for basic, acidic for acidic, polar for polar etc.
  • Non-conservative substitution may also occur i.e. from one class of residue to another or alternatively involving the inclusion of unnatural amino acids such as ornithine (hereinafter referred to as Z), diaminobutyric acid ornithine (hereinafter referred to as B), norleucine ornithine (hereinafter referred to as O),
  • pyriylalanine, thienylalanine, naphthylalanine and phenylglycine Conservative substitutions that may be made are, for example within the groups of basic amino acids (Arginine, Lysine and Histidine), acidic amino acids (glutamic acid and aspartic acid), aliphatic amino acids (Alanine, Valine, Leucine, Isoleucine), polar amino acids
  • Tryptophan and Tyrosine Tryptophan and Tyrosine
  • hydroxyl amino acids Serine, Threonine
  • large amino acids Phenylalanine and Tryptophan
  • small amino acids Glycine, Alanine
  • Replacements may also be made by unnatural amino acids include; alpha* and alpha- disubstituted* amino acids, N-alkyl amino acids*, lactic acid*, halide derivatives of natural amino acids such as trifluorotyrosine*, p-CI-phenylalanine*, p-Br-phenylalanine*, p-I- phenylalanine*, L-allyl-glycine*, ⁇ -alanine*, L-a-amino butyric acid*, L-y-amino butyric acid*, L-a-amino isobutyric acid*, L-e-amino caproic acid*, 7-amino heptanoic acid*, L- methionine sulfone* * , L-norleucine*, L-norvaline*, p-nitro-L-phenylalanine*, L- hydroxyproline*, L-thioproline*, methyl derivatives
  • Variant amino acid sequences may include suitable spacer groups that may be inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or ⁇ -alanine residues.
  • alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or ⁇ -alanine residues.
  • a further form of variation involves the presence of one or more amino acid residues in peptoid form, will be well understood by those skilled in the art.
  • the peptoid form is used to refer to variant amino acid residues wherein the a-carbon substituent group is on the residue's nitrogen atom rather than the a-carbon.
  • Processes for preparing peptides in the peptoid form are known in the art, for example Simon RJ et a/. (1992), Horwell DC. (1995).
  • the variant targeting unit used in the homodimeric protein according to the present invention is variant having the sequence of amino acids 5-70 of SEQ ID NO: l and having at least at least 65%, at least 70%, at least 75%, at least 78%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% amino acid sequence identity therewith.
  • the protein or sequence used in the present invention is in a purified form.
  • purified means that a given component is present at a high level.
  • the component is desirably the predominant active component present in a composition.
  • variants refers to proteins, polypeptides, units, motifs, domains or nucleic acids.
  • variant may be used interchangeably with the term “mutant.”
  • variants include insertions, substitutions, transversions, truncations, and/or inversions at one or more locations in the amino acid or nucleotide sequence, respectively.
  • variant polypeptide polypeptide
  • variant enzyme mean a polypeptide/protein that has an amino acid sequence that has been modified from the amino acid sequence of SEQ ID NO: 1.
  • variant polypeptides include a polypeptide having a certain percent, e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, of sequence identity with SEQ ID NO: 1, or the amino acid sequence 5-70 of SEQ ID NO : l.
  • variant nucleic acids can include sequences that are complementary to sequences that are capable of hybridizing to the nucleotide sequences presented herein.
  • the melting point (Tm) of a variant nucleic acid may be about 1, 2, or 3°C lower than the Tm of the wild-type nucleic acid.
  • the variant nucleic acids include a polynucleotide having a certain percent, e.g., 80%, 85%, 90%, 95%, or 99%, of sequence identity with the nucleic acid encoding SEQ ID NO: 1 or encoding the monomeric protein which can form the homodimeric protein according to invention.
  • homodimeric protein refers to a protein comprising two individual identical strands of amino acids, or subunits held together as a single, dimeric protein by either hydrogen bonding, ionic (charged) interactions, actual covalent disulfide bonding, or some combination of these interactions.
  • dimerization motif refers to the sequence of amino acids between the antigenic unit and the targeting unit comprising the hinge region and the optional second domain that may contribute to the dimerization. This second domain may be an
  • the immunoglobulin domain and optionally the hinge region and the second domain are connected through a linker.
  • the dimerization motif serve to connect the antigenic unit and the targeting unit, but also contain the hinge region that facilitates the dimerization of the two monomeric proteins into a homodimeric protein according to the invention.
  • targeting unit refers to a unit that delivers the protein with its antigen to mouse or human APC for MHC class Il-restricted presentation to CD4+ T cells or for providing cross presentation to CD8+ T cells by MHC class I restriction.
  • antigenic unit refers to any molecule, such as a peptide which is able to be specifically recognized by an antibody or other component of the immune system, such as a surface receptor on T-cells. Included within this definition are also immunogens that are able to induce an immune response, such as idiotype immunogens of antibodies.
  • epitope or “antigenic epitope” is used to refer to a distinct molecular surface, such as a molecular surface provided by a short peptide sequence within an antigenic unit.
  • the antigenic unit comprises two ore more antigenic epitopes.
  • hinge region refers to a peptide sequence of the homodimeric protein that facilitates the dimerization, such as through the formation of an interchain covalent bond(s), e.g. disulfide bridge(s).
  • the hinge region may be Ig derived, such as hinge exons hl+h4 of an Ig, such as IgG3.
  • immunomulating composition refers to any therapeutic composition that is capable to activate the immune system, e.g., by activating or inhibiting lymphocyte functions, in particular T-cell functions like T-cell activation.
