WO2011053831A1 - Methods for diagnosing irritable bowel syndrome - Google Patents

Methods for diagnosing irritable bowel syndrome Download PDF

Info

Publication number
WO2011053831A1
WO2011053831A1 PCT/US2010/054810 US2010054810W WO2011053831A1 WO 2011053831 A1 WO2011053831 A1 WO 2011053831A1 US 2010054810 W US2010054810 W US 2010054810W WO 2011053831 A1 WO2011053831 A1 WO 2011053831A1
Authority
WO
WIPO (PCT)
Prior art keywords
ibs
marker
sample
level
ibs marker
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2010/054810
Other languages
English (en)
French (fr)
Inventor
Hua Gong
Shui Long Wang
Sharat Singh
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Prometheus Laboratories Inc
Original Assignee
Prometheus Laboratories Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA2778539A priority Critical patent/CA2778539A1/en
Priority to BR112012010108A priority patent/BR112012010108A2/pt
Priority to PH1/2012/500850A priority patent/PH12012500850A1/en
Priority to EP10827556.1A priority patent/EP2494074A4/en
Priority to JP2012537132A priority patent/JP2013509593A/ja
Priority to MX2012005015A priority patent/MX2012005015A/es
Priority to AU2010313292A priority patent/AU2010313292A1/en
Priority to RU2012122180/15A priority patent/RU2012122180A/ru
Application filed by Prometheus Laboratories Inc filed Critical Prometheus Laboratories Inc
Priority to CN2010800605536A priority patent/CN102712956A/zh
Publication of WO2011053831A1 publication Critical patent/WO2011053831A1/en
Priority to US13/441,658 priority patent/US20120315630A1/en
Priority to IL219317A priority patent/IL219317A0/en
Anticipated expiration legal-status Critical
Priority to ZA2012/03718A priority patent/ZA201203718B/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6813Hybridisation assays
    • C12Q1/6827Hybridisation assays for detection of mutation or polymorphism
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/156Polymorphic or mutational markers
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/06Gastro-intestinal diseases
    • G01N2800/065Bowel diseases, e.g. Crohn, ulcerative colitis, IBS

Definitions

  • IBS Irritable bowel syndrome
  • IBS patients are classified into three groups according to their predominant bowel symptoms: constipation-predominant IBS (IBS-C), diarrhea-predominant IBS (IBS-D) and IBS with alternating symptoms of diarrhea and constipation (IBS-M).
  • IBS-C constipation-predominant IBS
  • IBS-D diarrhea-predominant IBS
  • IBS-M IBS with alternating symptoms of diarrhea and constipation
  • Irritable bowel syndrome is a heterogeneous gastrointestinal (GI) function disorder.
  • GI infection may be a triggering factor for causing the onset of IBS symptoms.
  • IBS is often described as a "brain-gut disorder”. Alterations in GI motility and secretion mediated by dysregulation of the 5-HT signaling pathway may underlie the irregularities in bowel habits.
  • Activation of mast cells in proximity to colonic nerves correlated with the abnormal pain experienced by patients with IBS. Mast cells are well known to be capable of producing and releasing a variety of inflammatory mediators upon activation.
  • enteric flora has also been implicated, and a recent study demonstrated the efficacy of the probiotic organism Bifidobacterium in treating the disorder through modulation of immune activity (O'Mahony et al., Gastroenterol., 128:541-551 (2005)).
  • hypothalamic-pituitary-adrenal axis HP A is the core endocrine stress system in humans (De Wied et al., Front. Neuroendocrinol., 14:251 -302 (1993)) and provides an important link between the brain and the gut immune system. Activation of the axis takes place in response to both physical and psychological stressors (Dinan, Br. J. Psychiatry, 164:365-371 (1994)), both of which have been implicated in the pathophysiology of IBS (Cumberland et al., Epidemiol. Infect., 130:453-460 (2003)).
  • the Rome II criteria requires three months of continuous or recurrent abdominal pain or discomfort over a one-year period that is relieved by defecation and/or associated with a change in stool frequency or consistency as well as two or more of the following: altered stool frequency, altered stool form, altered stool passage, passage of mucus, or bloating and abdominal distention.
  • altered stool frequency altered stool form
  • altered stool passage passage of mucus
  • bloating and abdominal distention The absence of any structural or biochemical disorders that could be causing the symptoms is also a necessary condition.
  • the Rome II criteria can be used only when there is a substantial patient history and is reliable only when there is no abnormal intestinal anatomy or metabolic process that would otherwise explain the symptoms.
  • the Rome III criteria recently developed by the medical community can be used only when there is presentation of a specific set of symptoms, a detailed patient history, and a physical examination.
  • the present invention provides methods, assays, systems, and code for accurately classifying whether a sample from an individual is associated with irritable bowel syndrome (IBS).
  • IBS irritable bowel syndrome
  • the present invention is useful for classifying a sample from an individual as an IBS sample using a statistical algorithm and/or empirical data.
  • the present invention also provides methods, assays, systems, and code for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject.
  • IBS irritable bowel syndrome
  • the present invention is also useful for ruling out one or more diseases or disorders that present with IBS-like symptoms and ruling in IBS using a combination of statistical algorithms and/or empirical data.
  • the present invention provides an accurate diagnostic prediction of IBS and prognostic information useful for guiding treatment decisions.
  • the present invention provides a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject, the method comprising: (a) contacting a blood or serum sample from the subject with an IBS marker binding moiety under conditions suitable to transform the IBS marker present in the sample into a complex comprising the IBS marker and the IBS marker binding moiety; and (b) determining the level of the complex, thereby determining the level of the IBS marker present in the sample.
  • IBS irritable bowel syndrome
  • the present invention provides a method for monitoring the progression or regression of irritable bowel syndrome (IBS) in a subject, the method comprising: (a) contacting a first blood or serum sample taken from the subject at a first time with an IBS marker binding moiety under conditions suitable to transform the IBS marker present in the sample into a complex comprising the IBS marker and the IBS marker binding moiety; (b) determining the level of the complex, thereby determining the level of the IBS marker present in the first sample; (c) contacting a second blood or serum sample taken from the subject at a second time with an IBS marker binding moiety under conditions suitable to transform the IBS marker present in the sample into a complex comprising the IBS marker and the IBS marker binding moiety; (d) determining the level of the complex, thereby determining the level of the IBS marker present in the second sample; and (e) comparing the level of the IBS marker present in the first sample to the level of the IBS marker present in the second sample, wherein
  • the present invention provides a computer-readable medium comprising code for controlling one or more processors to classify whether a serum or blood sample from an subject is associated with irritable bowel syndrome (IBS), the code comprising instructions to apply a statistical process to a data set comprising a diagnostic marker profile to produce a statistically derived decision classifying the sample as an IBS sample or non-IBS sample based upon the diagnostic marker profile, wherein the diagnostic marker profile indicates the level of at least IBS diagnostic marker provided herein.
  • IBS irritable bowel syndrome
  • the present invention provides a system for classifying whether a serum or blood sample from a subject is associated with irritable bowel syndrome (IBS), the system comprising: (a) a data acquisition module configured to produce a data set comprising a diagnostic marker profile, wherein the diagnostic marker profile indicates the presence or level of at least one IBS diagnostic marker provided herein; (b) a data processing module configured to process the data set by applying a statistical process to the data set to produce a statistically derived decision classifying the sample as an IBS sample or non-IBS sample based upon the diagnostic marker profile; and (c) a display module configured to display the statistically derived decision.
  • IBS irritable bowel syndrome
  • the present invention provides a method for classifying whether a sample from an individual is associated with IBS, the method comprising: (a) determining a diagnostic marker profile by detecting the presence or level of at least one diagnostic marker in the sample; and (b) classifying the sample as an IBS sample or non-IBS sample using an algorithm based upon the diagnostic marker profile.
  • the IBS marker is selected from the group consisting of a cytokine, growth factor, anti-neutrophil antibody, anti-Saccharomyces cerevisiae antibody (ASCA), antimicrobial antibody, mast cell marker, stress marker, gastrointestinal hormone, serotonin metabolite, serotonin pathway marker, carbohydrate deficient transferrin (CDT), lactoferrin, anti-tissue transglutaminase (tTG) antibody, lipocalin, matrix metalloproteinase (MMP), tissue inhibitor of metal loproteinase (TIMP), alpha-globulin, actin-severing protein, S I 00 protein, fibrinopeptide, calcitonin gene- related peptide (CGRP), tachykinin, ghrelin, neurotensin, corticotropin-releasing hormone, serine protease, prostaglandin, histamine, and combinations thereof.
  • a cytokine growth factor
  • ASCA anti-Saccharomyces
  • the IBS marker is selected from the group consisting of carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone-binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase-activating peptide, serotonin, tryptophan, serotonin O-sulfate, 5-hydroxyindoleacetic acid, 5-HT glucuronide, tyrosine, phenylalanine, UDP-glucuronosyltransferase 1 -6, serotonin reuptake transporter, tryptophan hydroxylase 1 , monoamine oxidase A, monoamine oxidase B, and hydroxytryptamine (seroton
  • the presence or level of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, or more of the biomarkers shown in Table 1 is detected to generate a diagnostic marker profile that is useful for predicting IBS.
  • the biomarkers described herein are analyzed using an immunoassay such as an enzyme-linked immunosorbent assay (ELISA) or an immunohistochemical assay.
  • EGF Epidermal growth factor
  • VEGF Vascular endothelial growth factor
  • PEDF Pigment epithelium-derived factor
  • BDNF Brain-derived neurotrophic factor
  • SDGF Schwannoma-derived growth factor
  • Anti-neutrophil antibody Anti-neutrophil cytoplasmic antibody (ANCA)
  • pANCA Perinuclear anti-neutrophil cytoplasmic antibody
  • Antimicrobial antibody Anti-outer membrane protein C (OmpC) antibody
  • Alpha-globulin Alpha-2-macroglobulin (a2-MG) Alpha-globulin Alpha-2-macroglobulin (a2-MG)
  • Haptoglobin precursor alpha-2 Hpa2
  • CRFBP Corticotropin-releasing hormone-binding protein
  • Adrenocorticotropic hormone (ACTH, corticotrophin)
  • PGE 2 Prostaglandin E2
  • CGRP Calcitonin gene-related peptide
  • NGF Nerve Growth Factor
  • VIP Vasoactive Intestinal Peptide
  • Serotonin O-sulfate (5-Hydroxytryptamine O-sulfate; 5-HT- o-sulfate)
  • SERT serotonin reuptake transporter
  • TPH1 Tryptophan hydroxylase 1
  • MAO-A Monoamine oxidase A
  • Hydroxytryptamine (serotonin) receptor 3A (5-HT3A; 5- HT3R)
  • Figure 1 illustrates a dose response curve in one embodiment of the present invention.
  • Figure 2 illustrates a dose response curve in one embodiment of the present invention.
  • Figure 3 illustrates a standard curve in one embodiment of the present invention.
  • Rabbit anti-human tryptase was coated onto an immunoassay plate and blocked with assay buffer (5%BSA in PBS).
  • assay buffer 5%BSA in PBS
  • Different concentrations of human tryptase (Standard curve) or human serum samples were added to the wells and incubated for 2 hours at RT.
  • the plate was washed and alkaline phosphatase (AP) labeled McAb against tryptase (G3) were added and incubated for 2 hours at RT.
  • the plate was washed and AP substrate (CSPD) was added to each well.
  • a luminescence plate reader was used to detect the luminescent light.
  • Figure 4 illustrates a bar graph with tryptase concentrations in serum of GI control, IBS-C and IBS-D.
  • Figure 5 illustrates a bar graph with tryptase log value distribution.
  • Figure 6 illustrates a density analysis for tryptase data.
  • Figure 7 illustrates a bar graph with tryptase concentrations in serum of GI control, IBS-C, IBS-D and IBS-A.
  • Figure 8 illustrates the dose response curve of human tryptase in one embodiment of the present invention.
  • Figure 9 illustrates the optimization of the tryptase ELISA.
  • A Comparison of tryptase standard curve with different amount of capture antibody.
  • B Optimization of detecting antibody dilutions.
  • C Comparison of tryptase standard curves in the presence of different amounts of normal human serum (NHS).
  • Figure 11 illustrates the increased serum level of histamine and PGE 2 in IBS patients versus healthy controls.
  • Figure 12 illustrates one embodiment of a molecular pathway derived from the IBS markers identified and disclosed herein.
  • FIG. 13 illustrates a disease classification system (DCS) according to one embodiment of the present invention.
  • Figure 14 provides representative chromatographs demonstrating that the identified metabolites are present at different concentrations in the serums of individuals with IBS as compared to the serums of non-IBS individuals.
  • Figure 15 illustrates the increased serum level of the identified metabolites in IBS patients versus healthy controls.
  • Figure 16 illustrates the top variables identified in the IBS prediction.
  • Figure 17 provides representative chromatographs showing that tryptophan and 5- HT metabolite production is increased in response to TNFa treatment of whole blood.
  • Figure 18 illustrates (A) TPH1 and (B) MAO expression in whole blood treated with various inflammatory cytokines.
  • Figure 19 illustrates Urocortin (Ucn) levels (Y-axis) in whole blood treated with various inflammatory cytokines.
  • Figure 20 illustrates the levels of the mast cell markers (A) histamine, (B) PGE2, and (C) tryptase in whole blood treated with various inflammatory cytokines.
  • Figure 21 illustrates the interplay between leukocytes, enterochromaffin cells, mast cells and platelets in the gastrointestinal system mediated by some of the markers provided herein.
  • Figure 22 provides representative chromatograms obtained from the HPLC analysis of serum samples from IBS patients and healthy control (HC) subjects.
  • Figure 24 provides structure elucidation of the 7.5 min peak by mass spectrometry.
  • the molecular mass of the compound present in the 7.5 min peak was determined to be 181 .9 m/z (panel A), which corresponds to the molecular mass of the amino acid tyrosine.
  • the molecular mass of the compound present in the 13.5 min peak was determined to be 165.9 m z (panel A), which corresponds to the molecular mass of the amino acid phenylalanine. That the identity of this peak is phenylalanine was further verified by the results in panel B, which shows a prominent mass peak at m/z 131.0 corresponding to the loss of H 2 0 (18 m/z) and NH 3 (17 m/z) from the molecular ion (165.9 m/z); and by panel C, which shows a prominent mass peak at m/z 120.0 corresponding to the loss of HCOOH (46 m/z) from the molecular ion.
  • Figure 26 illustrates the dose-dependent response of spiked in D-tyrosine to serum samples determined by HPLC analysis.
  • Figure 27 illustrates the dose-dependent response of spiked in L-phenylalanine to serum samples determined by HPLC analysis.
  • Figure 28 illustrates the serotonin pathway and its participation in the
  • Figure 29 illustrates the transcript levels of 5-HT pathway metabolic enzymes produced by cytokine treatment of whole blood cells.
  • Figure 30 illustrates the normalized levels of mast cell activation markers produced by cytokine treatment of whole blood cells.
  • Figure 31 illustrates the levels of urocortin (Ucn) produced by cytokine treatment of whole blood cells.
  • IBS irritable bowel syndrome
  • IBS irritable bowel syndrome
  • Gastroenterol Hepatol. 2010 Mar;7(3): 163-73 One observation that supports this theory is the repeated finding that an increased number of mast cells can be found in the intestinal mucosa of patients diagnosed with IBS (Guilarte, M. et al, Gut 56, 203-209 (2007); Walker, M. M. et al, Pharmacol. Ther. 29, 765-773 (2009); Akbar, A. et al, Gut 57, 923-929 (2008); Barbara, G. et al, Gastroenterology 126, 693-702 (2004); Barbara, G. et al, Gastroenterology 132, 26-37 (2007); Cremon, C. et al, Am. J. Gastroenterol.
  • the present invention provides, among other aspects, non-invasive methods and assays for the diagnosis and classification of irritable bowel syndrome (IBS).
  • these methods and assays are related to the detection of the presence or concentration level of various IBS biomarkers in the blood and/or serum of subjects suspected of, or previously diagnosed as having IBS.
  • the methods comprise the detection of one or more IBS markers identified in Table 1 , in blood and/or serum samples from a subject. Additional markers can also be used.
  • the present invention is based, in part, upon the surprising discovery that the accuracy of classifying a biological sample from an individual as an IBS sample can be substantially improved by detecting the presence or level of certain diagnostic markers ⁇ e.g., ⁇ -tryptase, prostaglandin E 2 , histamine, cytokines, growth factors, anti-neutrophil antibodies, anti-Saccharomyces cerevisiae antibodies, antimicrobial antibodies, mast cell markers, stress markers, gastrointestinal hormones, serotonin metabolites, serotonin pathway markers, carbohydrate deficient transferrin (CDT), lactoferrin, etc.), alone or in combination with identifying the presence or severity of IBS-related symptoms based upon the individual's response to one or more questions ⁇ e.g., "Are you currently experiencing any symptoms?").
  • certain diagnostic markers e.g., ⁇ -tryptase, prostaglandin E 2 , histamine, cytokines, growth factors, anti-neutrophil antibodies,
  • Figure 12 shows a non-limiting example of a molecular pathway derived from the IBS markers identified and disclosed herein.
  • the present invention uses statistical algorithms to aid in the classification of a sample as an IBS sample or non-IBS sample.
  • the present invention uses statistical algorithms for ruling out other intestinal disorders (e.g., IBD), and then classifying the non-IBD sample to aid in the classification of IBS. II. Definitions
  • classifying includes “to associate” or “to categorize” a sample with a disease state. In certain instances, “classifying” is based on statistical evidence, empirical evidence, or both. In certain embodiments, the methods and systems of classifying use a so- called training set of samples having known disease states. Once established, the training data set serves as a basis, model, or template against which the features of an unknown sample are compared, in order to classify the unknown disease state of the sample. In certain instances, classifying the sample is akin to diagnosing the disease state of the sample. In certain other instances, classifying the sample is akin to differentiating the disease state of the sample from another disease state.
  • IBS irritable bowel syndrome
  • bowel disorders characterized by one or more symptoms including, but not limited to, abdominal pain, abdominal discomfort, change in bowel pattern, loose or more frequent bowel movements, diarrhea, and constipation, typically in the absence of any apparent structural abnormality.