  • the antigenic unit is a cancer associated or a cancer specific antigen.
  • cancer associated antigen refers to any antigen, which in not necessarily specific for a certain cancer, but overexpressed on the surface of the cancer cells of this cancer. The term may be used interchangeably with the term “cancer antigens”.
  • the antigenic unit is an antigenic scFv.
  • a linker such as a (G 4 S) 3 linker, connects the V H and V L in the antigenic scFv.
  • the antigenic scFv is derived from a monoclonal Ig produced by myeloma or lymphoma cells.
  • the antigenic unit is a telomerase, or a functional part thereof. In some embodiments the telomerase is hTERT.
  • the antigenic unit is a melanoma antigen. In some embodiments the melanoma antigen is tyrosinase, TRP-1, or TRP-2. In some embodiments the antigenic unit is a prostate cancer antigen. In some embodiments the prostate cancer antigen is PSA.
  • the antigenic unit is a cervix cancer antigen.
  • the cervix cancer antigen is selected from the list consisting of human papilloma virus El, E2, E4, E6, and E7.
  • the antigenic unit is derived from a bacterium.
  • the bacterium derived antigenic unit is a tuberculosis antigen. In some embodiments the bacterium derived antigenic unit is a brucellosis antigen.
  • the antigenic unit is derived from a virus.
  • the virus derived antigenic unit is derived from HIV.
  • the HIV derived antigenic unit is derived from gpl20 or Gag.
  • the antigenic unit is selected from the list consisting of influenza virus hemagglutinin (HA), nucleoprotein, and M2 antigen; Herpes simplex 2 antigen glycoprotein D; and a Human Papilloma virus antigen, such as any one selected from the list consisting of El, E2, E6, E7, LI and L2.
  • the dimerization motif comprises a hinge region and optionally another domain that facilitate dimerization, such as an immunoglobulin domain, optionally connected through a linker.
  • the hinge region is Ig derived, such as derived from IgG3.
  • the hinge region has the ability to form one, two, or several covalent bonds.
  • the covalent bond is a disulphide bridge.
  • the immunoglobulin domain of the dimerization motif is a
  • carboxyterminal C domain or a sequence that is substantially homologous to said C domain.
  • the carboxyterminal C domain is derived from IgG.
  • the immunoglobulin domain of the dimerization motif has the ability to homodimerize. In some embodiments the immunoglobulin domain of the dimerization motif has the ability to homodimerize via noncovalent interactions. In some embodiments the noncovalent interactions are hydrophobic interactions.
  • the dimerization domain does not comprise the CH2 domain.
  • the dimerization motif consist of hinge exons hi and h4 connected through a linker to a C H 3 domain of human IgG3.
  • the linker that connect the hinge region and another domain that facilitate dimerization, such as an immunoglobulin domain is a G 3 S 2 G 3 SG linker.
  • the antigenic unit and the dimerization motif is connected through a linker, such as a GLSGL linker.
  • the targeting unit comprises amino acids 3-70 of SEQ ID NO: l.
  • the targeting unit consists of amino acids 5-70 of SEQ ID NO: l.
  • the targeting unit consists of amino acids 3-70 of SEQ ID NO: l.
  • the targeting unit consists of amino acids 1-70 of SEQ ID NO: l.
  • the homodimeric protein do not comprise amino acids 1-70 of SEQ ID NO: l.
  • the targeting unit comprises amino acids 3-70 of SEQ ID NO:2.
  • the targeting unit consists of amino acids 5-70 of SEQ ID NO:2.
  • the targeting unit consists of amino acids 3-70 of SEQ ID NO:2.
  • the targeting unit consists of amino acids 1-70 of SEQ ID NO:2. In some embodiments the homodimeric protein do not comprise amino acids 1-70 of SEQ ID NO:2.
  • the targeting unit consists of not more than 68 amino acids, such as 68, 67, or 66 amino acids.
  • the targeting unit do not contain the amino acid sequence AP at positions 1 and 2 of the targeting unit.
  • the homodimeric protein is a first homodimeric protein having increased affinity as compared to the affinity of a second homodimeric protein, which second homodimeric protein only differs from said first homodimeric protein by having a targeting unit, which consists of amino acids 1-70 of SEQ ID NO:2; the increased affinity being for any one chemokine receptor selected from CCR1, CCR3 and CCR5.
  • the nucleic acid molecule according to invention is comprised by a vector.
  • nucleic acid molecule according to the invention is formulated for administration to a patient to induce production of the homodimeric protein in said patient.
  • vaccine or immunostimulating composition according to the invention comprises a pharmaceutically acceptable carrier and/or adjuvant.
  • the cancer treated by a vaccine or immunostimulating composition or pharmaceutical compositions according to the present invention is multiple myeloma or lymphoma, malignant melanoma, HPV induced cancers, prostate cancer, breast cancer, lung cancer, ovarian cancer, and/or liver cancer.
  • infectious disease treated by a vaccine or immunostimulating composition or pharmaceutical compositions according to the present invention is selected from the list consisting of influenza, Herpes, CMV, HPV, HBV, brucellosis, HIV, HSV-2 and tuberculosis. Numbered embodiments of the invention :
  • a homodimeric protein of two identical amino acid chains each amino acid chain comprising a targeting unit comprising an amino acid sequence having at least 80 % sequence identity to the amino acid sequence 5-70 of SEQ ID NO : l, and an antigenic unit, the targeting unit and the antigenic unit being connected through a dimerization motif.
  • the antigenic unit is an antigenic scFv.
  • the bacterium derived antigenic unit is selected from a tuberculosis antigen and a brucellosis antigen.
  • influenza virus hemagglutinin (HA), nucleoprotein, and M2 antigen
  • Herpes simplex 2 antigen glycoprotein D Herpes simplex 2 antigen glycoprotein D.
  • the cancer antigenic unit is a melanoma antigen, such as the melanoma antigens tyrosinase, TRP-1 or TRP2.
  • the cancer antigenic unit is a prostate cancer antigen, such as the prostate cancer antigen PSA.
  • the cancer antigenic unit is a cervix cancer antigen, such as the cervix cancer antigen selected from the list consisting of El, E2, E4, E6, E7, LI and L2.