  • IBS intracranial pressure
  • IBS-D diarrhea-predominant
  • IBS-C constipation-predominant
  • IBS-A IBS with alternating stool pattern
  • IBS-M IBS with alternating stool pattern
  • IBS-PI post-infectious IBS
  • the term "transforming the sample” includes a physical and/or chemical change of the sample to extract a marker or to change or modify a marker as defined herein.
  • An extraction, a manipulation, a chemical precipitation, an ELISA, a complexation, an immuno- extraction, a physical or chemical modification of the sample or marker to measure a level or concentration of a marker all constitute a transformation.
  • the change or modification is a transformation.
  • sample includes any biological specimen obtained from an individual. Suitable samples for use in the present invention include, without limitation, whole blood, plasma, serum, saliva, urine, stool (i.e., feces), tears, and any other bodily fluid, or a tissue sample (i.e., biopsy) such as a small intestine or colon sample, and cellular extracts thereof (e.g., red blood cellular extract).
  • tissue sample i.e., biopsy
  • the sample is a blood, plasma, or serum sample.
  • the sample is a serum sample.
  • the use of samples such as serum, saliva, and urine is well known in the art (see, e.g., Hashida et ah , J. Clin. Lab.
  • biomarker or “marker” includes any diagnostic marker such as a biochemical marker, serological marker, genetic marker, or other clinical or echographic characteristic that can be used to classify a sample from an individual as an IBS sample or to rule out one or more diseases or disorders associated with IBS-like symptoms in a sample from an individual.
  • biomarker or “marker” also encompasses any classification marker such as a biochemical marker, serological marker, genetic marker, or other clinical or echographic characteristic that can be used to classify IBS into one of its various forms or clinical subtypes.
  • diagnostic markers suitable for use in the present invention include cytokines, growth factors, anti-neutrophil antibodies, anti-Saccha omyces cerevisiae antibodies, antimicrobial antibodies, mast cell markers, stress markers, gastrointestinal hormones, serotonin metabolites, serotonin pathway markers, carbohydrate deficient transferrin (CDT), anti-tissue transglutaminase (tTG) antibodies, lipocalins, matrix metalloproteinases (MMPs), tissue inhibitor of cytokines, growth factors, anti-neutrophil antibodies, anti-Saccha omyces cerevisiae antibodies, antimicrobial antibodies, mast cell markers, stress markers, gastrointestinal hormones, serotonin metabolites, serotonin pathway markers, carbohydrate deficient transferrin (CDT), anti-tissue transglutaminase (tTG) antibodies, lipocalins, matrix metalloproteinases (MMPs), tissue inhibitor of
  • TIMPs metalloproteinases
  • alpha-globulins actin-severing proteins
  • S I 00 proteins fibrinopeptides
  • fibrinopeptides calcitonin gene-related peptide (CGRP)
  • CGRP calcitonin gene-related peptide
  • tachykinins ghrelin
  • neurotensin corticotropin-releasing hormone (CRH)
  • serine proteases e.g., tryptase, elastase
  • prostaglandin e.g., PGE 2
  • histamine C-reactive protein
  • lactoferrin lactoferrin
  • anti-lactoferrin antibodies calprotectin, hemoglobin, NOD2/CARD 15, serotonin reuptake transporter (SERT), tryptophan hydroxylase-1 , 5-hydroxytryptamine (5-HT), lactulose, and the like.
  • classification markers include, without limitation, leptin, SERT, tryptophan hydroxylase-1 , 5-HT, antrum mucosal protein 8, keratin-8, claudin-8, zonulin, corticotropin releasing hormone receptor- 1 (CRHR1), corticotropin releasing hormone receptor-2
  • diagnostic markers can be used to classify IBS into one of its various forms or clinical subtypes.
  • classification markers can be used to classify a sample as an IBS sample or to rule out one or more diseases or disorders associated with IBS-like symptoms.
  • diagnostic markers can be used to classify IBS into one of its various forms or clinical subtypes.
  • classification markers can be used to classify a sample as an IBS sample or to rule out one or more diseases or disorders associated with IBS-like symptoms.
  • diagnostic and classification markers suitable for use in the present invention.
  • the presence or level of at least one diagnostic marker is determined using an assay such as a hybridization assay or an amplification-based assay. Examples of hybridization assays and amplification-based assays suitable for use in the methods of the present invention are described above. In certain other instances, the presence or level of at least one diagnostic marker is determined using an immunoassay or an immunohistochemical assay. Non-limiting examples of immunoassays and
  • binding moiety refers to any class of molecules capable of specifically recognizing a biomarker of interest.
  • binding moieties that are well suited for use in the methods provided herein include proteins, such as monoclonal or polyclonal antibodies and functional fragments thereof (e.g., minibodies, diabodies, triabodies, single chain Fv, F(ab)' , and the like), combinatorially derived proteins from phage display or ribosome display, peptides, nucleic acids, such as aptamers, and other molecules that are capable of specifically recognizing a biomarker of interest.
  • proteins such as monoclonal or polyclonal antibodies and functional fragments thereof (e.g., minibodies, diabodies, triabodies, single chain Fv, F(ab)' , and the like), combinatorially derived proteins from phage display or ribosome display, peptides, nucleic acids, such as aptamers, and other molecules that are capable of specifically recognizing a biomark
  • the term "profile” includes any set of data that represents the distinctive features or characteristics associated with a disease or disorder such as IBS or IBD.
  • the term encompasses a "diagnostic marker profile” that analyzes one or more diagnostic markers in a sample, a "symptom profile” that identifies one or more IBS-related clinical factors (i.e., symptoms) an individual is experiencing or has experienced, and combinations thereof.
  • a "diagnostic marker profile” can include a set of data that represents the presence or level of one or more diagnostic markers associated with IBS and/or IBD.
  • a “symptom profile” can include a set of data that represents the presence, severity, frequency, and/or duration of one or more symptoms associated with IBS and/or IBD.
  • a panel for measuring one or more of the diagnostic markers and/or diagnostic profiles described above can be constructed and used for classifying the sample as an IBS sample or non-IBS sample.
  • the presence or level of a plurality of diagnostic markers can be determined simultaneously or sequentially, using, for example, an aliquot or dilution of the individual's sample.
  • the level of a particular diagnostic marker in the individual's sample is considered to be elevated when it is at least about 10%, 15%, 20%, 25%, 50%, 75%, 100%, 125%,
  • a comparative sample e.g., a normal, GI control, IBD, and/or Celiac disease sample
  • population of samples e.g., greater than a median level of the same marker in a comparative population of normal, GI control, IBD, and/or Celiac disease samples.
  • the level of a particular diagnostic marker in the individual's sample is considered to be lowered when it is at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% less than the level of the same marker in a comparative sample (e.g., a normal, GI control, IBD, and/or Celiac disease sample) or population of samples (e.g., less than a median level of the same marker in a comparative population of normal, GI control, IBD, and/or Celiac disease samples).
  • a comparative sample e.g., a normal, GI control, IBD, and/or Celiac disease sample
  • population of samples e.g., less than a median level of the same marker in a comparative population of normal, GI control, IBD, and/or Celiac disease samples.
  • the term "individual,” “subject,” or “patient” typically refers to humans, but also to other animals including, e.g., other primates, rodents, canines, felines, equines, ovines, porcines, and the like.
  • substantially the same amino acid sequence includes an amino acid sequence that is similar, but not identical to, the naturally-occurring amino acid sequence.
  • an amino acid sequence that has substantially the same amino acid sequence as a naturally-occurring peptide, polypeptide, or protein can have one or more modifications such as amino acid additions, deletions, or substitutions relative to the amino acid sequence of the naturally-occurring peptide, polypeptide, or protein, provided that the modified sequence retains substantially at least one biological activity of the naturally- occurring peptide, polypeptide, or protein such as immunoreactivity.
  • Comparison for substantial similarity between amino acid sequences is usually performed with sequences between about 6 and 100 residues, preferably between about 10 and 100 residues, and more preferably between about 25 and 35 residues.
  • a particularly useful modification of a peptide, polypeptide, or protein of the present invention, or a fragment thereof, is a modification that confers, for example, increased stability.
  • Incorporation of one or more D-amino acids is a modification useful in increasing stability of a polypeptide or polypeptide fragment.
  • deletion or substitution of lysine residues can increase stability by protecting the polypeptide or polypeptide fragment against degradation.
  • the term "monitoring the progression or regression of IBS” includes the use of the methods, systems, and code of the present invention to determine the disease state (e.g., presence or severity of IBS) of an individual.
  • the results of an algorithm e.g., a learning statistical classifier system
  • the methods, systems, and code of the present invention can be used to predict the progression of IBS, e.g., by determining a likelihood for IBS to progress either rapidly or slowly in an individual based on an analysis of diagnostic markers and/or the identification or IBS-related symptoms.
  • the methods, systems, and code of the present invention can be used to predict the regression of IBS, e.g., by determining a likelihood for IBS to regress either rapidly or slowly in an individual based on an analysis of diagnostic markers and/or the identification or IBS-related symptoms.
  • the term "monitoring drug efficacy in an individual receiving a drug useful for treating IBS" includes the use of the methods, systems, and code of the present invention to determine the effectiveness of a therapeutic agent for treating IBS after it has been administered.
  • the results of an algorithm e.g., a learning statistical classifier system
  • a drug useful for treating IBS is any compound or drug used to improve the health of the individual and includes, without limitation, IBS drugs such as serotonergic agents, antidepressants, chloride channel activators, chloride channel blockers, guanylate cyclase agonists, antibiotics, opioids, neurokinin antagonists, antispasmodic or anticholinergic agents, belladonna alkaloids, barbiturates, glucagon-like peptide- 1 (GLP-1 ) analogs, corticotropin releasing factor (CRF) antagonists, probiotics, free bases thereof, pharmaceutically acceptable salts thereof, derivatives thereof, analogs thereof, and combinations thereof.
  • IBS drugs such as serotonergic agents, antidepressants, chloride channel activators, chloride channel blockers, guanylate cyclase agonists, antibiotics, opioids, neurokinin antagonists, antispasmodic or anticholinergic agents, belladonna alkaloids, barbiturates, glucagon-like peptid
  • a therapeutically effective amount or dose includes a dose of a drug that is capable of achieving a therapeutic effect in a subject in need thereof.
  • a therapeutically effective amount of a drug useful for treating IBS can be the amount that is capable of preventing or relieving one or more symptoms associated with IBS.
  • the exact amount can be ascertainable by one skilled in the art using known techniques (see, e.g. , Lieberman, Pharmaceutical Dosage Forms, Vols. 1 -3 (1992); Lloyd, The Art, Science arid Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, Gennaro, Ed., Lippincott, Williams & Wilkins (2003)).
  • the present invention provides methods, systems, and code for aiding in the diagnosis of irritable bowel syndrome in a subject. Similarly, the present invention provides methods, systems, and code for accurately classifying whether a sample from an individual is associated with irritable bowel syndrome (IBS).
  • IBS irritable bowel syndrome
  • the present invention relies on the use of a statistical algorithm (e.g., a learning statistical classifier system) and/or empirical data (e.g., the presence or level of an IBS marker).
  • the present invention is also useful for ruling out one or more diseases or disorders that present with IBS-like symptoms and ruling in IBS using a combination of statistical algorithms and/or empirical data.
  • the present invention provides an accurate diagnostic prediction of IBS and prognostic information useful for guiding treatment decisions.
  • IBS Irritable Bowel Syndrome
  • the present invention provides methods for aiding in the diagnosis of irritable bowel syndrome in a subject by determining the level of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, or more of the biomarkers shown in Table 1 .
  • the methods provided herein rely on the detection of at least one biomarker selected from the group consisting of carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone-binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase-activating peptide, serotonin, tryptophan, serotonin O-sulfate, 5-hydroxyindoleacetic acid, 5-HT glucuronide, tyrosine, phenylalanine, UDP-glucuronosyltransferase 1 -6, serotonin reuptake transporter, tryptophan hydroxylase 1 , monoamine oxidase A, monoamine oxidase B, hydroxytryptamine (seroton
  • methods for aiding in the diagnosis of irritable bowel syndrome in a subject by determining the level of at least one biomarker selected from carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone-binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase-activating peptide, serotonin, tryptophan, serotonin O-sulfate, 5- hydroxyindoleacetic acid, 5-HT glucuronide, tyrosine, phenylalanine, UDP- glucuronosyltransferase 1 -6, serotonin reuptake transporter, tryptophan hydroxylase 1 , monoamine oxidase A, monoamine oxid
  • TRIP-1 Metalloproteinase-l
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • CBDA Anti- CBir- 1 Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti- Human Tissue Transglutaminase IgA
  • PGE? prostaglandin E 2
  • methods for aiding in the diagnosis of irritable bowel syndrome in a subject by determining the level of at least one biomarker selected from carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone- binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase-activating peptide, serotonin, tryptophan, serotonin O-sulfate, 5- hydroxyindoleacetic acid, 5-HT glucuronide, tyrosine, phenylalanine, UDP- glucuronosyltransferase 1 -6, serotonin reuptake transporter, tryptophan hydroxylase 1 , monoamine oxidase A, monoamine oxid
  • CXCL4/PF-4, and/or CXCL7/NAP-2 growth factor
  • growth factor e.g., EGF, VEGF, PEDF, BDNF, and/or SDGF
  • anti-neutrophil antibody e.g., ANCA, pANCA, cANCA, NSNA, and/or
  • SAPPA SAPPA
  • ASCA e.g., ASCA-IgA, ASCA-IgG, and/or ASCA-IgM
  • antimicrobial antibody e.g., anti-OmpC antibody, anti-flagellin antibody, and/or anti-I2 antibody
  • lactoferrin anti- tTG antibody
  • lipocalin e.g., NGAL, NGAL/MMP-9 complex
  • MMP e.g., MMP-9
  • TIMP e.g., TIMP-1
  • alpha-globulin e.g., alpha-2-macroglobulin, haptoglobin, and/or
  • actin-severing protein e.g., gelsolin
  • S 100 protein e.g., calgranulin
  • fibrinopeptide e.g., FIB A
  • CGRP tachykinin
  • ghrelin neurotensin
  • corticotropin-releasing hormone and combinations thereof.
  • the presence or level of other diagnostic markers such as, for example, anti-lactoferrin antibody, L-selectin/CD62L, elastase, C-reactive protein (CRP), calprotectin, anti-U l -70 kDa autoantibody, zona occludens 1 (ZO-1 ), vasoactive intestinal peptide (VIP), serum amyloid A, gastrin, ⁇ -tryptase, histamine, prostaglandin E 2 (PGE 2 ), and a combination thereof may also be detected.
  • diagnostic markers such as, for example, anti-lactoferrin antibody, L-selectin/CD62L, elastase, C-reactive protein (CRP), calprotectin, anti-U l -70 kDa autoantibody, zona occludens 1 (ZO-1 ), vasoactive intestinal peptide (VIP), serum amyloid A, gastrin, ⁇ -tryptase,
  • the present invention provides a method for classifying whether a sample from an individual is associated with IBS, the method comprising: (a) determining a diagnostic marker profile by detecting the presence or level of at least one diagnostic marker in the sample; (b) classifying the sample as an IBD sample or non-IBD sample using a first statistical algorithm based upon the diagnostic marker profile; and if the sample is classified as a non-IBD sample, (c) classifying the non-IBD sample as an IBS sample or non-IBS sample using a second statistical algorithm based upon the same diagnostic marker profile as determined in step (a) or a different diagnostic marker profile.
  • the diagnostic markers used for ruling out IBD can be the same as the diagnostic markers used for ruling in IBS. Alternatively, the diagnostic markers used for ruling out IBD can be different than the diagnostic markers used for ruling in IBS.
  • the method of first ruling out IBD i.e., classifying the sample as an IBD sample or non-IBD sample
  • ruling in IBS i.e., classifying the non-IBD sample as an IBS sample or non-IBS sample
  • the diagnostic marker profile and the symptom profile can be determined simultaneously or sequentially in any order.
  • the methods of the present invention further comprise ruling out intestinal inflammation.
  • intestinal inflammation include acute inflammation, diverticulitis, ileal pouch-anal anastomosis, microscopic colitis, infectious diarrhea, and combinations thereof.
  • the intestinal inflammation is ruled out based upon the presence or level of C-reactive protein (CRP), lactoferrin, calprotectin, or combinations thereof.
  • CRP C-reactive protein
  • the methods of the present invention can further comprise ' sending the IBS classification results to a clinician, e.g., a gastroenterologist or a general practitioner.
  • the methods can also provide a diagnosis in the form of a probability that the individual has IBS.
  • the individual can have about a 0%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or greater probability of having IBS.
  • the methods of the present invention further provide a prognosis of IBS in the individual.
  • the prognosis can be surgery, development of a category or clinical subtype of IBS, development of one or more symptoms, or recovery from the disease. 1.
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: (a) contacting a blood or serum sample from the subject with an IBS marker binding moiety under conditions suitable to transform the IBS marker present in the sample into a complex comprising the IBS marker and the IBS marker binding moiety; and (b) determining the level of the complex, thereby determining the level of the IBS marker present in the sample, wherein the IBS marker is selected from the group consisting of carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone-binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase-activating peptide, serotonin, tryptophan, seroton
  • the method further comprises: (c) comparing the level of the IBS marker present in the sample to a control level, wherein a difference in the level of the IBS marker present in the sample relative to the control level is indicative of an increased likelihood of the subject having IBS.
  • the present invention provides an assay to aid in the diagnosis of IBS, the assay comprising: (a) contacting a sample having an IBS marker contained therein under conditions suitable to transform the IBS marker into a complex comprising the IBS marker and a capture anti-IBS marker antibody; (b) contacting the complex with an enzyme labeled indicator antibody to transform the complex into a labeled complex; (c) contacting the labeled complex with a substrate for the enzyme; and (d) detecting the presence or level of the IBS marker in the sample, wherein the IBS marker is selected from the group consisting of carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone-binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase
  • a control level is the level of the IBS marker present in a blood or serum sample from a healthy subject or an average level of the IBS marker present in blood or serum samples from a cohort of healthy subjects.
  • a control level is the level of the IBS marker present in a blood or serum sample from a non-IBS subject or an average level of the IBS marker present in blood or serum samples from a cohort of non-IBS subjects.
  • a control level is the level of the IBS marker present in a blood or serum sample from a diseased subject or an average level of the IBS marker present in blood or serum samples from a cohort of diseased subjects.
  • Non- limiting examples of diseased subjects that are useful for determining a control level from include subjects with IBS, subjects with a non-IBS gastrointestinal disease, subjects with inflammatory bowel disease (IBD), subjects with ulcerative colitis (UC), subjects with Crohn's disease (CD), subjects with celiac disease, subjects with gastroesophageal reflux disease (GERD), subjects with cancer, subjects with a cancer of the gastrointestinal tract, subjects with a cancer of the stomach, subjects with a cancer of the small or large bowel, and the like.
  • IBS inflammatory bowel disease
  • IBD inflammatory bowel disease
  • UC ulcerative colitis
  • CD Crohn's disease
  • celiac disease subjects with celiac disease
  • gastroesophageal reflux disease GEF
  • subjects with cancer subjects with a cancer of the gastrointestinal tract, subjects with a cancer of the stomach, subjects with a cancer of the small or large bowel, and the like.
  • control level is a level of the IBS marker in a blood or serum sample of a healthy subject or healthy subjects
  • an increased level of the IBS marker present in a sample from a subject, relative to the control level is indicative of an increased likelihood of the subject having IBS.
  • control is a healthy subject or subjects
  • a similar or reduced level of the IBS marker present in a sample from a subject, relative to the control level is indicative of an increased likelihood of the subject not having IBS.
  • control level is a level of the IBS marker in a blood or serum sample of a subject or subjects with IBS
  • a similar or increased level of the IBS marker present in a sample from a subject, relative to the control level is indicative of an increased likelihood of the subject having IBS.
  • control is a subject or subjects with IBS
  • a reduced level of the IBS marker present in a sample from a subject, relative to the control level is indicative of an increased likelihood of the subject not having IBS.
  • methods for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising the detection of an IBS marker in a blood or serum sample and at least one additional blood or serum biomarker selected from ⁇ - tryptase , histamine and prostaglandin E 2 (PGE 2 ).
  • the method comprises detecting or determining the level of the IBS marker and ⁇ -tryptase from a blood or serum sample from a subject.
  • the method comprises detecting or determining the level of the IBS marker and PGE? from a blood or serum sample from a subject.
  • the method comprises detecting or determining the level of the IBS marker and histamine from a blood or serum sample from a subject. In yet another embodiment, the method comprises detecting or determining the level of the IBS marker, ⁇ - tryptase, histamine, and PGE 2 from a blood or serum sample from a subject. Preferably, the IBS marker, ⁇ -tryptase, histamine, and/or PGE 2 are detected from the same blood or serum sample, although in certain instances the biomarkers may be detected in different blood or serum samples taken from the same individual, for example, at the same time or at different times.
  • the biomarkers may be detected in separate assays performed with different aliquots of a blood or serum sample from a subject. In other embodiments, the biomarkers may be detected in a single multiplex detection assay, for example, in a
  • methods for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising the detection of the IBS marker in a blood or serum sample and at least one additional biomarker selected from Brain- Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti- Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), ⁇ -tryptase, hist
  • BDNF Brain- Derived Neurotropic Fact
  • the sample used for detecting or determining the presence or level of at least one diagnostic marker is typically whole blood, plasma, serum, saliva, urine, stool (i.e., feces), tears, and any other bodily fluid, or a tissue sample (i.e., biopsy) such as a small intestine or colon sample.
  • a tissue sample i.e., biopsy
  • the methods of the present invention further comprise obtaining the sample from the individual prior to detecting or determining the presence or level of at least one diagnostic marker in the sample.
  • the additional biomarker may be detected from a blood or serum sample.
  • the additional biomarker may be detected from a stool sample or a biopsy from the bowel of the subject.
  • the method comprises detecting or determining the level of the IBS marker from a blood or serum sample and Brain-Derived Neurotropic Factor (BDNF) from a biological sample.
  • BDNF Brain-Derived Neurotropic Factor
  • Brain-Derived Neurotropic Factor (BDNF) is detected in a blood or serum sample from the subject.
  • Brain-Derived Neurotropic Factor (BDNF) is detected in a stool sample or a biopsy from the bowel of the subject.
  • at least one additional biomarker is also detected.
  • the method comprises detecting or determining the level of the IBS marker from a blood or serum sample and Neutrophil Gelatinase-Associated Lipocalin (NGAL) from a biological sample.
  • Neutrophil Gelatinase-Associated Lipocalin (NGAL) is detected in a blood or serum sample from the subject.
  • Neutrophil Gelatinase-Associated Lipocalin (NGAL) is detected in a stool sample or a biopsy from the bowel of the subject.
  • at least one additional biomarker is also detected.
  • the method comprises detecting or determining the level of the IBS marker from a blood or serum sample and TNF-related Weak Inducer of Apoptosis (TWEAK) from a biological sample.
  • TNF-related Weak Inducer of Apoptosis TWEAK
  • TNF-related Weak Inducer of Apoptosis TWEAK
  • TWEAK TNF-related Weak Inducer of Apoptosis
  • at least one additional biomarker is also detected.
  • the method comprises detecting or determining the level of the IBS marker from a blood or serum sample and Growth-Related Oncogene Alpha (GRO-a) from a biological sample.
  • Growth-Related Oncogene Alpha (GRO-a) is detected in a blood or serum sample from the subject.
  • Growth-Related Oncogene Alpha (GRO-a) is detected in a stool sample or a biopsy from the bowel of the subject.
  • at least one additional biomarker is also detected.
  • the method comprises detecting or determining the level of the IBS marker from a blood or serum sample and Interleukin-1 Beta (IL-1 ⁇ ) from a biological sample.
  • Interleukin- 1 Beta (IL- ⁇ ⁇ ) is detected in a blood or serum sample from the subject.
  • Interleukin-1 Beta (IL-1 ⁇ ) is detected in a stool sample or a biopsy from the bowel of the subject.
  • At least one additional biomarker is also detected.
  • the method comprises detecting or determining the level of the IBS marker from a blood or serum sample and Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ) from a biological sample.
  • Tissue Inhibitor of Metalloproteinase- 1 Tissue Inhibitor of Metalloproteinase- 1
  • Metalloproteinase- 1 is detected in a blood or serum sample from the subject.
  • Tissue Inhibitor of Metalloproteinase- 1 is detected in a stool sample or a biopsy from the bowel of the subject.
  • at least one additional biomarker is also detected.
  • the method comprises detecting or determining the level of the IBS marker from a blood or serum sample and Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA) from a biological sample.
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • Anti-Saccharomyces cerevisiae Antibody is detected in a blood or serum sample from the subject. In another preferred embodiment, Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA) is detected in a stool sample or a biopsy from the bowel of the subject. In other embodiments, at least one additional biomarker is also detected.
  • the method comprises detecting or determining the level of the IBS marker from a blood or serum sample and Anti-CBir-1 Antibody (CBirl ) from a biological sample.
  • Anti-CBir- 1 Antibody (CBirl ) is detected in a blood or serum sample from the subject.
  • Antibody (CBirl ) is detected in a stool sample or a biopsy from the bowel of the subject. In other embodiments, at least one additional biomarker is also detected.
  • the method comprises detecting or determining the level of the IBS marker from a blood or serum sample and Anti-Human Neutrophil Cytoplasmic Antibody (ANCA) from a biological sample.
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • ANCA Neutrophil Cytoplasmic Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti-Human Tissue Transglutaminase IgA
  • Transglutaminase IgA is detected in a blood or serum sample from the subject.
  • Anti-Human Tissue Transglutaminase IgA (tTG) is detected in a stool sample or a biopsy from the bowel of the subject.
  • at least one additional biomarker is also detected.
  • the method comprises detecting or determining the level of the IBS marker from a blood or serum sample and all of Brain-Derived Neurotropic Factor
  • BDNF Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK TNF-related Weak Inducer of Apoptosis
  • GRO-a Growth-Related Oncogene Alpha
  • IL- 1 ⁇ Interleukin-1 Beta
  • Tissue Inhibitor of Metalloproteinase-1 Tissue Inhibitor of Metalloproteinase-1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), and Anti-Human Tissue Transglutaminase IgA (tTG) from a blood or serum sample, a stool sample, or a biopsy from the bowel of the subject.
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • CBirl Anti-CBir-1 Antibody
  • ANCA Anti
  • the presence or level of at least one diagnostic marker is determined using an assay such as a hybridization assay or an amplification-based assay.
  • an assay such as a hybridization assay or an amplification-based assay.
  • hybridization assays suitable for use in the methods of the present invention include, but are not limited to, Northern blotting, dot blotting, RNase protection, and a combination thereof.
  • a non-limiting example of an amplification-based assay suitable for use in the methods of the present invention includes a reverse transcriptase-polymerase chain reaction (RT-PCR).
  • the presence or level of at least one diagnostic marker is determined using an immunoassay or an immunohistochemical assay.
  • An immunoassay suitable for use in the methods of the present invention includes an enzyme-linked immunosorbent assay (ELISA).
  • ELISA enzyme-linked immunosorbent assay
  • immunohistochemical assays suitable for use in the methods of the present invention include, but are not limited to, immunofluorescence assays such as direct fluorescent antibody assays, indirect fluorescent antibody (IFA) assays, anticomplement immunofluorescence assays, and avidin-biotin immunofluorescence assays. Other types of immunohistochemical assays include immunoperoxidase assays.
  • the presence or level of the IBS marker is determined using a sandwich enzyme-linked immunosorbent assay (ELISA).
  • ELISA sandwich enzyme-linked immunosorbent assay
  • Any suitable antibody pair may be used for the capture and detecting antibodies in a sandwich ELISA.
  • the detecting antibody will be conjugated to an enzyme, for example, alkaline phophatase, to aid in the detection of the complex.
  • a secondary antibody conjugated to an enzyme e.g. , alkaline phophatase
  • alkaline phophatase a secondary antibody conjugated to an enzyme
  • the complex will then be detected by the use of a luminescent substrate, for example, Ultra LITETM (NAG Research Laboratories); SensoLyte® (AnaSpec); SuperSignal ELISA Femto Maximum Sensitivity Substrate (Thermo Scientific); SuperSignal ELISA Pico Chemiluminescent Substrate (Thermo Scientific); CPSD (disodium 3-(4-methoxyspiro ⁇ 1 ,2- dioxetane-3,2'-(5'-chloro)tricyclo[3.3.1 .13,7]decan ⁇ -4-yl)phenyl phosphate; Tropix, Inc).
  • a luminescent substrate for example, Ultra LITETM (NAG Research Laboratories); SensoLyte® (AnaSpec); SuperSignal ELISA Femto Maximum Sensitivity Substrate (Thermo Scientific); SuperSignal ELISA Pico Chemiluminescent Subst
  • the ⁇ -tryptase sandwich ELISA comprises the use of an alkaline phosphatase conjugated anti-tryptase antibody as the detecting antibody and a CPSD containing luminescent substrate to enhance the assay sensitivity.
  • the CPSD substrate can be found in chemiluminescent detection systems, such as the ELISA-LightTM System (Applied Biosystems).
  • the methods provided herein further include the step of determining a symptom profile for the subject, wherein the symptom profile is determined by identifying the presence or severity of at least one symptom in the subject.
  • the method comprises: (d) determining a symptom profile for the subject, wherein the symptom profile is determined by identifying the presence or severity of at least one symptom in the subject; and (e) diagnosing the subject as having IBS or not having IBS using an algorithm based upon the level of an IBS biomarker and the system profile.
  • the method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprises determining a diagnostic marker profile, for example for the IBS marker or a combination thereof as described herein, optionally in combination with a symptom profile, wherein the symptom profile is determined by identifying the presence or severity of at least one symptom in the individual; and classifying the sample as an IBS sample or non-IBS sample using an algorithm based upon the diagnostic marker profile and the symptom profile.
  • a diagnostic marker profile for example for the IBS marker or a combination thereof as described herein, optionally in combination with a symptom profile, wherein the symptom profile is determined by identifying the presence or severity of at least one symptom in the individual.
  • the symptom profile is typically determined by identifying the presence or severity of at least one symptom selected from the group consisting of chest pain, chest discomfort, heartburn, uncomfortable fullness after having a regular-sized meal, inability to finish a regular-sized meal, abdominal pain, abdominal discomfort, constipation, diarrhea, bloating, abdominal distension, negative thoughts or feelings associated with having pain or discomfort, and combinations thereof.
  • the presence or severity of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more of the symptoms described herein is identified to generate a symptom profile that is useful for predicting IBS.
  • a questionnaire or other form of written, verbal, or telephone survey is used to produce the symptom profile.
  • the questionnaire or survey typically comprises a standardized set of questions and answers for the purpose of gathering information from respondents regarding their current and/or recent IBS-related symptoms.
  • the symptom profile is produced by compiling and/or analyzing all or a subset of the answers to the questions set forth in the questionnaire or survey. In other embodiments, the symptom profile is produced based upon the individual's response to the following question: "Are you currently experiencing any symptoms?" The symptom profile generated in accordance with either of these embodiments can be used in combination with a diagnostic marker profile in the algorithmic-based methods described herein to improve the accuracy of predicting IBS.
  • the methods provided herein further include providing a probability that a subject has IBS. In certain embodiments, the method may comprise providing a probability that the is subject highly unlikely, unlikely, likely, or highly likely has IBS.
  • methods are provided that further include providing a probability that a sample classified as an IBS sample or a non-IBS sample is from a subject with IBS.
  • the method may comprise providing a probability that the is sample is from a subject that highly unlikely, unlikely, likely, or highly likely has IBS.
  • the methods provided herein further include classifying a diagnosis of IBS as IBS-constipation (IBS-C), IBS-diarrhea (IBS-D), IBS-mixed (IBS-M), IBS-alternating (IBS-A), or post-infectious IBS (IBS-PI).
  • methods are provided herein to further classify a sample as an IBS-constipation (IBS-C), IBS-diarrhea (IBS-D), IBS-mixed (IBS-M), IBS-alternating (IBS-A), or post-infectious IBS (IBS-PI) sample.
  • the present invention provides an assay to aid in the differentiation of IBS-D and IBS-A from IBS-C, the assay comprising: (a) contacting a sample having an IBS marker contained therein under conditions suitable to transform the IBS marker into a complex comprising the IBS marker and a capture anti-IBS marker antibody; (b) contacting the complex with an enzyme labeled indicator antibody to transform the complex into a labeled complex; (c) contacting the labeled complex with a substrate for the enzyme; and (d) detecting the presence or level of the IBS marker in the sample.
  • the assay to aid in the differentiation of IBS-D and IBS-A from IBS-C further comprises detecting the presence or level of ⁇ -tryptase, a prostaglandin (e.g., PGE 2 ), and/or histamine in the sample.
  • a prostaglandin e.g., PGE 2
  • methods provided herein further include diagnosing a subject not having IBS as having IBD, as not having IBD, as having celiac disease, as not having celiac disease, as being a healthy subject, or as not having a gastrointestinal disease.
  • methods are provided herein that further classify a non-IBS sample as an IBD sample, a non-IBD sample, a healthy sample, a non-gastrointestinal disease sample, a celiac sample, and the like.
  • the methods provided herein comprise the use of an algorithm based upon the level of an IBS biomarker.
  • the algorithm is further based upon the system profile.
  • the algorithm comprises a statistical algorithm, for example a learning statistical classifier system.
  • the algorithm comprises a combination of at least two learning statistical classifier systems.
  • the combination of at least two learning statistical classifier systems comprises a random forest classifier and a neural network classifier.
  • the present invention provides a method for aiding in the dignois of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration of a stress marker in a biological sample from the subject (e.g., a blood or serum sample).
  • IBS dignois of irritable bowel syndrome
  • the level or concentration of the stress marker may be determined by various methods known in the art, including without limitation, immunoassays, for example, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme-linked immunosorbent assay (ELISA), antigen capture ELISA, sandwich ELISA, IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA); immunoradiometric assays (IRMA); fluorescence polarization immunoassays (FPIA); and chemiluminescence assays (CL); marker purification, for example, by high pressure liquid chromatography (HPLC), alone or in combination with mass spectrometry (e.g., MALDI/MS, MALDI- TOF/MS, SELDI-TOF/MS, tandem MS, etc.); and other well known methods including, without limitation,
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a stress marker binding moiety under conditions suitable to transform the stress marker present in the sample into a complex comprising the stress marker and the stress marker binding moiety; and determining the level of said complex, thereby determining the level or concentration of the stress marker present in the sample.
  • the stress marker is selected from urocortin (Ucn), corticotrophin- releasing hormone-binding protein (CRFBP), Cortisol, adrenocorticotropic hormone, and a combination thereof.
  • the method provided above further comprises a step of comparing the level or concentration of the stress marker present in the sample to a control level or concentration, wherein a difference in the level or concentration of the stress marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS.
  • control level or concentration is the level or concentration of the stress marker present in a blood or serum sample from a healthy subject
  • an increased level or concentration of the stress marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • the same or a reduced level or concentration of the stress marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • control level or concentration is the level or concentration of the stress marker present in a blood or serum sample from a subject with IBS
  • same or an increased level or concentration of the stress marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • a reduced level or concentration of the stress marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • IBS irritable bowel syndrome
  • a stress marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase-1 (TIMP-1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir- 1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, prostaglandin
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a urocortin binding moiety under conditions suitable to transform urocortin present in the sample into a complex comprising urocortin and the urocortin binding moiety; and determining the level of said complex, thereby determining the level or concentration of urocortin present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK TNF-related Weak Inducer of Apoptosis
  • Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, and prostaglandin E? (PGE 2 ).