  • the dimerization motif comprises a hinge region and optionally another domain that facilitate dimerization, such as an immunoglobulin domain, optionally connected through a linker.
  • the hinge region is Ig derived, such as derived from IgG3.
  • homodimeric protein according to any one of embodiments 1-29, which homodimeric protein do not comprise amino acids 1-70 of SEQ ID NO : l .
  • homodimeric protein according to any one of embodiments 1-29, which homodimeric protein do not comprise amino acids 1-70 of SEQ ID NO : 2.
  • each said targeting unit consist of not more than 68 amino acids, such as 68, 67, or 66 amino acids.
  • the nucleic acid molecule according to embodiment 43 comprised by a vector.
  • nucleic acid molecule according to embodiments 43 or 44 formulated for administration to a patient to induce production of the homodimeric protein in said patient.
  • a pharmaceutical composition comprising the homodimeric protein according to any one of embodiments 1-42, or the nucleic acid molecule according to embodiments 43 or 44.
  • a host cell comprising the nucleic acid molecule according to embodiments 43 or 44.
  • a vaccine against a cancer or an infectious disease comprising an immunologically effective amount of a homodimeric protein according to any one of embodiments 1-42 or nucleic acid molecule according to embodiments 43 or 44 encoding the monomeric protein which can form the homodimeric protein, wherein said vaccine is able to trigger both a T-cell- and B-cell immune response and wherein said homodimeric protein contain an antigenic unit specific for said cancer or infectious disease.
  • the vaccine according to embodiment 50 further comprising a pharmaceutically acceptable carrier and/or adjuvant.
  • the vaccine according to embodiment 50 or 51, wherein said infectious disease is selected from the list consisting of tuberculosis, Influenza, Herpes, CMV, HPV, HBV, HIV, brucellosis, and/or HSV-2.
  • a method of treating a cancer or an infectious disease in a patient comprising administering to the patient in need thereof, a homodimeric protein according to any one of embodiments 1-42, or the nucleic acid molecule according to embodiments 43 or 44 encoding the monomeric protein which can form the homodimeric protein, wherein said homodimeric protein contain an antigen unit specific for said cancer or infectious disease.
  • mice were obtained from Taconic (Ry, Denmark). Id(A2 315 )-specific T-cell receptor (TCR) transgenic mice have been described (see Bogen B et al. Eur J Immunol 1992
  • HEK 293 stably transfected with hCCR5 and hCCRl were kindly provided by Mario Mellado (Madrid, Spain) and Zack Howard (Frederick, MD), respectively.
  • HEK 293 stably transfected with Rhesus macaque were obtained from Pfizer Inc., (Groton, CT).
  • the murine lymphoma Esb/MP cells were kindly provided by Jo Van Damme (Leuven, Belgium).
  • LD78a GGTGrGG47TCCGCATCACTTGCTGCTGAC (SEQ ID NO : 3) ; ⁇ _ ⁇ 78 ⁇ : GGTGrGG47TCCGCACCACTTGCTGCTGAC (SEQ ID NO : 4) ; and reverse primer (BsiWI restriction site, in italic) was
  • vaccibody construct encoded for homodimeric proteins with hCCL3-derived targeting units and MOPC315 scFv in a VH-VL orientation as antigenic unit, connected via a homodimerizing motif consisting of human hinge exons hi and h4 and CH3 domain of IgG3.
  • the antigenic unit (scFv 315 ) in vaccibodies described above were exchanged with either paired murine CK domains (Tunheim G et al . Vaccine 2007 Jun l l ;25(24) :4723-34) or influenza virus hemagglutinin (HA) from H1 N1 A/Puerto Rico/8/34 (Mt. Sinai) (G. Grodeland, manuscript in preparation) .
  • scFv 315 vaccibodies DNP-BSA (binds to M315) as coat and biotinylated monoclonal HP6017
  • HA vaccibodies MCA878G (anti-CH3 dimerization motif) as coat and anti-HA biotinylated mAB H36-4-52 for detection; mouse CKCK
  • vaccibodies 187.1 mAb (binds to mouse CK) as coat and biotinylated 187.1 for detection.
  • vaccibody proteins having scFv 315 as antigenic unit were affinity purified from supernatants of stably transfected NSO cells on DNP (bound by M315) Sepharose columns. Purified proteins were loaded onto a 4-20% Tris-glycine gel . Following membrane transfer, proteins were detected with either biotinylated HP6017 or Ab2-1.4 (binds to M315) mAbs followed by streptavidin HRP. Vaccibody proteins were quantified by Bradford and ELISA using BSA and mCCL3 vaccibody (see Fredriksen AB et al . Mol Ther 2006 Apr; 13(4) : 776-85)as standards, respectively.
  • Protein bands corresponding to ⁇ _ ⁇ 78 ⁇ and ⁇ _ ⁇ 78 ⁇ -2 vaccibodies with Fv 315 were excised from a Coomassie-stained polyacrylamide gel and subjected to tryptic in-gel digestion as previously described . Binding to human and murine CCR5 and CCR1
  • Vaccibody proteins at concentrations ranging from 0.2 to 25 ⁇ g/mL were used to stain parental or stably transfected HEK 293 cells or BALB/c splenocytes (gated by FSC/SSC and on CDl lb+ CD3- cells) .
  • Bound vaccibody proteins were detected by biotinylated HP6017 (binds to CH3 of hIgG3) or Ab2-1.4 (binds to M315) mAbs followed by streptavidin PE. Cells were analyzed on a FACScalibur.
  • chemotactic index defined as the fold increase in the number of migrating cells in the presence of chemotactic factors over the spontaneous cell migration (i .e., in the presence of medium alone) .
  • BALB/c splenocytes were irradiated (8 Gy) and mixed with vaccibody proteins containing scFv 315 at concentration ranging from 20 to 0.04 ⁇ g/mL before addition of in vitro polarized Id 315 -specific Th2 cells derived from TCR-transgenic mice.
  • An Id peptide corresponding to sequence 89-107 of ⁇ 2 315 was used as a positive control .
  • Human PBMC from three different DR4*01 healthy donors were mixed with supernatants from transiently transfected 293E cells, containing vaccibody proteins with mouse CKCK as antigenic unit, before irradiation (20 Gy) and addition of T18 T cell clone that recognizes aa. 40-48 of murine Ck presented by DR4*01. After 48 hrs plates were pulsed with 3 H-thymidine for 24 hrs before harvesting.
  • Vaccibody DNA was purified using Endofree-mega plasmid purification system (Qiagen). 25 pL solution of 0.5 mg/mL vaccibody DNA in sterile 0.9% NaCI was injected intradermally in the lower back of mice, on both sides, followed by electroporation using Dermavax