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a corticotrophin-releasing hormone-binding protein binding moiety under conditions suitable to transform corticotrophin-releasing hormone- binding protein present in the sample into a complex comprising corticotrophin-releasing hormone-binding protein and the corticotrophin-releasing hormone-binding protein binding moiety; and determining the level of said complex, thereby determining the level or concentration of corticotrophin-releasing hormone-binding protein present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of BDNF, Neurotrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of BDNF, Neurotrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of BDNF, TNF-related Weak Inducer of BDNF, Neurotrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of BDNF, Neurotrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of BDNF
  • TWEAK Treatment-Related Oncogene Alpha
  • GRO-a Growth-Related Oncogene Alpha
  • IL- 1 ⁇ Interleukin- 1 Beta
  • Tissue Inhibitor of Metalloproteinase-1 Tissue Inhibitor of Metalloproteinase-1
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • Birl Anti-CBir-1 Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti-Human Tissue Transglutaminase IgA
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a Cortisol binding moiety under conditions suitable to transform Cortisol present in the sample into a complex comprising Cortisol and the Cortisol binding moiety; and determining the level of said complex, thereby determining the level or concentration of Cortisol present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase-1 ( ⁇ - 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-lgA), Anti-CBir-1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK TNF-related Weak Inducer of Apoptosis
  • GRO-a Growth-Related Oncogene
  • Transglutaminase IgA tTG
  • histamine histamine
  • ⁇ -tryptase histamine
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with an adrenocorticotropic hormone binding moiety under conditions suitable to transform adrenocorticotropic hormone present in the sample into a complex comprising adrenocorticotropic hormone and the adrenocorticotropic hormone binding moiety; and determining the level of said complex, thereby determining the level or concentration of adrenocorticotropic hormone present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (T
  • TRIP-1 Metalloproteinase- 1
  • ASCA-lgA Anti-Saccharomyces cerevisiae Antibody
  • CBDA Anti- CBir- 1 Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti- Human Tissue Transglutaminase IgA
  • PGE 2 prostaglandin E 2
  • the present invention provides a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration of a gastrointestinal hormone in a biological sample from the subject (e.g. , a blood or serum sample).
  • a biological sample from the subject e.g. , a blood or serum sample.
  • the level or concentration of the gastrointestinal hormone may be determined by various methods known in the art, including without limitation,
  • immunoassays for example, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme-linked immunosorbent assay (ELISA), antigen capture ELISA, sandwich ELISA, IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA); immunoradiometric assays (IRMA); fluorescence polarization immunoassays (FPIA); and chemiluminescence assays (CL); marker
  • EIA enzyme immunoassays
  • EMIT enzyme multiplied immunoassay technique
  • ELISA enzyme-linked immunosorbent assay
  • MAC ELISA enzyme-linked immunosorbent assay
  • MEIA microparticle enzyme immunoassay
  • CEIA capillary electrophoresis immunoassays
  • RIA radioimmunoassays
  • HPLC high pressure liquid chromatography
  • mass spectrometry e.g., MALDI/MS, MALDI-TOF/MS, SELDI-TOF/MS, tandem MS, etc.
  • mass spectrometry e.g., MALDI/MS, MALDI-TOF/MS, SELDI-TOF/MS, tandem MS, etc.
  • MS mass spectrometry
  • other well known methods including, without limitation, Bradford assays, Coomassie blue staining, silver staining, assays for radiolabeled protein, and mass spectrometry.
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a gastrointestinal hormone binding moiety under conditions suitable to transform the gastrointestinal hormone present in the sample into a complex comprising the gastrointestinal hormone and the gastrointestinal hormone binding moiety; and determining the level of said complex, thereby determining the level or concentration of the gastrointestinal hormone present in the sample.
  • IBS irritable bowel syndrome
  • the gastrointestinal hormone is selected from substance P, nerve growth factor (NGF), neurokinin A, neurokinin B, vasoactive intestinal peptide (VIP), glucagon-like peptide 2 (GLP-2), motilin, pituitary adenylate cyclase-activating peptide (PACAP), and a combination thereof.
  • NGF nerve growth factor
  • VIP vasoactive intestinal peptide
  • GLP-2 glucagon-like peptide 2
  • motilin motilin
  • PACAP pituitary adenylate cyclase-activating peptide
  • the method provided above further comprises a step of comparing the level or concentration of the gastrointestinal hormone present in the sample to a control level or concentration, wherein a difference in the level or concentration of the gastrointestinal hormone present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS.
  • control level or concentration is the level or concentration of the gastrointestinal hormone present in a blood or serum sample from a healthy subject
  • an increased level or concentration of the gastrointestinal hormone present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS, while the same or a reduced level or concentration of the gastrointestinal hormone present in the sample relative to the control level or
  • concentration is indicative of an increased likelihood of said subject not having IBS.
  • control level or concentration is the level or concentration of the gastrointestinal hormone present in a blood or serum sample from a subject with IBS
  • the same or an increased level or concentration of the gastrointestinal hormone present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • a reduced level or concentration of the gastrointestinal hormone present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • IBS irritable bowel syndrome
  • methods for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration of a gastrointestinal hormone and at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF- related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase-1 (TIMP-1 ), Anti- Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir- 1 Antibody (CBirl ), Anti- Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, prostaglandin E2 (
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a substance P binding moiety under conditions suitable to transform substance P present in the sample into a complex comprising substance P and the substance P binding moiety; and determining the level of said complex, thereby determining the level or concentration of substance P present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (T
  • TRIP-1 Metalloproteinase- 1
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • CBirl Anti- CBir-1 Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti- Human Tissue Transglutaminase IgA
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a nerve growth factor binding moiety under conditions suitable to transform nerve growth factor present in the sample into a complex comprising nerve growth factor and the nerve growth factor binding moiety; and determining the level of said complex, thereby determining the level or concentration of nerve growth factor present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gel atinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP-1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, and prostaglandin E 2 (PGE 2 ).
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a neurokinin A binding moiety under conditions suitable to transform neurokinin A present in the sample into a complex comprising neurokinin A and the neurokinin A binding moiety; and determining the level of said complex, thereby determining the level or concentration of neurokinin A present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK Growth-Related Oncogene Alpha
  • GRO-a Growth-Related Oncogene Alpha
  • IL- ⁇ ⁇ Interleukin-1 Beta
  • Tissue Inhibitor of Metalloproteinase- 1 Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody
  • ASCA-IgA Anti-CBir- 1 Antibody
  • CBDA Anti -Human Neutrophil Cytoplasmic Antibody
  • ANCA Anti-Human Tissue Transglutaminase IgA (tTG)
  • histamine histamine
  • ⁇ -tryptase prostaglandin E 2
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a neurokinin B binding moiety under conditions suitable to transform neurokinin B present in the sample into a complex comprising neurokinin B and the neurokinin B binding moiety; and determining the level of said complex, thereby determining the level or concentration of neurokinin B present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK Growth-Related Oncogene Alpha
  • GRO-a Growth-Related Oncogene Alpha
  • IL- ⁇ ⁇ Interleukin- l Beta
  • Tissue Inhibitor of Metalloproteinase-1 Tissue Inhibitor of Metalloproteinase-1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody
  • ASCA-IgA Anti-CBir- l Antibody
  • CBirl Anti-Human Neutrophil Cytoplasmic Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti-Human Tissue Transglutaminase IgA
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a vasoactive intestinal peptide binding moiety under conditions suitable to transform vasoactive intestinal peptide present in the sample into a complex comprising vasoactive intestinal peptide and the vasoactive intestinal peptide binding moiety; and determining the level of said complex, thereby determining the level or concentration of vasoactive intestinal peptide present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- l Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- l Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apopto
  • TRIP-1 Metalloproteinase-1
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • CBDA Anti- CBir-l Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti- Human Tissue Transglutaminase IgA
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a glucagon-like peptide 2 binding moiety under conditions suitable to transform glucagon-like peptide 2 present in the sample into a complex comprising glucagon-like peptide 2 and the glucagon-like peptide 2 binding moiety; and determining the level of said complex, thereby determining the level or concentration of glucagon-like peptide 2 present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin-l Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase-1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir- 1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK TNF-related Weak Inducer of Apoptosis
  • GRO-a Growth-Related
  • Transglutaminase IgA tTG
  • histamine histamine
  • ⁇ -tryptase histamine
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a motilin binding moiety under conditions suitable to transform motilin present in the sample into a complex comprising motilin and the motilin binding moiety; and determining the level of said complex, thereby determining the level or concentration of motilin present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase-1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK TNF-related Weak Inducer of Apoptosis
  • GRO-a Growth-Related On
  • Transglutaminase IgA tTG
  • histamine histamine
  • ⁇ -tryptase histamine
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a pituitary adenylate cyclase-activating peptide binding moiety under conditions suitable to transform pituitary adenylate cyclase-activating peptide present in the sample into a complex comprising pituitary adenylate cyclase-activating peptide and the pituitary adenylate cyclase-activating peptide binding moiety; and determining the level of said complex, thereby determining the level or concentration of pituitary adenylate cyclase-activating peptide present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK
  • TMP-1 Metalloproteinase-1
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • CBirl Anti- CBir-1 Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti- Human Tissue Transglutaminase IgA
  • PGE 2 prostaglandin E 2
  • the present invention provides a method for aiding in the dignois of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration of a serotonin metabolite in a biological sample from the subject (e.g. , a blood or serum sample).
  • IBS dignois of irritable bowel syndrome
  • the level or concentration of the serotonin metabolite may be determined by various methods known in the art, including without limitation, immunoassays, for example, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme-linked immunosorbent assay (ELISA), antigen capture ELISA, sandwich ELISA, IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA);
  • EIA enzyme immunoassays
  • EMIT enzyme multiplied immunoassay technique
  • ELISA enzyme-linked immunosorbent assay
  • MAC ELISA enzyme-linked immunosorbent assay
  • MEIA microparticle enzyme immunoassay
  • CEIA capillary electrophoresis immunoassays
  • RIA radioimmunoassays
  • IRMA immunoradiometric assays
  • FPIA fluorescence polarization immunoassays
  • CL chemiluminescence assays
  • marker purification for example, by high pressure liquid chromatography (HPLC), alone or in combination with mass spectrometry (e.g., MALDI/MS, MALDI-TOF/MS, SELDI-TOF/MS, tandem MS, etc.); and other well known methods including, without limitation, Bradford assays, Coomassie blue staining, silver staining, assays for radiolabeled protein, and mass spectrometry.
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a serotonin metabolite binding moiety under conditions suitable to transform the serotonin metabolite present in the sample into a complex comprising the serotonin metabolite and the serotonin metabolite binding moiety; and determining the level of said complex, thereby determining the level or concentration of the serotonin metabolite present in the sample.
  • serotonin metabolite is selected from serotonin, tryptophan, serotonin O-sulfate, 5-hydroxyindoleacetic acid, 5-HT glucuronide, and a combination thereof.
  • the method provided above further comprises a step of comparing the level or concentration of the serotonin metabolite present in the sample to a control level or concentration, wherein a difference in the level or concentration of the serotonin metabolite present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS.
  • control level or concentration is the level or concentration of the serotonin metabolite present in a blood or serum sample from a healthy subject
  • an increased level or concentration of the serotonin metabolite present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • the same or a reduced level or concentration of the serotonin metabolite present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • control level or concentration is the level or concentration of the serotonin metabolite present in a blood or serum sample from a subject with IBS
  • same or an increased level or concentration of the serotonin metabolite present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • a reduced level or concentration of the serotonin metabolite present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • IBS irritable bowel syndrome
  • methods for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration of a serotonin metabolite and at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF- related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase-1 (TIMP- 1 ), Anti- Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti- Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase,
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a serotonin binding moiety under conditions suitable to transform serotonin present in the sample into a complex comprising serotonin and the serotonin binding moiety; and determining the level of said complex, thereby determining the level or concentration of serotonin present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL-1 ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir- 1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, and prostaglandin E 2 (PGE 2 ).
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatina
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a tryptophan binding moiety under conditions suitable to transform tryptophan present in the sample into a complex comprising tryptophan and the tryptophan binding moiety; and determining the level of said complex, thereby determining the level or concentration of tryptophan present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- 1 ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- 1 ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (T
  • TRIP- 1 Metalloproteinase- 1
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • CBDA Anti- CBir-1 Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti- Human Tissue Transglutaminase IgA
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a serotonin O-sulfate binding moiety under conditions suitable to transform serotonin O-sulfate present in the sample into a complex comprising serotonin O-sulfate and the serotonin O-sulfate binding moiety; and determining the level of said complex, thereby determining the level or concentration of serotonin O-sulfate present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL-1 ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP-1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, and prostaglandin E 2 (PGE 2 ).
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinas
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a 5-hydroxyindoleacetic acid binding moiety under conditions suitable to transform 5-hydroxyindoleacetic acid present in the sample into a complex comprising 5-hydroxyindoleacetic acid and the 5-hydroxyindoleacetic acid binding moiety; and determining the level of said complex, thereby determining the level or concentration of 5-hydroxyindoleacetic acid present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis
  • TRIP- 1 Metalloproteinase- l
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • CBirl Anti- CBir- 1 Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti- Human Tissue Transglutaminase IgA
  • PGE 2 prostaglandin E2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a 5-HT glucuronide binding moiety under conditions suitable to transform 5-HT glucuronide present in the sample into a complex comprising 5- HT glucuronide and the 5-HT glucuronide binding moiety; and determining the level of said complex, thereby determining the level or concentration of 5-HT glucuronide present in the sample.
  • the method further comprises detecting the level or
  • IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase- l (TIMP-1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir- 1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, and prostaglandin E 2 (PGE 2 ).
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • the present invention provides a method for aiding in the dignois of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration of a serum metabolite in a biological sample from the subject (e.g., a blood or serum sample).
  • IBS dignois of irritable bowel syndrome
  • the level or concentration of the serum metabolite may be determined by various methods known in the art, including without limitation, immunoassays, for example, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme- linked immunosorbent assay (ELISA), antigen capture ELISA, sandwich ELISA, IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA); immunoradiometric assays (IRMA); fluorescence polarization immunoassays (FPIA); and chemiluminescence assays (CL); marker purification, for example, by high pressure liquid chromatography (HPLC), alone or in combination with mass spectrometry (e.g., MALDI/MS, MALDI-TOF/MS, SELDI-TOF/MS, tandem MS, etc.); and other well known methods including,
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a serum metabolite binding moiety under conditions suitable to transform the serum metabolite present in the sample into a complex comprising the serum metabolite and the serum metabolite binding moiety; and determining the level of said complex, thereby determining the level or concentration of the serum metabolite present in the sample.
  • the serum metabolite is selected from tyrosine and/or phenylalanine.
  • the method provided above further comprises a step of comparing the level or concentration of the serum metabolite present in the sample to a control level or concentration, wherein a difference in the level or concentration of the serum metabolite present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS.
  • control level or concentration is the level or concentration of the serum metabolite present in a blood or serum sample from a healthy subject
  • an increased level or concentration of the serum metabolite present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • the same or a reduced level or concentration of the serum metabolite present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • control level or concentration is the level or concentration of the serum metabolite present in a blood or serum sample from a subject with IBS
  • same or an increased level or concentration of the serum metabolite present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • a reduced level or concentration of the serum metabolite present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • IBS irritable bowel syndrome
  • methods for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration of a serum metabolite and at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase,
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a tyrosine binding moiety under conditions suitable to transform tyrosine present in the sample into a complex comprising tyrosine and the tyrosine moiety; and determining the level of said complex, thereby determining the level or concentration of tyrosine present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth -Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase-1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK TNF-related Weak Inducer of Apoptosis
  • GRO-a Growth -Rel
  • Transglutaminase IgA tTG
  • histamine histamine
  • ⁇ -tryptase histamine
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a phenylalanine binding moiety under conditions suitable to phenylalanine present in the sample into a complex comprising phenylalanine and the phenylalanine binding moiety; and determining the level of said complex, thereby determining the level or concentration of phenylalanine present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK Growth-Related Oncogene Alpha
  • GRO-a Growth-Related Oncogene Alpha
  • IL- ⁇ ⁇ Interleukin-1 Beta
  • Tissue Inhibitor of Metalloproteinase-1 Tissue Inhibitor of Metalloproteinase-1
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • Birl Anti-CBir-1 Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • ANCA Anti-Human Tissue Transglutaminase IgA (tTG)
  • histamine histamine
  • ⁇ -tryptase prostaglandin E 2
  • the present invention provides a method for aiding in the dignois of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration of a serotonin pathway marker in a biological sample from the subject (e.g. , a blood or serum sample).
  • IBS dignois of irritable bowel syndrome
  • the level or concentration of the serotonin pathway marker may be determined by various methods known in the art, including without limitation, immunoassays, for example, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme-linked immunosorbent assay (ELISA), antigen capture ELISA, sandwich ELISA, IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA);
  • enzyme immunoassays such as enzyme multiplied immunoassay technique (EMIT), enzyme-linked immunosorbent assay (ELISA), antigen capture ELISA, sandwich ELISA, IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA
  • CEIA capillary electrophoresis immunoassays
  • RIA radioimmunoassays
  • IRMA immunoradiometric assays
  • FPIA fluorescence polarization immunoassays
  • CL chemiluminescence assays
  • marker purification for example, by high pressure liquid chromatography (HPLC), alone or in combination with mass spectrometry ⁇ e.g., MALDI/MS, MALDI-TOF/MS, SELDI-TOF/MS, tandem MS, etc.); and other well known methods including, without limitation, Bradford assays, Coomassie blue staining, silver staining, assays for radiolabeled protein, and mass spectrometry.
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a serotonin pathway marker binding moiety under conditions suitable to transform the serotonin pathway marker present in the sample into a complex comprising the serotonin pathway marker and the serotonin pathway marker binding moiety; and determining the level of said complex, thereby determining the level or concentration of the serotonin pathway marker present in the sample.
  • IBS irritable bowel syndrome
  • the serotonin pathway marker is selected from UDP-glucuronosyltransferase 1 - 6, serotonin reuptake transporter, tryptophan hydroxylase 1 , monoamine oxidase A, monoamine oxidase B, hydroxytryptamine (serotonin) receptor 3A, and a combination thereof.
  • the method provided above further comprises a step of comparing the level or concentration of the serotonin pathway marker present in the sample to a control level or concentration, wherein a difference in the level or concentration of the serotonin pathway marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS.
  • control level or concentration is the level or concentration of the serotonin pathway marker present in a blood or serum sample from a healthy subject
  • an increased level or concentration of the serotonin pathway marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • the same or a reduced level or concentration of the serotonin pathway marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • control level or concentration is the level or concentration of the serotonin pathway marker present in a blood or serum sample from a subject with IBS
  • same or an increased level or concentration of the serotonin pathway marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • a reduced level or concentration of the serotonin pathway marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • methods for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration of a serotonin pathway marker and at least one additional IBS marker selected from Brain- Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP-1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti- Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, prostag
  • BDNF Brain- Derived
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a UDP-glucuronosyltransferase 1 -6 binding moiety under conditions suitable to transform UDP-glucuronosyltransferase 1 -6 present in the sample into a complex comprising UDP-glucuronosyltransferase 1-6 and the UDP- glucuronosyltransferase 1 -6 binding moiety; and determining the level of said complex, thereby determining the level or concentration of UDP-glucuronosyltransferase 1 -6 present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir- 1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, and prostaglandin E 2 (PGE 2 ).
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Ge
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a serotonin reuptake transporter binding moiety under conditions suitable to transform serotonin reuptake transporter present in the sample into a complex comprising serotonin reuptake transporter and the serotonin reuptake transporter binding moiety; and determining the level of said complex, thereby determining the level or concentration of serotonin reuptake transporter present in the sample.
  • the method further comprises detecting the level or concentration of at least one additional
  • IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase- Associated Lipocalin
  • TWEAK TNF-related Weak Inducer of Apoptosis
  • GRO-a Growth- Related Oncogene Alpha
  • IL- ⁇ ⁇ Interleukin-1 Beta
  • TRIP-1 Metalloproteinase-1
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • CBirl Anti- CBir-1 Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti- Human Tissue Transglutaminase IgA
  • PGE 2 prostaglandin E 2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a tryptophan hydroxylase 1 binding moiety under conditions suitable to transform tryptophan hydroxylase 1 present in the sample into a complex comprising tryptophan hydroxylase 1 and the tryptophan hydroxylase 1 binding moiety; and determining the level of said complex, thereby determining the level or concentration of tryptophan hydroxylase 1 present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth- Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of BDNF, Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (T
  • TRIP-1 Metalloproteinase- 1
  • ASCA-IgA Anti-Saccharomyces cerevisiae Antibody
  • CBDA Anti- CBir- 1 Antibody
  • ANCA Anti-Human Neutrophil Cytoplasmic Antibody
  • tTG Anti- Human Tissue Transglutaminase IgA
  • PGE 2 prostaglandin E2
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a monoamine oxidase A binding moiety under conditions suitable to transform monoamine oxidase A present in the sample into a complex comprising monoamine oxidase A and the monoamine oxidase A binding moiety; and determining the level of said complex, thereby determining the level or concentration of monoamine oxidase A present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF- related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti- Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti- Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, and prostaglandin E 2 (PGE 2 ).
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatina
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a monoamine oxidase B binding moiety under conditions suitable to transform monoamine oxidase B present in the sample into a complex comprising monoamine oxidase B and the monoamine oxidase B binding moiety; and determining the level of said complex, thereby determining the level or concentration of monoamine oxidase B present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF- related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase-1 (TIMP- 1 ), Anti- Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti- Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, and prostaglandin E 2 (PGE 2 ).
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a hydroxytryptamine (serotonin) receptor 3A binding moiety under conditions suitable to transform hydroxytryptamine (serotonin) receptor 3A present in the sample into a complex comprising hydroxytryptamine (serotonin) receptor 3A and the hydroxytryptamine (serotonin) receptor 3A binding moiety; and determining the level of said complex, thereby determining the level or concentration of hydroxytryptamine (serotonin) receptor 3A present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK TNF-related Weak Inducer of Apoptosis
  • GRO-a Growth-Related On
  • Transglutaminase IgA tTG
  • histamine histamine
  • ⁇ -tryptase histamine
  • PGE 2 prostaglandin E 2
  • the present invention provides a method for aiding in the dignois of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration carbohydrate deficient transferrin in a biological sample from the subject (e.g., a blood or serum sample).
  • the level or concentration of carbohydrate deficient transferrin may be determined by various methods known in the art, including without limitation,
  • immunoassays for example, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme-linked immunosorbent assay (ELISA), antigen capture ELISA, sandwich ELISA, IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA); immunoradiometric assays (IRMA); fluorescence polarization immunoassays (FPIA); and chemiluminescence assays (CL); marker
  • EIA enzyme immunoassays
  • EMIT enzyme multiplied immunoassay technique
  • ELISA enzyme-linked immunosorbent assay
  • MAC ELISA enzyme-linked immunosorbent assay
  • MEIA microparticle enzyme immunoassay
  • CEIA capillary electrophoresis immunoassays
  • RIA radioimmunoassays
  • HPLC high pressure liquid chromatography
  • mass spectrometry e.g., MALDI/MS, MALDI-TOF/MS, SELDI-TOF/MS, tandem MS, etc.
  • mass spectrometry e.g., MALDI/MS, MALDI-TOF/MS, SELDI-TOF/MS, tandem MS, etc.
  • MS mass spectrometry
  • other well known methods including, without limitation, Bradford assays, Coomassie blue staining, silver staining, assays for radiolabeled protein, and mass spectrometry.
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a carbohydrate deficient transferrin binding moiety under conditions suitable to transform carbohydrate deficient transferrin present in the sample into a complex comprising carbohydrate deficient transferrin and the carbohydrate deficient transferrin binding moiety; and determining the level of said complex, thereby determining the level or concentration of carbohydrate deficient transferrin present in the sample.
  • IBS irritable bowel syndrome
  • the method provided above further comprises a step of comparing the level or concentration of carbohydrate deficient transferrin present in the sample to a control level or concentration, wherein a difference in the level or concentration of carbohydrate deficient transferrin present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS.
  • control level or concentration is the level or concentration of carbohydrate deficient transferrin present in a blood or serum sample from a healthy subject
  • an increased level or concentration of carbohydrate deficient transferrin present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • the same or a reduced level or concentration of the stress marker present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • control level or concentration is the level or concentration of carbohydrate deficient transferrin present in a blood or serum sample from a subject with IBS
  • same or an increased level or concentration of carbohydrate deficient transferrin present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject having IBS
  • a reduced level or concentration of carbohydrate deficient transferrin present in the sample relative to the control level or concentration is indicative of an increased likelihood of said subject not having IBS.
  • IBS irritable bowel syndrome
  • methods for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject by detecting the level or concentration of carbohydrate deficient transferrin and at least one additional IBS marker selected from Brain- Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin- 1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti- Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), histamine, ⁇ -tryptase, pros
  • a method for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject comprising: contacting a blood or serum sample from the subject with a carbohydrate deficient transferrin binding moiety under conditions suitable to transform carbohydrate deficient transferrin present in the sample into a complex comprising carbohydrate deficient transferrin and the carbohydrate deficient transferrin binding moiety; and determining the level of said complex, thereby determining the level or concentration of carbohydrate deficient transferrin present in the sample.
  • IBS irritable bowel syndrome
  • the method further comprises detecting the level or concentration of at least one additional IBS marker selected from Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK Growth-Related Oncogene Alpha
  • GRO-a Growth-Related Oncogene Alpha
  • IL- ⁇ ⁇ Interleukin-1 Beta
  • Tissue Inhibitor of Metalloproteinase-1 Tissue Inhibitor of Metalloproteinase-1 (TIMP-1 ), Anti-Saccharomyces cerevisiae Antibody
  • ASCA-IgA Anti-CBir-1 Antibody
  • CBirl Anti -Human Neutrophil Cytoplasmic Antibody
  • ANCA Anti-Human Tissue Transglutaminase IgA (tTG)
  • histamine histamine
  • ⁇ -tryptase prostaglandin E 2
  • PGE 2 prostaglandin E 2
  • the method for aiding in the diagnosis of IBS comprises determining a diagnostic marker profile optionally in combination with a symptom profile, wherein the symptom profile is determined by identifying the presence or severity of at least one symptom in the individual; and classifying the sample as an IBS sample or non-IBS sample using an algorithm based upon the diagnostic marker profile and the symptom profile.
  • the diagnostic marker profile and the symptom profile can be determined simultaneously or sequentially in any order.
  • the symptom profile is typically determined by identifying the presence or severity of at least one symptom selected from the group consisting of chest pain, chest discomfort, heartburn, uncomfortable fullness after having a regular-sized meal, inability to finish a regular-sized meal, abdominal pain, abdominal discomfort, constipation, diarrhea, bloating, abdominal distension, negative thoughts or feelings associated with having pain or discomfort, and combinations thereof.
  • the presence or severity of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more of the symptoms described herein is identified to generate a symptom profile that is useful for predicting IBS.
  • a questionnaire or other form of written, verbal, or telephone survey is used to produce the symptom profile.
  • the questionnaire or survey typically comprises a standardized set of questions and answers for the purpose of ' gathering information from respondents regarding their current and/or recent IBS-related symptoms.
  • Example 3 provides exemplary questions that can be included in a questionnaire for identifying the presence or severity of one or more IBS-related symptoms in the individual.
  • the symptom profile is produced by compiling and/or analyzing all or a subset of the answers to the questions set forth in the questionnaire or survey. In certain other embodiments, the symptom profile is produced based upon the individual's response to the following question: "Are you currently experiencing any symptoms?" The symptom profile generated in accordance with either of these embodiments can be used in combination with a diagnostic marker profile in the algorithmic-based methods described herein to improve the accuracy of predicting IBS.
  • methods for aiding in the diagnosis of irritable bowel syndrome (IBS) in a subject is based upon the diagnostic marker profile, alone or in combination with a symptom profile, in conjunction with a statistical algorithm.
  • the statistical algorithm is a learning statistical classifier system.
  • the learning statistical classifier system can be selected from the group consisting of a random forest (RF), classification and regression tree (C&RT), boosted tree, neural network (NN), support vector machine (SVM), general chi-squared automatic interaction detector model, interactive tree, multiadaptive regression spline, machine learning classifier, and combinations thereof.
  • the learning statistical classifier system is a tree-based statistical algorithm (e.g., RF, C&RT, etc.) and/or a NN (e.g., artificial NN, etc.). Additional examples of learning statistical classifier systems suitable for use in the present invention are described in U.S. Patent Application No. 1 1/368,285.
  • the methods comprise classifying a sample from the subject as an IBS sample or non-IBS sample.
  • the statistical algorithm is a single learning statistical classifier system.
  • the single learning statistical classifier system comprises a tree-based statistical algorithm such as a RF or C&RT.
  • a single learning statistical classifier system can be used to classify the sample as an IBS sample or non-IBS sample based upon a prediction or probability value and the presence or level of at least one diagnostic marker (i.e., diagnostic marker profile), alone or in combination with the presence or severity of at least one symptom (i.e., symptom profile).
  • diagnostic marker profile i.e., diagnostic marker profile
  • the use of a single learning statistical classifier system typically classifies the sample as an IBS sample with a sensitivity, specificity, positive predictive value, negative predictive value, and/or overall accuracy of at least about 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
  • the classification of a sample as an IBS sample or non-IBS sample is useful for aiding in the diagnosis of IBS in a subject.
  • the statistical algorithm is a combination of at least two learning statistical classifier systems.
  • the combination of learning statistical classifier systems comprises a RF and a NN, e.g., used in tandem or parallel.
  • a RF can first be used to generate a prediction or probability value based upon the diagnostic marker profile, alone or in combination with a symptom profile, and a NN can then be used to classify the sample as an IBS sample or non-IBS sample based upon the prediction or probability value and the same or different diagnostic marker profile or combination of profiles.
  • the hybrid RF/NN learning statistical classifier system of the present invention classifies the sample as an IBS sample with a sensitivity, specificity, positive predictive value, negative predictive value, and/or overall accuracy of at least about 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
  • the statistical algorithm is a random forest classifier or a combination of a random forest classifier and a neural network classifier.
  • the data obtained from using the learning statistical classifier system or systems can be processed using a processing algorithm.
  • a processing algorithm can be selected, for example, from the group consisting of a multilayer perceptron, backpropagation network, and Levenberg-Marquardt algorithm.
  • Levenberg-Marquardt algorithm a combination of such processing algorithms can be used, such as in a parallel or serial fashion.
  • the methods of the present invention further comprise sending the IBS classification results to a clinician, e.g., a gastroenterologist or a general practitioner.
  • the methods of the present invention provide a diagnosis in the form of a probability that the individual has IBS.
  • the individual can have about a 0%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or greater probability of having IBS.
  • the methods of the present invention further provide a prognosis of IBS in the individual.
  • the prognosis can be surgery, development of a category or clinical subtype of IBS, development of one or more symptoms, or recovery from the disease.
  • any of a variety of assays, techniques, and kits known in the art can be used to determine the presence or level of one or more markers in a sample to classify whether the sample is associated with IBS.
  • the present invention relies, in part, on determining the presence or level of at least one marker in a sample obtained from an individual.
  • determining the presence of at least one marker includes determining the presence of each marker of interest by using any quantitative or qualitative assay known to one of skill in the art. In certain instances, qualitative assays that determine the presence or absence of a particular trait, variable, or biochemical or serological substance (e.g., protein or antibody) are suitable for detecting each marker of interest.
  • determining the level of at least one marker includes determining the level of each marker of interest by using any direct or indirect quantitative assay known to one of skill in the art.
  • quantitative assays that determine, for example, the relative or absolute amount of RNA, protein, antibody, or activity are suitable for determining the level of each marker of interest.
  • any assay useful for determining the level of a marker is also useful for determining the presence or absence of the marker.
  • the term "antibody” includes a population of immunoglobulin molecules, which can be polyclonal or monoclonal and of any isotype, or an immunologically active fragment of an immunoglobulin molecule. Such an immunologically active fragment contains the heavy and light chain variable regions, which make up the portion of the antibody molecule that specifically binds an antigen.
  • an immunologically active fragment of an immunoglobulin molecule known in the art as Fab, Fab' or F(ab') 2 is included within the meaning of the term antibody.
  • Flow cytometry can be used to determine the presence or level of one or more markers in a sample.
  • Such flow cytometric assays including bead based immunoassays, can be used to determine, e.g., antibody marker levels in the same manner as described for detecting serum antibodies to Candida albicans and HIV proteins (see, e.g., Bishop and Davis, J. Immunol. Methods, 210:79-87 ( 1997); McHugh et al, J. Immunol. Methods, 1 16:213 ( 1989); Scillian et al, Blood, 73:2041 (1989)).
  • Phage display technology for expressing a recombinant antigen specific for a marker can also be used to determine the presence or level of one or more markers in a sample.
  • Phage particles expressing an antigen specific for, e.g., an antibody marker can be anchored, if desired, to a multi-well plate using an antibody such as an anti-phage monoclonal antibody (Felici et al, "Phage-Displayed Peptides as Tools for Characterization of Human Sera" in Abelson (Ed.), Methods in EnzymoL, 267, San Diego: Academic Press, Inc. ( 1996)).
  • a variety of immunoassay techniques can be used to determine the presence or level of one or more markers in a sample ⁇ see, e.g., Self and Cook, Curr. Opin. BiotechnoL , 7:60-65 ( 1996)).
  • immunoassay encompasses techniques including, without limitation, enzyme immunoassays (EIA) such as enzyme multiplied immunoassay technique (EMIT), enzyme-linked immunosorbent assay (ELISA), antigen capture ELISA, sandwich ELISA, IgM antibody capture ELISA (MAC ELISA), and microparticle enzyme immunoassay (MEIA); capillary electrophoresis immunoassays (CEIA); radioimmunoassays (RIA); immunoradiometric assays (IRMA); fluorescence polarization immunoassays (FPIA); and chemiluminescence assays (CL). If desired, such immunoassays can be automated.
  • EIA enzyme multiplied immunoassay technique
  • ELISA enzyme-linked immunosorbent assay
  • MAC ELISA enzyme-linked immunosorbent assay
  • MEIA microparticle enzyme immunoassay
  • CEIA capillary electrophoresis immunoassays
  • RIA radioimm
  • Immunoassays can also be used in conjunction with laser induced fluorescence (see, e.g., Schmalzing and Nashabeh, Electrophoresis, 18:2184-2193 (1997); Bao, /. Chromatogr. B. Biomed. Sci., 699:463-480 ( 1997)).
  • Liposome immunoassays such as flow-injection liposome immunoassays and liposome immunosensors, are also suitable for use in the present invention (see, e.g., Rongen et al , J. Immunol. Methods, 204: 105- 133 ( 1997)).
  • nephelometry assays in which the formation of protein/antibody complexes results in increased light scatter that is converted to a peak rate signal as a function of the marker concentration, are suitable for use in the present invention.
  • Nephelometry assays are commercially available from Beckman Coulter (Brea, CA; Kit #449430) and can be performed using a Behring Nephelometer Analyzer (Fink et al., J. Clin. Chem. Clin. Biol. Chem., 27:261 -276 (1989)).
  • Antigen capture ELISA can be useful for determining the presence or level of one or more markers in a sample.
  • an antibody directed to a marker of interest is bound to a solid phase and sample is added such that the marker is bound by the antibody. After unbound proteins are removed by washing, the amount of bound marker can be quantitated using, e.g., a radioimmunoassay (see, e.g., Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York, 1988)).
  • Sandwich ELISA can also be suitable for use in the present invention.
  • a first antibody is bound to a solid support, and the marker of interest is allowed to bind to the first antibody.
  • the amount of the marker is quantitated by measuring the amount of a second antibody that binds the marker.
  • the antibodies can be immobilized onto a variety of solid supports, such as magnetic or chromatographic matrix particles, the surface of an assay plate (e.g., microtiter wells), pieces of a solid substrate material or membrane (e.g., plastic, nylon, paper), and the like.
  • An assay strip can be prepared by coating the antibody or a plurality of antibodies in an array on a solid support.
  • a radioimmunoassay using, for example, an iodine-125 ( 125 I) labeled secondary antibody is also suitable for determining the presence or level of one or more markers in a sample.
  • a secondary antibody labeled with a chemiluminescent marker can also be suitable for use in the present invention.