  • mice (Cytopulse, Sweden). Groups consisted of 3 to 7 mice.
  • mice were bled three, four and six weeks following a single immunization.
  • Myeloma protein M315 (IgA, ⁇ 2) was used as coat and anti-Id 315 Abs in mouse sera were detected by biotinylated anti-mouse IgGl a or anti-mouse IgG2a a (BD Pharmingen). Endpoint titers were calculated.
  • Millipore Multiscreen plates (Millipore, Billerca, MA, USA) were coated with anti-mouse IFNy (AN18) (12pg/ml) and then blocked for 2h with RPMI-1640 (Invitrogen, NY, USA) containing 10% FCS.
  • Single cell splenocytes were prepared individually from mice DNA-vaccinated 3 weeks earlier with HA-containing vaccibodies or NaCI, and incubated overnight at 10 5 , 5xl0 5 and 2.5xl0 5 cells/well with one of the following HA-derived peptides from Prolmmune (Oxford, UK) : SVSSFERFEIPK (aa.
  • IFNy- producing cells were detected by using the BCIP/NBT kit (Zymed Laboratories Inc, Carlsbad, CA, USA), and counting was performed with KS EliSpot version 4.3.56 from Zeiss on a Zeiss Axioplan 2 imaging system (objective: Epiplan-Neofluar 5x, 442320). Vaccination of mice with vaccibody -HA constructs.
  • mice were anesthetized, shaved, and vaccinated intradermally with 25 ⁇ DNA (0,5mg/ml) on each side of the lower back region immediately followed by skin electroporation
  • mice 14 days later, the mice were anesthetized with hypnorm/dormicum and challenged with 20 ⁇ influenza (A/Puerto Rico/8/34 (Mt. Sinai) virus (5xLD50). Following challenge, the mice were weighed and closely monitored for clinical signs.
  • Fig. 1A Construction and expression of human CCL3-based vaccibodies
  • Homodimeric vaccibodies were constructed that have various hCCL3-based targeting units, a human Ig-derived homodimerization unit and various antigenic units, as indicated in Fig. 1A.
  • the NH 2 terminal aa. sequence of the employed LD78a, ⁇ _ ⁇ 78 ⁇ , ⁇ _ ⁇ 78 ⁇ -2 and the putative effect of the CllS point mutation on chemokine structure LD78 (C11S) are shown in Fig. IB and 1C, respectively.
  • All vaccibodies were expressed at comparable levels by transiently transfected 293E cells, except ⁇ _ ⁇ 78 ⁇ -2 vaccibodies which were consistently expressed to a lower extent (Fig. 2 A-C).
  • vaccibody proteins having scFv 315 as antigenic unit were tested by SDS- PAGE, where single bands of about 110 kDa were visible that, following membrane blotting, could be stained with appropriate mAbs (Fig. 2 D and data not shown for other constructs).
  • the apparently increased size of the mutated (CllS) vaccibody is likely due to an increase in Stokes radius due to abrogation of a S-S bond (Fig. 1C). Under reducing conditions, single bands of about 55 kDA, corresponding to monomers were observed, as would be expected (data not shown).
  • the NH 2 terminal aa The NH 2 terminal aa.
  • pure full lenght ⁇ _ ⁇ 78 ⁇ or NH 2 -truncated ⁇ _ ⁇ 78 ⁇ -2 vaccibodies can be expressed and purified from stably transfected NSO cells.
  • ⁇ 78 ⁇ vaccibodies and NH 2 -truncated version bind human and murine chemokine receptors
  • NH2-truncated ⁇ _ ⁇ 78 ⁇ -2 vaccibody displayed stronger binding than full lenght ⁇ _ ⁇ 78 ⁇ vaccibody.
  • Point mutated ⁇ _ ⁇ 78 ⁇ (CllS) vaccibody did not bind hCCR5- transfected cells (Fig. 3A).
  • ⁇ _ ⁇ 78 ⁇ -2 but not ⁇ _ ⁇ 78 ⁇ vaccibodies, also bound hCCRl- expressing HEK 293 (Fig. 3 C, D and data not shown), which is in agreement with previous reports. There was no staining of parental, untransfected HEK 293 cells (not shown).
  • ⁇ _ ⁇ 78 ⁇ vaccibody but not its point mutated counterpart, bound CDl lb+ BALB/c splenocytes (Fig. 4 A), and induced chemotaxis of Esb/MP cells (Fig. 4 B), thus providing the rationale for testing ⁇ _ ⁇ 78 ⁇ - ⁇ 55 ⁇ vaccibodies in mice. Delivery of antigen to APC via chemokine receptors improves T-cell responses in vitro in mouse and human systems
  • ⁇ _ ⁇ 78 ⁇ vaccibodies that express murine CKCK as a model antigen were mixed with donor PBMCs and cloned T18 CD4+ T cells that recognize aa 40-48 of murine CK in the context of DR4*01.
  • the difference between wild type and point mutated ⁇ _ ⁇ 78 ⁇ was less pronounced than in the mouse system (Fig . 5 B) .
  • targeted antigen delivery is demonstrated by superiority of ⁇ _ ⁇ 78 ⁇ over non-targeted NIP-specific vaccibody (Fig . 5B) .
  • ⁇ _ ⁇ 78 ⁇ -2 vaccibodies outperformed ⁇ _ ⁇ 78 ⁇ vaccibodies. Similar results were obtained using three different donors (not shown).
  • V H + V L Id of M315 myeloma protein is a very weak self antigen, in fact an extensive immunization scheme including multiple immunizations with complete and incomplete Freund's adjuvant was required to detect anti-Id antibodies.
  • Anti-Id 315 IgGl Fig . 6A
  • IgG2a Fig .
  • hemagglutinin served as the target antigen.
  • H1N1 hemagglutinin
  • HA from strain A/Puerto Rico/8/34 (Mt. Sinai) (H1N1) is known to express three epitopes to which BALB/c mice (H-2 d ) respond.
  • Two of these are MHC class II-restricted, SVSSFERFEIPK (SEQ ID NO: ll) (aa. 107-119) restricted by I-E d and HNTNGVTAACSHEG (SEQ ID NO: 12) (aa. 126-138) restricted by I-A d , respectively.
  • the third epitope, IYSTVASSL (SEQ ID NO: 13) (aa. 633-641) is MHC class I- restricted (K d ).
  • CCR5 is conserved across different species, including monkey. Human and macaque CCR5 genes have very close aa. homology (98%). Like humans, macaques have two CCL3 isoforms. ⁇ _ ⁇ 78 ⁇ and ⁇ _ ⁇ 78 ⁇ -2 vaccibodies bound in a dose-dependent fashion Rhesus macaque CCR5-expressing HEK 293 cells, whereas the C11S point mutated ⁇ _ ⁇ 78 ⁇ did not bind the same cells (Fig. 8, and data not shown). This result indicates that vaccibodies with ⁇ _ ⁇ 78 ⁇ and ⁇ _ ⁇ 78 ⁇ -2 intended for human use not only can be tested in mice, as above, but also in Rhesus macaques, prior to any human application. ⁇ 78 ⁇ - HA vaccibody but not ⁇ 78 ⁇ -2- ⁇ vaccibody protects mice from influenza.
  • mice were vaccinated with either of the two forms of LD78 ⁇ , ⁇ _ ⁇ 78 ⁇ or ⁇ _ ⁇ 78 ⁇ -2.
  • the full length version of ⁇ _ ⁇ 78 ⁇ was shown to have superior effect in terms of protecting mice from influenza infection.
  • APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA LD78a (SEQ ID NO:2) :

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Organic Chemistry (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Oncology (AREA)
  • Virology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pulmonology (AREA)
  • Communicable Diseases (AREA)
  • Cell Biology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Engineering & Computer Science (AREA)
  • AIDS & HIV (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/EP2011/060628 2010-06-25 2011-06-24 Homodimeric protein constructs Ceased WO2011161244A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
ES11727190T ES2706058T3 (es) 2010-06-25 2011-06-24 Constructos de proteínas homodiméricas
EP11727190.8A EP2585107B1 (en) 2010-06-25 2011-06-24 Homodimeric protein constructs
AU2011268934A AU2011268934B2 (en) 2010-06-25 2011-06-24 Homodimeric protein constructs
US13/805,709 US10590195B2 (en) 2010-06-25 2011-06-24 Homodimeric protein constructs
EP18195357.1A EP3441085A1 (en) 2010-06-25 2011-06-24 Homodimeric protein constructs
BR112012032922-7A BR112012032922B1 (pt) 2010-06-25 2011-06-24 Proteína homodimérica, molécula de ácido nucleico, composição farmacêutica, método para a preparação de uma proteína homodimérica, e, vacina
CN201180031589.6A CN102985109B (zh) 2010-06-25 2011-06-24 同型二聚体蛋白质构建体
DK11727190.8T DK2585107T3 (en) 2010-06-25 2011-06-24 Homodimeric protein constructs
CA2803058A CA2803058C (en) 2010-06-25 2011-06-24 Homodimeric protein constructs
KR1020137002177A KR20130087517A (ko) 2010-06-25 2011-06-24 동종이합체 단백질 구조물
KR1020187024633A KR102044948B1 (ko) 2010-06-25 2011-06-24 동종이합체 단백질 구조물
JP2013515914A JP2013532971A (ja) 2010-06-25 2011-06-24 ホモ二量体タンパク質コンストラクト
RU2013103335A RU2624041C2 (ru) 2010-06-25 2011-06-24 Конструкции гомодимерных белков
US16/784,778 US11479605B2 (en) 2010-06-25 2020-02-07 Homodimeric protein constructs
US17/934,348 US12516116B2 (en) 2010-06-25 2022-09-22 Homodimeric protein constructs