  • a chemiluminescence assay using a chemiluminescent secondary antibody is suitable for sensitive, non-radioactive detection of marker levels.
  • Such secondary antibodies can be obtained commercially from various sources, e.g., Amersham Lifesciences, Inc. (Arlington Heights, IL).
  • the immunoassays described above are particularly useful for determining the presence or level of one or more markers in a sample.
  • an ELISA using an IL-8-binding molecule such as an anti-IL-8 antibody or an extracellular IL-8-binding protein (e.g., IL-8 receptor) is useful for determining whether a sample is positive for IL-8 protein or for determining IL-8 protein levels in a sample.
  • a fixed neutrophil ELISA is useful for determining whether a sample is positive for ANCA or for determining ANCA levels in a sample.
  • an ELISA using yeast cell wall phosphopeptidomannan is useful for determining whether a sample is positive for ASCA-IgA and/or ASCA-IgG, or for determining ASCA-IgA and/or ASCA-IgG levels in a sample.
  • An ELISA using OmpC protein or a fragment thereof is useful for determining whether a sample is positive for anti- OmpC antibodies, or for determining anti-OmpC antibody levels in a sample.
  • An ELISA using 12 protein or a fragment thereof is useful for determining whether a sample is positive for anti-I2 antibodies, or for determining anti-I2 antibody levels in a sample.
  • An ELISA using flagellin protein (e.g., Cbir- 1 flagellin) or a fragment thereof is useful for determining whether a sample is positive for anti-flagellin antibodies, or for determining anti-flagellin antibody levels in a sample.
  • the immunoassays described above are particularly useful for determining the presence or level of other diagnostic markers in a sample.
  • Specific immunological binding of the antibody to the marker of interest can be detected directly or indirectly. Direct labels include fluorescent or luminescent tags, metals, dyes, radionuclides, and the like, attached to the antibody.
  • An antibody labeled with iodine- 125 ( 125 I) can be used for determining the levels of one or more markers in a sample.
  • a chemiluminescence assay using a chemiluminescent antibody specific for the marker is suitable for sensitive, non-radioactive detection of marker levels.
  • An antibody labeled with fluorochrome is also suitable for determining the levels of one or more markers in a sample.
  • fluorochromes include, without limitation, DAPI, fluorescein, Hoechst 33258, R-phycocyanin, B-phycoerythrin, R-phycoerythrin, rhodamine, Texas red, and lissamine.
  • Secondary antibodies linked to fluorochromes can be obtained commercially, e.g., goat F(ab') 2 anti-human IgG-FITC is available from Tago Immunologicals (Burlingame, CA).
  • Indirect labels include various enzymes well-known in the art, such as horseradish peroxidase (HRP), alkaline phosphatase (AP), ⁇ -galactosidase, urease, and the like.
  • HRP horseradish peroxidase
  • AP alkaline phosphatase
  • ⁇ -galactosidase urease, and the like.
  • a horseradish-peroxidase detection system can be used, for example, with the chromogenic substrate tetramethylbenzidine (TMB), which yields a soluble product in the presence of hydrogen peroxide that is detectable at 450 nm.
  • TMB tetramethylbenzidine
  • An alkaline phosphatase detection system can be used with the chromogenic substrate p-nitrophenyl phosphate, for example, which yields a soluble product readily detectable at 405 nm.
  • a ⁇ -galactosidase detection system can be used with the chromogenic substrate o-nitrophenyl-P-D-galactopyranoside (ONPG), which yields a soluble product detectable at 410 nm.
  • An urease detection system can be used with a substrate such as urea-bromocresol purple (Sigma Immunochemicals; St. Louis, MO).
  • a useful secondary antibody linked to an enzyme can be obtained from a number of commercial sources, e.g., goat F(ab') 2 anti-human IgG-alkaline phosphatase can be purchased from Jackson ImmunoResearch (West Grove, PA.).
  • a signal from the direct or indirect label can be analyzed, for example, using a spectrophotometer to detect color from a chromogenic substrate; a radiation counter to detect radiation such as a gamma counter for detection of 125 I; or a fluorometer to detect fluorescence in the presence of light of a certain wavelength.
  • a quantitative analysis of the amount of marker levels can be made using a spectrophotometer such as an EMAX Microplate Reader (Molecular Devices; Menlo Park, CA) in accordance with the manufacturer's instructions.
  • the assays of the present invention can be automated or performed robotically, and the signal from multiple samples can be detected simultaneously.
  • Quantitative western blotting can also be used to detect or determine the presence or level of one or more markers in a sample.
  • Western blots can be quantitated by well-known methods such as scanning densitometry or phosphorimaging.
  • protein samples are electrophoresed on 10% SDS-PAGE Laemmli gels.
  • Primary murine monoclonal antibodies are reacted with the blot, and antibody binding can be confirmed to be linear using a preliminary slot blot experiment.
  • Goat anti-mouse horseradish peroxidase- coupled antibodies are used as the secondary antibody, and signal detection performed using chemiluminescence, for example, with the Renaissance chemiluminescence kit (New England Nuclear; Boston, MA) according to the manufacturer's instructions.
  • immunohistochemical assay encompasses techniques that utilize the visual detection of fluorescent dyes or enzymes coupled (i.e., conjugated) to antibodies that react with the marker of interest using fluorescent microscopy or light microscopy and includes, without limitation, direct fluorescent antibody assay, indirect fluorescent antibody (IFA) assay, anticomplement immunofluorescence, avidin-biotin immunofluorescence, and
  • An IFA assay is useful for determining whether a sample is positive for ANCA, the level of ANCA in a sample, whether a sample is positive for pANCA, the level of pANCA in a sample, and/or an ANCA staining pattern (e.g., cANCA, pANCA, NSNA, and/or SAPPA staining pattern).
  • concentration of ANCA in a sample can be quantitated, e.g., through endpoint titration or through measuring the visual intensity of fluorescence compared to a known reference standard.
  • the presence or level of a marker of interest can be determined by detecting or quantifying the amount of the purified marker.
  • Purification of the marker can be achieved, for example, by high pressure liquid chromatography (HPLC), alone or in combination with mass spectrometry (e.g., MALDI/MS, MALDI-TOF/MS, SELDI-TOF/MS, tandem MS, etc.).
  • mass spectrometry e.g., MALDI/MS, MALDI-TOF/MS, SELDI-TOF/MS, tandem MS, etc.
  • Qualitative or quantitative detection of a marker of interest can also be determined by well-known methods including, without limitation, Bradford assays, Coomassie blue staining, silver staining, assays for radiolabeled protein, and mass spectrometry.
  • suitable apparatuses include clinical laboratory analyzers such as the ElecSys (Roche), the AxSym (Abbott), the Access (Beckman), the ADVIA ® , the CENTAUR ® (Bayer), and the NICHOLS ADVANTAGE ® (Nichols Institute) immunoassay systems.
  • Preferred apparatuses or protein chips perform simultaneous assays of a plurality of markers on a single surface.
  • Particularly useful physical formats comprise surfaces having a plurality of discrete, addressable locations for the detection of a plurality of different markers. Such formats include protein
  • each discrete surface location may comprise antibodies to immobilize one or more markers for detection at each location.
  • Surfaces may alternatively comprise one or more discrete particles (e.g., microparticles or nanoparticles) immobilized at discrete locations of a surface, where the microparticles comprise antibodies to immobilize one or more markers for detection.
  • PCR polymerase chain reaction
  • sequence analysis includes a Taqman ® allelic discrimination assay available from Applied Biosystems.
  • sequence analysis include Maxam- Gilbert sequencing, Sanger sequencing, capillary array DNA sequencing, thermal cycle sequencing (Sears et al, Biotechniques, 13:626-633 (1992)), solid-phase sequencing
  • sequencing with mass spectrometry such as matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF/MS; Fu et al, Nature Biotech., 16:381 -384 ( 1998)), and sequencing by hybridization (Chee et al, Science, 274:610-614 ( 1996); Drmanac et al, Science, 260: 1649- 1652 ( 1993); Drmanac et al, Nature Biotech., 16:54-58 (1998)).
  • MALDI-TOF/MS matrix-assisted laser desorption/ionization time-of-flight mass spectrometry
  • Non- limiting examples of electrophoretic analysis include slab gel electrophoresis such as agarose or polyacrylamide gel electrophoresis, capillary electrophoresis, and denaturing gradient gel electrophoresis.
  • Other methods for genotyping an individual at a polymorphic site in a marker include, e.g., the INVADER ® assay from Third Wave Technologies, Inc., restriction fragment length polymorphism (RFLP) analysis, allele-specific oligonucleotide
  • SSCP single strand conformational polymorphism
  • markers of interest may be combined into one test for efficient processing of a multiple of samples.
  • one skilled in the art would recognize the value of testing multiple samples (e.g., at successive time points, etc.) from the same subject.
  • Such testing of serial samples can allow the identification of changes in marker levels over time. Increases or decreases in marker levels, as well as the absence of change in marker levels, can also provide useful information to classify IBS or to rule out diseases and disorders associated with IBS-like symptoms.
  • a panel for measuring one or more of the markers described above may be constructed to provide relevant information related to the approach of the present invention for classifying a sample as being associated with IBS.
  • Such a panel may be constructed to determine the presence or level of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, or more individual markers.
  • the analysis of a single marker or subsets of markers can also be carried out by one skilled in the art in various clinical settings. These include, but are not limited to, ambulatory, urgent care, critical care, intensive care, monitoring unit, inpatient, outpatient, physician office, medical clinic, and health screening settings. [0203]
  • the analysis of markers could be carried out in a variety of physical formats as well. For example, the use of microtiter plates or automation could be used to facilitate the processing of large numbers of test samples. Alternatively, single sample formats could be developed to facilitate treatment and diagnosis in a timely fashion. 1.
  • the present invention provides an assay for the detection of an IBS marker in a blood or serum sample, the method comprising the steps of: (a) coating a solid phase surface with a first anti-IBS marker capture antibody; (b) contacting the solid phase surface with a blood or serum sample under conditions suitable to transform the IBS marker present in the sample into a complex comprising the IBS marker and the anti-IBS marker capture antibody; (c) contacting the IBS marker and the anti-IBS maker complex with a second detecting antibody under conditions suitable to form a ternary complex; and (d) contacting the ternary complex with a luminescent or chemiluminescent substrate, wherein the IBS marker is selected from the group consisting of carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone-binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide
  • hydroxytryptamine (serotonin) receptor 3A hydroxytryptamine (serotonin) receptor 3A.
  • the detecting antibody is conjugated to alkaline phosphatase.
  • the detecting antibody is not conjugated to an enzyme and the method further comprises the steps of (i) contacting the ternary complex with a third antibody conjugated to alkaline phosphatase under conditions suitable to form a quaternary complex and (ii) contacting the quaternary complex with a luminescent or chemiluminescent substrate.
  • any suitable antibody pair may be used for the capture and detecting antibodies in a sandwich ELISA.
  • One of skill in the art will know and appreciate how to select an appropriate antibody pair for the assay.
  • two antibodies are selected that bind to the target of interest, e.g. , the IBS marker, at different epitopes such that the binding of the first (capture) antibody does not interfere with the second (detecting) antibody.
  • the detecting antibody will be conjugated to an enzyme, for example, alkaline phophatase, to aid in the detection of the complex.
  • a secondary antibody conjugated to an enzyme e.g. , alkaline phophatase
  • alkaline phophatase which binds to the detecting antibody
  • the complex will be detected by the use of a luminescent substrate, for example, a luminescent substrate found in a kit such as Ultra LITETM (NAG Research Laboratories); SensoLyte® (AnaSpec); SuperSignal ELISA Femto Maximum Sensitivity Substrate (Thermo Scientific); SuperSignal ELISA Pico Chemiluminescent Substrate (Thermo Scientific); or CPSD (disodium 3-(4-methoxyspiro ⁇ l ,2-dioxetane-3,2'-(5'- chloro)tricyclo[3.3.1 .13,7]decan ⁇ -4-yl)phenyl phosphate; Tropix, Inc).
  • a luminescent substrate found in a kit such as Ultra LITETM (NAG Research Laboratories); SensoLyte® (AnaSpec); SuperSignal ELISA Femto Maximum Sensitivity Substrate (Thermo
  • an assay for detecting the presence or level of an IBS marker comprises a sandwich ELISA that relies on the use of an alkaline phosphatase conjugated anti-IBS marker antibody as the detecting antibody and a CPSD containing luminescent substrate to enhance the assay sensitivity.
  • the CPSD substrate can be found in chemiluminescent detection systems, such as the ELISA-LightTM System (Applied
  • the detection limit of the IBS marker present in a blood or serum sample is less than about 500 pg/ml. In certain embodiments, the detection limit of the IBS marker present in a blood or serum sample is less than about 500 pg/ml, or less than about 400 pg/ml, 300 pg/ml, 250 pg/ml, 200 pg/ml, 150 pg/ml, 100 pg/ml, 75 pg/ml, 50 pg/ml, 40 pg/ml, 30 pg/ml, 25 pg/ml, 20 pg/ml, 15 pg/ml, or less than about 10 pg/ml.
  • the detection limit of the IBS marker present in a blood or serum sample is less than about 200 pg/ml. In a more preferred embodiment, the detection limit of the IBS marker present in a blood or serum sample is less than about 100 pg/ml. In a more preferred embodiment, the detection limit of the IBS marker present in a blood or serum sample is less than about 50 pg/ml. In a most preferred embodiment, the detection limit of the IBS marker present in a blood or serum sample is less than about 25 pg/ml.
  • the present invention provides an assay to aid in the diagnosis of IBS, the assay comprising: (a) contacting a sample having an IBS marker under conditions suitable to transform the IBS marker into a complex comprising the IBS marker and a capture anti-IBS marker antibody; (b) contacting the complex with an enzyme-labeled indicator antibody to transform the complex into a labeled complex; (c) contacting the labeled complex with a substrate for the enzyme; and (d) detecting the presence or level of the IBS marker in the sample, wherein the IBS marker is selected from the group consisting of carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone-binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase- activating
  • the sample is human serum.
  • the sample is obtained from a subject suspected of having IBS.
  • a higher level of the IBS marker in the sample relative to healthy controls is indicative of an increased likelihood of the subject having IBS.
  • the assay is an enzyme-linked immunosorbent assay (ELISA).
  • ELISA enzyme-linked immunosorbent assay
  • detecting the presence or level of the IBS marker in the sample comprises the use of a detection device.
  • the detection device comprises a luminescence plate reader.
  • the detection device comprises a spectrophotometer.
  • the assay further comprises detecting the presence or level of ⁇ -tryptase, prostaglandin E2 (PGE 2 ), and/or histamine in the sample.
  • PGE 2 prostaglandin E2
  • the present invention provides an assay to aid in the
  • the assay comprising: (a) contacting a sample having an IBS marker under conditions suitable to transform the IBS marker into a complex comprising the IBS marker and a capture anti-IBS marker antibody; (b) contacting the complex with an enzyme-labeled indicator antibody to transform the complex into a labeled complex; (c) contacting the labeled complex with a substrate for the enzyme; and (d) detecting the presence or level of the IBS marker in the sample, wherein the IBS marker is selected from the group consisting of carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone-binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase-activating peptide, serotonin, tryptophan, se
  • the IBS marker is selected from
  • the assay aids in the differentiation of IBS-D and IBS-A from IBS-C.
  • the sample is human serum.
  • the assay is an enzyme-linked immunosorbent assay (ELISA).
  • ELISA enzyme-linked immunosorbent assay
  • detecting the presence or level of the IBS marker in the sample comprises the use of a detection device.
  • the assay further comprises detecting the presence or level of ⁇ -tryptase
  • PGE 2 prostaglandin E2
  • histamine in the sample.
  • the assays provided herein may further comprise detection of the presence or level of at least one additional biomarker selected from the group consisting of Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL-1 ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir- 1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), ⁇ -tryptase, prostaglandin E 2 , histamine, and a combination thereof.
  • BDNF Brain-Derived Neurotropic Fact
  • the assays provided herein may further comprise detection of the presence or level of at least one additional biomarker selected from the group consisting of a cytokine (e.g., IL-8, IL- ⁇ ⁇ , TWEAK, leptin, OPG, ⁇ -3 ⁇ , GROa, CXCL4/PF-4, and/or CXCL7/NAP-2), growth factor (e.g., EGF, VEGF, PEDF, BDNF, and/or SDGF), anti-neutrophil antibody (e.g., ANCA, pANCA, cANCA, NSNA, and/or SAPPA), ASCA (e.g., ASCA-IgA, ASCA-IgG, and/or ASCA-IgM), antimicrobial antibody (e.g., anti-OmpC antibody, anti-flagellin antibody, and/or anti-I2 antibody), lactoferrin, anti- tTG antibody, lipocalin (e
  • a cytokine
  • actin-severing protein e.g., gelsolin
  • S I 00 protein e.g., calgranulin
  • fibrinopeptide e.g., FIBA
  • CGRP tachykinin
  • ghrelin neurotensin
  • corticotropin-releasing hormone and combinations thereof.
  • the presence or level of other diagnostic markers such as, for example, an ti -lactoferrin antibody, L-selectin/CD62L, elastase, C-reactive protein (CRP), calprotectin, anti-U l -70 kDa autoantibody, zona occludens 1 (ZO- 1 ), vasoactive intestinal peptide (VIP), serum amyloid A, gastrin, and a combination thereof may also be detected.
  • other diagnostic markers such as, for example, an ti -lactoferrin antibody, L-selectin/CD62L, elastase, C-reactive protein (CRP), calprotectin, anti-U l -70 kDa autoantibody, zona occludens 1 (ZO- 1 ), vasoactive intestinal peptide (VIP), serum amyloid A, gastrin, and a combination thereof may also be detected.
  • CRP C-reactive protein
  • ZO- 1
  • the assays provided may comprise the detection of at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, or more of the biomarkers described herein.
  • kits for aiding in the diagnosis of IBS in a subject, or for classifying a sample as an IBS sample or a non-IBS sample.