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US35851310P 2010-06-25 2010-06-25
EP10167291 2010-06-25
US61/358,513 2010-06-25
EP10167291.3 2010-06-25

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US13/805,709 A-371-Of-International US10590195B2 (en) 2010-06-25 2011-06-24 Homodimeric protein constructs
US16/784,778 Division US11479605B2 (en) 2010-06-25 2020-02-07 Homodimeric protein constructs

Publications (1)

Publication Number Publication Date
WO2011161244A1 true WO2011161244A1 (en) 2011-12-29

Family

ID=42983487

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2011/060628 Ceased WO2011161244A1 (en) 2010-06-25 2011-06-24 Homodimeric protein constructs

Country Status (10)

Country Link
US (3) US10590195B2 (enExample)
EP (2) EP3441085A1 (enExample)
JP (2) JP2013532971A (enExample)
KR (2) KR20130087517A (enExample)
CN (1) CN102985109B (enExample)
AU (1) AU2011268934B2 (enExample)
CA (1) CA2803058C (enExample)
DK (1) DK2585107T3 (enExample)
RU (1) RU2624041C2 (enExample)
WO (1) WO2011161244A1 (enExample)

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013092875A1 (en) * 2011-12-21 2013-06-27 Vaccibody As Vaccines against hpv
WO2017118695A1 (en) * 2016-01-08 2017-07-13 Vaccibody As Therapeutic anticancer neoepitope vaccine
WO2019048936A1 (en) * 2017-09-07 2019-03-14 University Of Oslo VACCINE MOLECULES
US10590195B2 (en) 2010-06-25 2020-03-17 Vaccibody As Homodimeric protein constructs
WO2021204911A1 (en) * 2020-04-07 2021-10-14 Evaxion Biotech A/S Neoepitope immunotherapy with apc targeting unit
WO2021219897A1 (en) 2020-05-01 2021-11-04 Vaccibody As Betacoronavirus prophylaxis and therapy
WO2022013277A1 (en) * 2020-07-14 2022-01-20 Evaxion Biotech A/S Apc targeting units for immunotherapy
WO2022200590A1 (en) 2021-03-26 2022-09-29 Nykode Therapeutics ASA Therapeutic combination for treating cancer
RU2782422C2 (ru) * 2016-01-08 2022-10-26 Никоде Терапьютикс АСА Терапевтическая противораковая неоэпитопная вакцина
WO2022233851A1 (en) 2021-05-03 2022-11-10 Nykode Therapeutics ASA Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of infectious diseases
WO2022238395A1 (en) 2021-05-10 2022-11-17 Nykode Therapeutics ASA Tolerance-inducing constructs and compositions and their use for the treatment of immune disorders
WO2022238402A1 (en) 2021-05-10 2022-11-17 Nykode Therapeutics ASA Tolerance-inducing constructs and composition and their use for the treatment of immune disorders
WO2022238420A2 (en) 2021-05-10 2022-11-17 Nykode Therapeutics ASA Co-expression of constructs and immunostimulatory compounds
WO2022238432A2 (en) 2021-05-10 2022-11-17 Nykode Therapeutics ASA Co-expression of constructs and immunoinhibitory compounds
WO2022238363A1 (en) 2021-05-10 2022-11-17 Nykode Therapeutics ASA Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of infectious diseases
WO2023079001A1 (en) 2021-11-03 2023-05-11 Nykode Therapeutics ASA Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2
WO2024092025A1 (en) 2022-10-25 2024-05-02 Nykode Therapeutics ASA Constructs and their use
WO2024100196A1 (en) 2022-11-09 2024-05-16 Nykode Therapeutics ASA Co-expression of constructs and polypeptides

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8932603B2 (en) 2003-02-25 2015-01-13 Vaccibody As Modified antibody
KR102682118B1 (ko) 2016-04-29 2024-07-08 주식회사유한양행 Ccl3 변이체를 포함하는 융합 단백질 및 이의 용도
CN109983033B (zh) 2016-09-23 2023-10-31 美勒斯公司 调节细胞表达的生物活性的结合分子
WO2025064470A1 (en) 2023-09-19 2025-03-27 Regeneron Pharmaceuticals, Inc. Viral peptides and uses thereof
WO2025064738A1 (en) 2023-09-22 2025-03-27 Regeneron Pharmaceuticals, Inc. Dntt 250-258 off-target peptides and uses thereof
WO2025064761A1 (en) 2023-09-22 2025-03-27 Regeneron Pharmaceuticals, Inc. Kras10-18 g12d off-target peptides and uses thereof
WO2025136809A2 (en) 2023-12-19 2025-06-26 Regeneron Pharmaceuticals, Inc. Foxp3 peptides and uses thereof
WO2025178991A1 (en) 2024-02-21 2025-08-28 Regeneron Pharmaceuticals, Inc. Splicing factor gene mutation-associated neoantigenic peptides and uses thereof
WO2026006724A1 (en) 2024-06-28 2026-01-02 Regeneron Pharmaceuticals, Inc. Prame off-target peptides and uses thereof
WO2026006734A1 (en) 2024-06-28 2026-01-02 Regeneron Pharmaceuticals, Inc. Off-target peptide-mhc complex conformation modeling systems and methods for antigen-recognition molecule development
WO2026030428A2 (en) 2024-08-01 2026-02-05 Regeneron Pharmaceuticals, Inc. Prostate-specific antigen peptides and uses thereof

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0920522A1 (en) 1996-08-14 1999-06-09 THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES A vector for polynucleotide vaccines
WO2004076489A1 (en) 2003-02-25 2004-09-10 Medinnova As Modified antibody
US20070298051A1 (en) 2003-11-19 2007-12-27 Beth Israel Deaconess Medical Center Adjuvants Of Immune Response

Family Cites Families (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5703055A (en) 1989-03-21 1997-12-30 Wisconsin Alumni Research Foundation Generation of antibodies through lipid mediated DNA delivery
US5270181A (en) * 1991-02-06 1993-12-14 Genetics Institute, Inc. Peptide and protein fusions to thioredoxin and thioredoxin-like molecules
US5646016A (en) 1991-02-06 1997-07-08 Genetics Institute, Inc. Peptide and protein fusions to thioredoxin, thioredoxin-like molecules, and modified thioredoxin-like molecules
WO1994008601A1 (en) 1992-10-14 1994-04-28 The Board Of Trustees Of The Leland Stanford Junior University Enhancement of b cell lymphoma tumor resistance using idiotype/cytokine conjugates
GB9820014D0 (en) 1998-09-14 1998-11-04 Cancer Res Campaign Tech Receptor antagonists and uses thereof
US20030119112A1 (en) 2001-06-20 2003-06-26 Genentech, Inc. Compositions and methods for the diagnosis and treatment of disorders involving angiogenesis
CN1268321C (zh) 2001-07-13 2006-08-09 那野伽利阿株式会社 内部包有药物的高分子胶束的冻结干燥用组合物和该胶束的制备方法
EP2075256A2 (en) 2002-01-14 2009-07-01 William Herman Multispecific binding molecules
CA2474002A1 (en) 2002-01-18 2003-07-24 Bjarne Bogen Bispecific antibody dna constructs for intramuscular administration
EP1806364B1 (fr) 2002-01-18 2013-07-31 Pierre Fabre Medicament Nouveaux anticorps anti-igf-ir et leurs applications
GB0222953D0 (en) * 2002-10-03 2002-11-13 Glaxo Group Ltd Novel Compounds
KR101199789B1 (ko) * 2003-03-24 2012-11-09 더 스크립스 리서치 인스티튜트 종양 성장 억제 dna 백신
HN2006031275A (es) * 2005-09-07 2010-10-29 Amgen Fremont Inc Anticuerpos monoclonales humanos para la quinasa-1 tipo receptor de activina
US20090010948A1 (en) * 2006-12-15 2009-01-08 The University Of Hong Kong Anti-tumor vaccines delivered by dendritic cells devoid of interleukin-10
BRPI0720647A2 (pt) * 2006-12-29 2014-01-14 Osprey Pharmaceuticals Usa Inc Processos de seleção e produção de toxinas modificadas, conjugados contendo toxinas modificadas e usos dos mesmos
CA2739608A1 (en) 2008-10-07 2010-04-15 The Regents Of The University Of California Recombinant nell protein production
AU2011268934B2 (en) 2010-06-25 2015-09-10 Nykode Therapeutics ASA Homodimeric protein constructs
WO2015050158A1 (ja) 2013-10-01 2015-04-09 国立大学法人三重大学 抗原提示を促進するエピトープ間配列を含むt細胞誘導ワクチン
US12005112B2 (en) 2017-09-07 2024-06-11 University Of Oslo Vaccine molecules

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0920522A1 (en) 1996-08-14 1999-06-09 THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES A vector for polynucleotide vaccines
WO2004076489A1 (en) 2003-02-25 2004-09-10 Medinnova As Modified antibody
US20070298051A1 (en) 2003-11-19 2007-12-27 Beth Israel Deaconess Medical Center Adjuvants Of Immune Response

Non-Patent Citations (11)

* Cited by examiner, † Cited by third party
Title
AGNETE BRUNSVIK FREDRIKSEN ET AL: "Chemokine-idiotype fusion DNA vaccines are potentiated by bivalency and xenogeneic sequences", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US LNKD- DOI:10.1182/BLOOD-2006-06-032938, vol. 110, 1 January 2007 (2007-01-01), pages 1797 - 1805, XP007915509, ISSN: 0006-4971, [retrieved on 20070531] *
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
BOGEN B ET AL., EUR J IMMUNOL, vol. 22, no. 3, March 1992 (1992-03-01), pages 703 - 9
FREDRIKSEN AB ET AL., MOL THER, vol. 13, 2006, pages 776 - 85
FREDRIKSEN AB ET AL., MOL THER, vol. 13, no. 4, April 2006 (2006-04-01), pages 776 - 85
FREDRIKSEN AB, BOGEN B, BLOOD, vol. 110, 2007, pages 1797 - 805
ØYNEBRÅTEN I ET AL: "P19-39. Vaccibodies: a novel vaccine strategy for HIV that target viral antigens to APC", RETROVIROLOGY, BIOMED CENTRAL LTD., LONDON, GB LNKD- DOI:10.1186/1742-4690-6-S3-P359, vol. 6, no. Suppl 3, 22 October 2009 (2009-10-22), pages P359, XP021064082, ISSN: 1742-4690 *
PROOST P ET AL: "Cleavage by CD26/dipeptidyl peptidase IV converts the chemokine LD78beta into a most efficient monocyte attractant and CCR1 agonist.", BLOOD 1 SEP 2000 LNKD- PUBMED:10961862, vol. 96, no. 5, 1 September 2000 (2000-09-01), pages 1674 - 1680, XP002607458, ISSN: 0006-4971 *
RUFFINI P A ET AL: "Human chemokine MIP1alpha increases efficiency of targeted DNA fusion vaccines", VACCINE, ELSEVIER LTD, GB, vol. 29, no. 2, 16 December 2010 (2010-12-16), pages 191 - 199, XP027539078, ISSN: 0264-410X, [retrieved on 20101104] *
SNODGRASS HR ET AL., EUR J IMMUNOL, vol. 22, no. 8, August 1992 (1992-08-01), pages 2169 - 72
TUNHEIM G ET AL., VACCINE, vol. 25, no. 24, 11 June 2007 (2007-06-11), pages 4723 - 34