  • the kits provided herein contain a binding moiety for detecting the presence or level of an IBS biomarker selected from carbohydrate deficient transferrin, urocortin, corticotrophin- releasing hormone-binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase-activating peptide, serotonin, tryptophan, serotonin O-sulfate, 5-hydroxyindoleacetic acid, 5-HT glucuronide, tyrosine, phenylalanine, UDP-glucuronosyltransferase 1 -6,
  • the kit will also contain at least one binding moiety for an additional biomarker selected from the group consisting of Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gel atinase- Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO-a), Interleukin-1 Beta (IL- 1 ⁇ ), Tissue Inhibitor of Metalloproteinase- 1 (TIMP- 1 ), Anti-Saccharomyces cerevisiae Antibody (ASCA-IgA), Anti-CBir-1 Antibody (CBirl ), Anti-Human Neutrophil Cytoplasmic Antibody (ANCA), Anti-Human Tissue Transglutaminase IgA (tTG), ⁇ -tryptase,
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gel atinase- Associated Lipocalin
  • prostaglandin E? histamine, and a combination thereof.
  • a kit will contain at least one binding moiety for an additional biomarker selected from the group consisting of a cytokine (e.g., IL-8, IL- ⁇ ⁇ , TWEAK, leptin, OPG, ⁇ -3 ⁇ , GROa, CXCL4/PF-4, and/or CXCL7/NAP-2), growth factor (e.g., EGF, VEGF, PEDF, BDNF, and/or SDGF), anti-neutrophil antibody (e.g., ANCA, pANCA, cANCA, NSNA, and/or SAPPA), ASCA (e.g., ASCA-IgA, ASCA-IgG, and/or ASCA-IgM), antimicrobial antibody (e.g., anti-OmpC antibody, anti-flagellin antibody, and/or anti-I2 antibody), lactoferrin, anti-tTG antibody, lipocalin (e.g., NGAL,
  • a cytokine
  • Substance P ghrelin, neurotensin, corticotropin-releasing hormone, anti -lactoferrin antibody, L-selectin/CD62L, elastase, C-reactive protein (CRP), calprotectin, anti-U l -70 kDa autoantibody, zona occludens 1 (ZO-1 ), vasoactive intestinal peptide (VIP), serum amyloid A, gastrin, and combinations thereof.
  • CRP C-reactive protein
  • ZO-1 zona occludens 1
  • VIP vasoactive intestinal peptide
  • serum amyloid A gastrin, and combinations thereof.
  • kits provided may contain a binding moiety for at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, or more of the biomarkers described herein.
  • a kit is provided for detecting the presence or level of an IBS marker in a blood or serum sample.
  • the kit contains a first capture antibody, which is optionally attached to a solid surface, and a second detection antibody that binds to a different epitope on the IBS marker than the capture antibody.
  • the detection antibody will be conjugated to alkaline phosphatase.
  • the detection antibody will not be conjugated to an enzyme, i.e. , alkaline phophatase.
  • the kit may further comprise a third antibody specific for the detection antibody, the third antibody being conjugated to an enzyme, e.g. , alkaline phophatase.
  • the kit will also contain a luminescent or chemiluminescent substrate, for example, a luminescent substrate as found in Ultra LITETM (NAG Research Laboratories); SensoLyte® (AnaSpec); SuperSignal ELISA Femto Maximum Sensitivity Substrate (Thermo Scientific); SuperSignal ELISA Pico Chemiluminescent Substrate (Thermo Scientific); or CPSD (disodium 3-(4-methoxyspiro ⁇ l ,2-dioxetane-3,2'-(5 '- chloro)tricyclo[3.3.1 .13,7]decan ⁇ -4-yl)phenyl phosphate; Tropix, Inc).
  • a luminescent substrate as found in Ultra LITETM (NAG Research Laboratories); SensoLyte® (AnaSpec); SuperSignal ELISA Femto Maximum Sensitivity Substrate (Thermo Scientific); SuperS
  • the luminescent substrate is CPSD (disodium 3-(4-methoxyspiro ⁇ 1 ,2- dioxetane-3,2'-(5 '-chloro)tricyclo[3.3.1. 13,7]decan ⁇ -4-yl)phenyl phosphate.
  • the kit for detecting the presence or level of an IBS marker is suitable for detecting the IBS marker present in a blood or serum sample at a concentration of less than about 500 pg/ml. In certain embodiments, the kit is suitable for detecting the IBS marker present in a blood or serum sample at a concentration of less than about 500 pg/ml, or less than about 400 pg/ml, 300 pg/ml, 250 pg/ml, 200 pg/ml, 150 pg/ml, 100 pg/ml, 75 pg/ml, 50 pg/ml, 40 pg/ml, 30 pg/ml, 25 pg/ml, 20 pg/ml, 15 pg/ml, or less than about 10 pg/ml.
  • the kit is suitable for detecting the IBS marker present in a blood or serum sample at a concentration of less than about 200 pg/ml. In a more preferred embodiment, the kit is suitable for detecting the IBS marker present in a blood or serum sample at a concentration of less than about 100 pg/ml. In a more preferred embodiment, the kit is suitable for detecting the IBS marker present in a blood or serum sample at a concentration of less than about 50 pg/ml. In a most preferred embodiment, the kit is suitable for detecting the IBS marker present in a blood or serum sample at a concentration of less than about 25 pg/ml.
  • IBS drugs include, but are not limited to, serotonergic agents, antidepressants, chloride channel activators, chloride channel blockers, guanylate cyclase agonists, antibiotics, opioid agonists, neurokinin antagonists, antispasmodic or anticholinergic agents, belladonna alkaloids, barbiturates, GLP-1 analogs, CRF antagonists, probiotics, free bases thereof, pharmaceutically acceptable salts thereof, derivatives thereof, analogs thereof, and combinations thereof.
  • IBS drugs include bulking agents, dopamine antagonists, carminatives, tranquilizers, dextofisopam, phenytoin, timolol, and diltiazem. Additionally, amino acids like glutamine and glutamic acid which regulate intestinal permeability by affecting neuronal or glial cell signaling can be administered to treat patients with IBS.
  • the methods of the present invention further comprise classifying an IBS sample or a diagnosis of IBS as an IBS-constipation (IBS-C), IBS-diarrhea (IBS-D), IBS-mixed (IBS-M), IBS-alternating (IBS-A), or post-infectious IBS (IBS-PI) sample or diagnosis.
  • IBS-C IBS-constipation
  • IBS-D IBS-diarrhea
  • IBS-M IBS-mixed
  • IBS-A IBS-alternating
  • IBS-PI post-infectious IBS
  • At least one form of IBS is distinguished from at least one other form of IBS based upon the presence or level of one or more IBS markers provided herein.
  • the methods of the present invention can be used to differentiate an IBS-C sample from an IBS-A and/or IBS-D sample in an individual previously identified as having IBS.
  • the methods of the present invention can be used to classify a sample from an individual not previously diagnosed with IBS as an IBS-A sample, IBS-C sample, IBS-D sample, or non-IBS sample.
  • the methods further comprise sending the results from the classification to a clinician.
  • the methods further provide a diagnosis in the form of a probability that the individual has IBS-A, IBS-C, IBS-D, IBS-M, or IBS-PI.
  • the methods of the present invention can further comprise administering to the individual a therapeutically effective amount of a drug useful for treating IBS-A, IBS-C, IBS- D, IBS-M, or IBS-PI.
  • Suitable drugs include, but are not limited to, tegaserod (ZelnormTM), alosetron (Lotronex ® ), lubiprostone (AmitizaTM), rifamixin (XifaxanTM), MD- 1 100, probiotics, and a combination thereof.
  • a therapeutically effective dose of tegaserod or other 5-HT 4 agonist ⁇ e.g., mosapride, renzapride, AG 1 -001 , etc.
  • a therapeutically effective dose of tegaserod or other 5-HT 4 agonist ⁇ e.g., mosapride, renzapride, AG 1 -001 , etc.
  • a therapeutically effective amount of lubiprostone or other chloride channel activator, rifamixin or other antibiotic capable of controlling intestinal bacterial overgrowth, MD- 1 100 or other guanylate cyclase agonist, asimadoline or other opioid agonist, or talnetant or other neurokinin antagonist can be administered to the individual.
  • a therapeutically effective amount of alosetron or other 5-HT antagonist e.g., ramosetron, DDP-225, etc.
  • crofelemer or other chloride channel blocker e.g., talnetant or other neurokinin antagonist (e.g., saredutant, etc.)
  • an antidepressant such as a tricyclic antidepressant can be administered to the individual.
  • the present invention provides a method for monitoring the progression or regression of IBS in an individual, the method comprising: (a) determining a diagnostic marker profile by detecting the presence or level of at least one diagnostic marker in the sample; and (b) determining the presence or severity of IBS in the individual using an algorithm based upon the diagnostic marker profile.
  • the method of monitoring the progression or regression of IBS comprises determining a diagnostic marker profile optionally in combination with a symptom profile, wherein the symptom profile is determined by identifying the presence or severity of at least one symptom in the individual; and determining the presence or severity of IBS in the individual using an algorithm based upon the diagnostic marker profile and the symptom profile.
  • the present invention provides a method for monitoring drug efficacy in an individual receiving a drug useful for treating IBS, the method comprising: (a) determining a diagnostic marker profile by detecting the presence or level of at least one diagnostic marker in the sample; and (b) determining the effectiveness of the drug using an algorithm based upon the diagnostic marker profile.
  • the method of monitoring IBS drug efficacy comprises determining a diagnostic marker profile optionally in combination with a symptom profile, wherein the symptom profile is determined by identifying the presence or severity of at least one symptom in the individual; and determining the effectiveness of the drug using an algorithm based upon the diagnostic marker profile and the symptom profile.
  • the present invention provides a method for monitoring the progression or regression of irritable bowel syndrome (IBS) in a subject, the method comprising: (a) contacting a first blood or serum sample taken from the subject at a first time with an IBS marker binding moiety under conditions suitable to transform the IBS marker present in the sample into a complex comprising the IBS marker and the IBS marker binding moiety; (b) determining the level of the complex, thereby determining the level of the IBS marker present in the first sample; (c) contacting a second blood or serum sample taken from the subject at a second time with an IBS marker binding moiety under conditions suitable to transform the IBS marker present in the sample into a complex comprising the IBS marker and the IBS marker binding moiety; (d) determining the level of the complex, thereby determining the level of the IBS marker present in the second sample; and (e) comparing the level of the IBS marker present in the first sample to the level of the IBS marker present in the second sample, wherein
  • the method further comprises detecting the presence of level of at least one additional biomarker selected from the group consisting of Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF-related Weak Inducer of Apoptosis
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • the method comprises detecting the presence or level of at least two, three, four, five, six, seven, eight, nine, or all ten of the additional biomarkers provided above.
  • the method my further comprises detecting the presence of level of at least one biomarker selected from the group consisting of a cytokine ⁇ e. g., IL-8, IL- ⁇ ⁇ , TWEAK, leptin, OPG, ⁇ -3 ⁇ , GROa, CXCL4/PF-4, and/or CXCL7/NAP-2), growth factor (e.g., EGF, VEGF, PEDF, BDNF, and/or SDGF), anti-neutrophil antibody (e.g., ANCA, pANCA, cANCA, NSNA, and/or SAPPA), ASCA (e.g., ASCA-IgA, ASCA-IgG, and/or ASCA-IgM), antimicrobial antibody (e.g., anti-OmpC antibody, anti-flagellin antibody, and/or anti-12 antibody), lactoferrin, anti-tTG antibody, lipocalin (e.g., NGAL
  • a cytokine
  • NGAL/MMP-9 complex MMP (e.g., MMP-9), T P (e.g., TIMP- 1 ), alpha-globulin (e.g., alpha-2-macroglobulin, haptoglobin, and/or orosomucoid), actin-severing protein (e.g., gelsolin), S I 00 protein (e.g., calgranulin), fibrinopeptide (e.g., FIB A), CGRP, tachykinin (e.g., Substance P), ghrelin, neurotensin, corticotropin-releasing hormone, and combinations thereof.
  • MMP e.g., MMP-9
  • T P e.g., TIMP- 1
  • alpha-globulin e.g., alpha-2-macroglobulin, haptoglobin, and/or orosomucoid
  • actin-severing protein e.g., gelsolin
  • the presence or level of other diagnostic markers such as, for example, anti -lactoferrin antibody, L-selectin/CD62L, elastase, C-reactive protein (CRP), calprotectin, anti-Ul -70 kDa autoantibody, zona occludens 1 (ZO-1 ), vasoactive intestinal peptide (VIP), serum amyloid A, gastrin, and a combination thereof may also be detected.
  • diagnostic markers such as, for example, anti -lactoferrin antibody, L-selectin/CD62L, elastase, C-reactive protein (CRP), calprotectin, anti-Ul -70 kDa autoantibody, zona occludens 1 (ZO-1 ), vasoactive intestinal peptide (VIP), serum amyloid A, gastrin, and a combination thereof may also be detected.
  • a panel for measuring one or more of the diagnostic markers described above may be constructed and used for determining the presence or severity of IBS or for determining the effectiveness of an IBS drug.
  • the presence or level of a plurality of diagnostic markers can be determined simultaneously or sequentially, using, for example, an aliquot or dilution of the individual 's sample.
  • the level of a particular diagnostic marker in the individual's sample is generally considered to be elevated when it is at least about 10%, 15%, 20%, 25%, 50%, 75%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 350%, 400%, 450%, 500%, 600%, 700%, 800%, 900%, or 1000% greater than the level of the same marker in a comparative sample or population of samples (e.g., greater than a median level).
  • the level of a particular diagnostic marker in the individual's sample is typically considered to be lowered when it is at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% less than the level of the same marker in a comparative sample or population of samples (e.g., less than a median level).
  • the method of monitoring the progression or regression of IBS comprises determining a diagnostic marker profile optionally in combination with a symptom profile, wherein the symptom profile is determined by identifying the presence or severity of at least one symptom in the individual; and determining the presence or severity of IBS in the individual using an algorithm based upon the diagnostic marker profile and the symptom profile.
  • the method of monitoring IBS drug efficacy comprises determining a diagnostic marker profile optionally in combination with a symptom profile, wherein the symptom profile is determined by identifying the presence or severity of at least one symptom in the individual; and determining the effectiveness of the drug using an algorithm based upon the diagnostic marker profile and the symptom profile.
  • the diagnostic marker profile and the symptom profile can be determined simultaneously or sequentially in any order.
  • determining the presence or severity of IBS or the effectiveness of an IBS drug is based upon the diagnostic marker profile, alone or in combination with a symptom profile, in conjunction with a statistical algorithm.
  • the statistical algorithm is a learning statistical classifier system.
  • the learning statistical classifier system comprises any of the learning statistical classifier systems described herein.
  • the methods of the present invention can further comprise comparing the presence or severity of IBS in the individual determined in step (b) to the presence or severity of IBS in the individual at an earlier time.
  • the presence or severity of IBS determined for an individual receiving an IBS drug can be compared to the presence or severity of IBS determined for the same individual before initiation of use of the IBS drug or at an earlier time in therapy.
  • the methods of the present invention can comprise determining the effectiveness of the IBS drug by comparing the effectiveness of the IBS drug determined in step (b) to the effectiveness of the IBS drug in the individual at an earlier time in therapy.
  • the methods can further comprise sending the IBS monitoring results to a clinician, e.g., a gastroenterologist or a general practitioner.
  • the present invention provides a computer-readable medium comprising code for controlling one or more processors to classify whether a serum or blood sample from an subject is associated with irritable bowel syndrome (IBS), the code comprising instructions to apply a statistical process to a data set comprising a diagnostic marker profile to produce a statistically derived decision classifying the sample as an IBS sample or non-IBS sample based upon the diagnostic marker profile, wherein the diagnostic marker profile indicates the level of at least one diagnostic marker selected from the group consisting of carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone- binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase-activating peptide, serotonin, try
  • IBS irritable bowel syndrome
  • the computer-readable medium for ruling in IBS comprises instructions to apply a statistical process to a data set comprising a diagnostic marker profile optionally in combination with a symptom profile which indicates the presence or severity of at least one symptom in the individual to produce a statistically derived decision classifying the sample as an IBS sample or non-IBS sample based upon the diagnostic marker profile and the symptom profile.
  • a statistical process can be applied to the diagnostic marker profile and the symptom profile simultaneously or sequentially in any order.
  • the present invention provides a computer-readable medium including code for controlling one or more processors to classify whether a sample from an individual is associated with IBS, the code comprising instructions to apply a statistical process to a data set comprising a diagnostic marker profile to produce a statistically derived decision classifying the sample as an IBS sample or non-IBS sample based upon the diagnostic marker profile, wherein the diagnostic marker profile indicates the presence or level of at least one diagnostic marker in the sample.
  • the present invention provides a computer- readable medium including code for controlling one or more processors to classify whether a sample from an individual is associated with IBS, the code comprising: (a) instructions to apply a first statistical process to a data set comprising a diagnostic marker profile to produce a statistically derived decision classifying the sample as an IBD sample or non-IBD sample based upon the diagnostic marker profile, wherein the diagnostic marker profile indicates the presence or level of at least one diagnostic marker in the sample; and if the sample is classified as a non-IBD sample, (b) instructions to apply a second statistical process to the same or different data set to produce a second statistically derived decision classifying the non-IBD sample as an IBS sample or non-IBS sample.
  • the computer-readable medium for ruling in IBS comprises instructions to apply a statistical process to a data set comprising a diagnostic marker profile optionally in combination with a symptom profile which indicates the presence or severity of at least one symptom in the individual to produce a statistically derived decision classifying the sample as an IBS sample or non-IBS sample based upon the diagnostic marker profile and the symptom profile.
  • the computer-readable medium for first ruling out IBD and then ruling in IBS comprises instructions to apply a first statistical process to a data set comprising a diagnostic marker profile optionally in combination with a symptom profile which indicates the presence or severity of at least one symptom in the individual to produce a statistically derived decision classifying the sample as an IBD sample or non-IBD sample based upon the diagnostic marker profile and the symptom profile; and if the sample is classified as a non-IBD sample, instructions to apply a second statistical process to the same or different data set to produce a second statistically derived decision classifying the non-IBD sample as an IBS sample or non-IBS sample.