Cited By (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11479605B2 (en) 2010-06-25 2022-10-25 Nykode Therapeutics ASA Homodimeric protein constructs
US12516116B2 (en) 2010-06-25 2026-01-06 Nykode Therapeutics ASA Homodimeric protein constructs
US10590195B2 (en) 2010-06-25 2020-03-17 Vaccibody As Homodimeric protein constructs
EP3533462A1 (en) * 2011-12-21 2019-09-04 Vaccibody AS Vaccines against hpv
US9901635B2 (en) 2011-12-21 2018-02-27 Vaccibody As Vaccines against HPV
WO2013092875A1 (en) * 2011-12-21 2013-06-27 Vaccibody As Vaccines against hpv
RU2782422C2 (ru) * 2016-01-08 2022-10-26 Никоде Терапьютикс АСА Терапевтическая противораковая неоэпитопная вакцина
AU2017205270B2 (en) * 2016-01-08 2024-01-18 Nykode Therapeutics ASA Therapeutic anticancer neoepitope vaccine
US12059459B2 (en) 2016-01-08 2024-08-13 Nykode Therapeutics ASA Therapeutic anticancer neoepitope vaccine
IL260030B1 (en) * 2016-01-08 2025-08-01 Nykode Therapeutics ASA Neoepitope therapeutic vaccine against cancer
WO2017118695A1 (en) * 2016-01-08 2017-07-13 Vaccibody As Therapeutic anticancer neoepitope vaccine
IL260030B2 (en) * 2016-01-08 2025-12-01 Nykode Therapeutics ASA Therapeutic anticancer neoepitope vaccine
US12005112B2 (en) 2017-09-07 2024-06-11 University Of Oslo Vaccine molecules
WO2019048936A1 (en) * 2017-09-07 2019-03-14 University Of Oslo VACCINE MOLECULES
US12447205B2 (en) 2017-09-07 2025-10-21 University Of Oslo Vaccine molecules
WO2021204911A1 (en) * 2020-04-07 2021-10-14 Evaxion Biotech A/S Neoepitope immunotherapy with apc targeting unit
WO2021219897A1 (en) 2020-05-01 2021-11-04 Vaccibody As Betacoronavirus prophylaxis and therapy
WO2022013277A1 (en) * 2020-07-14 2022-01-20 Evaxion Biotech A/S Apc targeting units for immunotherapy
WO2022200590A1 (en) 2021-03-26 2022-09-29 Nykode Therapeutics ASA Therapeutic combination for treating cancer
WO2022233851A1 (en) 2021-05-03 2022-11-10 Nykode Therapeutics ASA Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of infectious diseases
WO2022238402A1 (en) 2021-05-10 2022-11-17 Nykode Therapeutics ASA Tolerance-inducing constructs and composition and their use for the treatment of immune disorders
WO2022238363A1 (en) 2021-05-10 2022-11-17 Nykode Therapeutics ASA Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of infectious diseases
WO2022238432A2 (en) 2021-05-10 2022-11-17 Nykode Therapeutics ASA Co-expression of constructs and immunoinhibitory compounds
WO2022238420A2 (en) 2021-05-10 2022-11-17 Nykode Therapeutics ASA Co-expression of constructs and immunostimulatory compounds
WO2022238395A1 (en) 2021-05-10 2022-11-17 Nykode Therapeutics ASA Tolerance-inducing constructs and compositions and their use for the treatment of immune disorders
WO2023079001A1 (en) 2021-11-03 2023-05-11 Nykode Therapeutics ASA Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2
WO2024092025A1 (en) 2022-10-25 2024-05-02 Nykode Therapeutics ASA Constructs and their use
WO2024100196A1 (en) 2022-11-09 2024-05-16 Nykode Therapeutics ASA Co-expression of constructs and polypeptides

Also Published As

Publication number Publication date
CN102985109A (zh) 2013-03-20
US12516116B2 (en) 2026-01-06
KR102044948B1 (ko) 2019-11-14
JP2016202185A (ja) 2016-12-08
EP2585107A1 (en) 2013-05-01
DK2585107T3 (en) 2019-02-11
US20130336971A9 (en) 2013-12-19
RU2624041C2 (ru) 2017-06-30
US20130171140A1 (en) 2013-07-04
US20200239568A1 (en) 2020-07-30
CA2803058C (en) 2022-07-05
US10590195B2 (en) 2020-03-17
US20230065226A1 (en) 2023-03-02
EP3441085A1 (en) 2019-02-13
EP2585107B1 (en) 2018-10-24
CA2803058A1 (en) 2011-12-29
JP6538622B2 (ja) 2019-07-03
US11479605B2 (en) 2022-10-25
AU2011268934B2 (en) 2015-09-10
AU2011268934A1 (en) 2013-01-10
JP2013532971A (ja) 2013-08-22
RU2013103335A (ru) 2014-07-27
KR20130087517A (ko) 2013-08-06
CN102985109B (zh) 2016-05-11
KR20180099918A (ko) 2018-09-05

Similar Documents

Publication Publication Date Title
US12516116B2 (en) Homodimeric protein constructs
CN111939250B (zh) 一种预防covid-19的疫苗及其制备方法
RU2644201C2 (ru) Вакцины против hpv
KR20170102905A (ko) 신규 다가 나노입자 기반 백신
US20140234316A1 (en) Vaccibodies targeted to cross-presenting dendritic cells
Ruffini et al. Human chemokine MIP1α increases efficiency of targeted DNA fusion vaccines
JP2022553258A (ja) インフルエンザウイルスワクチン及びその使用
JP2019033762A (ja) ホモ二量体タンパク質コンストラクト
BR112012032922B1 (pt) Proteína homodimérica, molécula de ácido nucleico, composição farmacêutica, método para a preparação de uma proteína homodimérica, e, vacina
EA046906B1 (ru) Вакцины против вируса гриппа и пути их применения
CN118742321A (zh) 用于预防性和治疗性治疗由SARS-CoV-2引起的疾病的免疫原性构建体和疫苗
HK1202442B (en) Vaccines against hpv

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201180031589.6

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11727190

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2803058

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 4073/KOLNP/2012

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2013515914

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2011727190

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2011268934

Country of ref document: AU

Date of ref document: 20110624

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013103335

Country of ref document: RU

Kind code of ref document: A

Ref document number: 20137002177

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 13805709

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112012032922

Country of ref document: BR

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112012032922

Country of ref document: BR

ENPW Started to enter national phase and was withdrawn or failed for other reasons

Ref document number: 112012032922

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112012032922

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20121221