  • the first and/or second statistical process can be applied to the diagnostic marker profile and the symptom profile simultaneously or sequentially in any order.
  • the first and second statistical processes are implemented in different processors.
  • the first and second statistical processes are implemented in a single processor.
  • the first statistical process is a learning statistical classifier system. Examples of learning statistical classifier systems suitable for use in the present invention are described above.
  • the first and/or second statistical process is a single learning statistical classifier system such as, for example, a RF or C&RT.
  • the first and/or second statistical process is a combination of at least two learning statistical classifier systems.
  • the combination of learning statistical classifier systems comprises a RF and a NN or SVM, e.g., used in tandem.
  • the data obtained from using the learning statistical classifier system or systems can be processed using a processing algorithm.
  • the present invention provides a system for classifying whether a serum or blood sample from a subject is associated with irritable bowel syndrome (IBS), the system comprising: (a) a data acquisition module configured to produce a data set comprising a diagnostic marker profile, wherein the diagnostic marker profile indicates the presence or level of at least one diagnostic marker selected from the group consisting of carbohydrate deficient transferrin, urocortin, corticotrophin-releasing hormone-binding protein, Cortisol, adrenocorticotropic hormone, substance P, nerve growth factor, neurokinin A, neurokinin B, vasoactive intestinal peptide, glucagon-like peptide 2, motilin, pituitary adenylate cyclase- activating peptide, serotonin, tryptophan, serotonin O-sulfate, 5-hydroxyindoleacetic acid, 5- HT glucuronide, tyrosine, phenylalanine, UDP
  • the system for classifying whether a serum or blood sample is associated with IBS, aiding in the diagnosis of IBS, or ruling in IBS comprises a data acquisition module configured to produce a data set comprising a diagnostic marker profile optionally in combination with a symptom profile which indicates the presence or severity of at least one symptom in the individual; a data processing module configured to process the data set by applying a statistical process to the data set to produce a statistically derived decision classifying the sample as an IBS sample or non-IBS sample based upon the diagnostic marker profile and the symptom profile; and a display module configured to display the statistically derived decision.
  • the present invention provides a system for classifying whether a sample from an individual is associated with IBS, the system comprising: (a) a data acquisition module configured to produce a data set comprising a diagnostic marker profile, wherein the diagnostic marker profile indicates the presence or level of at least one diagnostic marker in the sample; (b) a data processing module configured to process the data set by applying a first statistical process to the data set to produce a first statistically derived decision classifying the sample as an IBD sample or non-IBD sample based upon the diagnostic marker profile; if the sample is classified as a non-IBD sample, a data processing module configured to apply a second statistical process to the same or different data set to produce a second statistically derived decision classifying the non-IBD sample as an IBS sample or non-IBS sample; and (c) a display module configured to display the first and/or the second statistically derived decision.
  • the system for first ruling out IBD and then ruling in IBS comprises a data acquisition module configured to produce a data set comprising a diagnostic marker profile optionally in combination with a symptom profile which indicates the presence or severity of at least one symptom in the individual; a data processing module configured to process the data set by applying a first statistical process to the data set to produce a first statistically derived decision classifying the sample as an IBD sample or non- IBD sample based upon the diagnostic marker profile and the symptom profile; if the sample is classified as a non-IBD sample, a data processing module configured to apply a second statistical process to the same or different data set to produce a second statistically derived decision classifying the non-IBD sample as an IBS sample or non-IBS sample; and a display module configured to display the first and/or the second statistically derived decision.
  • the diagnostic marker profile indicates the level of at least one additional diagnostic marker selected from the group consisting of Brain-Derived Neurotropic Factor (BDNF), Neutrophil Gelatinase-Associated Lipocalin (NGAL), TNF- related Weak Inducer of Apoptosis (TWEAK), Growth-Related Oncogene Alpha (GRO- ), Interleukin-1 Beta (IL- ⁇ ⁇ ), Tissue Inhibitor of Metalloproteinase-1 (TIMP- 1 ), Anti-
  • BDNF Brain-Derived Neurotropic Factor
  • NGAL Neutrophil Gelatinase-Associated Lipocalin
  • TWEAK TNF- related Weak Inducer of Apoptosis
  • GRO- Growth-Related Oncogene Alpha
  • IL- ⁇ ⁇ Interleukin-1 Beta
  • Tissue Inhibitor of Metalloproteinase-1 Tissue Inhibitor of Metalloproteinase-1
  • the method comprises detecting the presence or level of at least two, three, four, five, six, seven, eight, nine, or all ten of the additional biomarkers provided above.
  • the diagnostic marker profile indicates the level of at least one additional diagnostic marker selected from the group consisting of a cytokine (e.g., IL-8, IL- ⁇ ⁇ , TWEAK, leptin, OPG, ⁇ -3 ⁇ , GROa, CXCL4/PF-4, and/or CXCL7/NAP-2), growth factor (e.g., EGF, VEGF, PEDF, BDNF, and/or SDGF), anti-neutrophil antibody (e.g., ANCA, pANCA, cANCA, NSNA, and/or SAPPA), ASCA (e.g., ASCA-IgA, ASCA- IgG, and/or ASCA-IgM), antimicrobial antibody (e.g., anti-OmpC antibody, anti-flagellin antibody, and/or anti-I2 antibody), lactoferrin, anti-tTG antibody, lipocalin (e.g., NGAL, NGAL/
  • a cytokine
  • the presence or level of other diagnostic markers such as, for example, anti-lactoferrin antibody, L-selectin/CD62L, elastase, C-reactive protein (CRP), calprotectin, anti-Ul -70 kDa autoantibody, zona occludens 1 (ZO- 1 ), vasoactive intestinal peptide (VIP), serum amyloid A, gastrin, and a combination thereof may also be detected.
  • diagnostic markers such as, for example, anti-lactoferrin antibody, L-selectin/CD62L, elastase, C-reactive protein (CRP), calprotectin, anti-Ul -70 kDa autoantibody, zona occludens 1 (ZO- 1 ), vasoactive intestinal peptide (VIP), serum amyloid A, gastrin, and a combination thereof may also be detected.
  • IBD inflammatory bowel disease
  • CD Celiac disease
  • Crohn's disease and ulcerative colitis Crohn's disease and ulcerative colitis.
  • Crohn's disease is an inflammatory disease affecting the lower part of the ileum and often involving the colon and other regions of the intestinal tract. Ulcerative colitis is characterized by an inflammation localized mostly in the mucosa and submucosa of the large intestine. Patients suffering from these clinical subtypes of IBD typically have IBS-like symptoms such as, for example, abdominal pain, chronic diarrhea, weight loss, and cramping.
  • Celiac disease is also characterized by IBS-like symptoms such as abdominal discomfort associated with chronic diarrhea, weight loss, and abdominal distension.
  • Celiac disease is an immune-mediated disorder of the intestinal mucosa that is typically associated with villous atrophy, crypt hyperplasia, and/or inflammation of the mucosal lining of the small intestine.
  • individuals with Celiac disease are at risk for mineral deficiency, vitamin deficiency, osteoporosis, autoimmune diseases, and intestinal malignancies (e.g., lymphoma and carcinoma).
  • CRP C-reactive protein
  • CRP is produced by the liver during the acute phase of the inflammatory process and is usually released about 24 hours post-commencement of the inflammatory process.
  • Patients suffering from diverticulitis, ileal pouch-anal anastomosis, microscopic colitis, and chronic infectious diarrhea typically have elevated fecal lactoferrin and/or calprotectin levels in addition to IBS-like symptoms.
  • Lactoferrin is a glycoprotein secreted by mucosal membranes and is the major protein in the secondary granules of leukocytes. Leukocytes are commonly recruited to inflammatory sites where they are activated, releasing granule content to the surrounding area. This process increases the concentration of lactoferrin in the stool.
  • lactoferrin levels are observed in patients with ileal pouch-anal anastomosis (i.e., a pouch is created following complete resection of colon in severe cases of Crohn's disease) when compared to other non-inflammatory conditions of the pouch, like irritable pouch syndrome. Elevated levels of lactoferrin are also observed in patients with diverticulitis, a condition in which bulging pouches (i.e., diverticula) in the digestive tract become inflamed and/or infected, causing severe abdominal pain, fever, nausea, and a marked change in bowel habits. Microscopic colitis is a chronic inflammatory disorder that is also associated with increased fecal lactoferrin levels.
  • Microscopic colitis is characterized by persistent watery diarrhea (non-bloody), abdominal pain usually associated with weight loss, a normal mucosa during colonoscopy and radiological examination, and very specific histopathological changes.
  • Microscopic colitis consists of two diseases, collagenous colitis and lymphocytic colitis.
  • Collagenous colitis is of unknown etiology and is found in patients with long-term watery diarrhea and a normal colonoscopy examination. Both collagenous colitis and lymphocytic colitis are characterized by increased lymphocytes in the lining of the colon.
  • Collagenous colitis is further characterized by a thickening of the sub-epithelial collagen layer of the colon.
  • Chronic infectious diarrhea is an illness that is also associated with increased fecal lactoferrin levels. Chronic infectious diarrhea is usually caused by a bacterial, viral, or protozoan infection, with patients presenting with IBS-like symptoms such as diarrhea and abdominal pain. Increased lactoferrin levels are also observed in patients with IBD.
  • diseases and disorders associated with intestinal inflammation can also be ruled out by detecting the presence of blood in the stool, such as fecal hemoglobin. Intestinal bleeding that occurs without the patient's knowledge is called occult or hidden bleeding. The presence of occult bleeding (e.g. , fecal hemoglobin) is typically observed in a stool sample from the patient. Other conditions such as ulcers (e.g., gastric, duodenal), cancer (e.g., stomach cancer, colorectal cancer), and hemorrhoids can also present with IBS-like symptoms including abdominal pain and a change in the consistency and/or frequency of stools.
  • ulcers e.g., gastric, duodenal
  • cancer e.g., stomach cancer, colorectal cancer
  • hemorrhoids can also present with IBS-like symptoms including abdominal pain and a change in the consistency and/or frequency of stools.
  • Calprotectin is a calcium binding protein with antimicrobial activity derived predominantly from neutrophils and monocytes. Calprotectin has been found to have clinical relevance in cystic fibrosis, rheumatoid arthritis, IBD, colorectal cancer, HIV, and other inflammatory diseases. Its level has been measured in serum, plasma, oral, cerebrospinal and synovial fluids, urine, and feces.
  • fecal calprotectin in GI disorders have been recognized: stable for 3-7 days at room temperature enabling sample shipping through regular mail; correlated to fecal alpha 1 - antitrypsin in patients with Crohn's disease; and elevated in a great majority of patients with gastrointestinal carcinomas and IBD. It was found that fecal calprotectin correlates well with endoscopic and histological gradings of disease activity in ulcerative colitis, and with fecal excretion of indium-1 1 1 -labelled neutrophilic granulocytes, which is a standard of disease activity in IBD.
  • the present invention overcomes this limitation by classifying a sample from an individual as an IBS sample using, for example, a statistical algorithm, or by excluding (i.e., ruling out) those diseases and disorders that share a similar clinical presentation as IBS and identifying (i.e., ruling in) IBS in a sample using, for example, a combination of statistical algorithms.
  • a variety of diagnostic markers are suitable for use in the methods, systems, and code of the present invention for classifying a sample from an individual as an IBS sample or for ruling out one or more diseases or disorders associated with IBS-like symptoms in a sample from an individual.
  • diagnostic markers include, without limitation, cytokines, growth factors, anti-neutrophil antibodies, mti-Saccharomyces cerevisiae antibodies, antimicrobial antibodies, anti-tissue transglutaminase (tTG) antibodies, Hpocalins, matrix metalloproteinases (MMPs), complexes of lipocalin and MMP, tissue inhibitor of metalloproteinases (TIMPs), globulins (e.g., alpha-globulins), actin-severing proteins, S lOO proteins, fibrinopeptides, calcitonin gene-related peptide (CGRP), tachykinins, ghrelin, neurotensin, corticotropin-releasing hormone (CRH), serine proteases (e.g., tryptases such as ⁇ -tryptase, elastase, etc.), prostaglandin (e.g., PGE 2 ), histamine, C-reactive protein
  • Additional diagnostic markers for predicting IBS in accordance with the present invention can be selected using the techniques described in Example 14 from US Patent Publication No. 2008/0085524, filed August 14, 2007, which is herein incorporated by reference in its entirety for all purposes.
  • One skilled in the art will also know of other diagnostic markers suitable for use in the present invention.
  • a diagnostic marker profile is determined by detecting the presence or level of at least one, two, or all three of the following biomarkers: a serine protease (e.g., a tryptase such as ⁇ -tryptase); a prostaglandin (e.g., PGE 2 ); and/or histamine.
  • a serine protease e.g., a tryptase such as ⁇ -tryptase
  • a prostaglandin e.g., PGE 2
  • histamine e.g., histamine
  • the presence or level of at least two, three, four, five, six, seven, eight, nine, ten, or more diagnostic markers are determined in the individual's sample.
  • the cytokine comprises one or more of the cytokines described below.
  • the growth factor comprises one or more of the growth factors described below.
  • the presence or level of epidermal growth factor (EGF), vascular endothelial growth factor (VEGF), pigment epithelium-derived factor (PEDF), brain-derived neurotrophic factor (BDNF), and/or amphiregulin (SDGF) is determined in the individual's sample.
  • the anti-neutrophil antibody comprises ANCA, pANCA, cANCA, NSNA, SAPPA, and combinations thereof.
  • the ASCA comprises ASCA-IgA, ASCA-IgG, ASCA-IgM, and combinations thereof.
  • the antimicrobial antibody comprises an anti-OmpC antibody, anti-flagellin antibody, anti-I2 antibody, and combinations thereof.
  • the lipocalin comprises one or more of the lipocalins described below.
  • the presence or level of neutrophil gelatinase-associated lipocalin is preferred.
  • NGAL NGAL
  • NGAL/MMP-9 complex a matrix metalloproteinase
  • MMP metalloproteinase
  • MMP-9 comprises one or more of the MMPs described below.
  • TIMP-9 comprises one or more of the tissue inhibitor of metalloproteinase (TIMP) comprises one or more of the TIMPs described below.
  • TIMP-1 comprises one or more of the alpha-globulins described below.
  • alpha-globulin comprises one or more of the alpha-globulins described below.
  • the presence or level of alpha-2-macroglobulin, haptoglobin, and/or orosomucoid is determined in the individual's sample.
  • the actin-severing protein comprises one or more of the actin-severing proteins described below.
  • the presence or level of gelsolin is determined in the individual's sample.
  • the S 100 protein comprises one or more of the S 100 proteins described below including, for example, calgranulin.
  • the fibrinopeptide comprises one or more of the fibrinopeptides described below.
  • the presence or level of fibrinopeptide A is determined in the individual 's sample.
  • the presence or level of a tachykinin such as Substance P, neurokinin A, and/or neurokinin B is determined in the individual's sample.
  • the serine protease comprises one or more of the serine proteases described below.
  • the presence or level of a serine protease such as tryptase (e.g., ⁇ -tryptase) is determined in the individual's sample.
  • the prostaglandin comprises one or more of the prostaglandins described below.
  • the presence or level of a prostaglandin such as PGE 2 is determined in the individual 's sample.
  • serine protease includes any member of a family of proteases in which one of the amino acids at the active site is serine.
  • serine proteases include tryptase (e.g., a-tryptase, ⁇ -tryptase, ⁇ - tryptase, and/or ⁇ -tryptase), elastase, chymotrypsin, trypsin, subtilisin, and combinations thereof.
  • Tryptase is an abundant specific neutral protease of human mast cells that can be measured in various biological fluids and can serve as a useful marker for mast cell activation. In fact, tryptase can be used as a marker for mast cell activation in IBS. It is believed that tryptase, possibly by activation of protease-activated receptor-2, is a good candidate to explain the pro-secretory and pro-inflammatory effects of mast cells, however other mast cell mediators could also involved.
  • ⁇ -tryptase is detected in a blood or serum sample from a subject
  • ⁇ -tryptase also commonly referred to as Tryptase beta-1 or Tryptase I
  • TPSAB 1 tryptase alpha/beta 1 gene
  • NP_003285 tryptase beta-1 precursor protein
  • the precursor protein is then processed by the removal of a signal peptide (amino acids 1 - 18) and activation peptide propeptide (amino acids 19-30) resulting in the mature Tryptase beta-1 polypeptide (amino acids 31 -275; UniProt: Q 15661 ).
  • the presence or level of a particular serine protease such as tryptase is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay.
  • an assay such as, for example, a hybridization assay or an amplification-based assay.
  • the presence or level of a particular serine protease such as tryptase is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay. Suitable ELISA techniques for determining the presence or level of tryptase in a serum sample are described herein.
  • the level of ⁇ - tryptase is detected in a blood or serum sample using a sandwich ELISA assay in which the detecting antibody is an alkaline phosphatase conjugated anti ⁇ -tryptase antibody, for example, commercial antibody G3.
  • a luminescent substrate for example, CPSD (disodium 3-(4-methoxyspiro ⁇ l ,2-dioxetane-3,2'-(5'-chloro)tricyclo[3.3. 1 .13,7]decan ⁇ -4-yl)phenyI phosphate), can then be used to enhance the sensitivity of the assay.
  • prostaglandin includes any member of a group of lipid compounds that are derived enzymatically from fatty acids and have important functions in the animal body. Every prostaglandin contains 20 carbon atoms, including a 5-carbon ring. Prostaglandins, together with the thromboxanes and prostacyclins, form the prostanoid class of fatty acid derivatives. The prostanoid class is a subclass of the eicosanoids.
  • prostaglandins include prostaglandin I 2 (PGI?), prostaglandin E 2 (PGE 2 ), prostaglandin F 2a (PGF 2a ), and combinations thereof.
  • PGE 2 prostaglandin E 2
  • PGE? may be detected by an ELISA or chemiluminescent assay. Suitable ELISA kits for determining the presence or level of PGE 2 in a serum sample are available from, e.g., Cayman Chemical Co. (Ann Arbor, MI).
  • histamine includes a biogenic amine involved in local immune responses as well as regulating physiological function in the gut and acting as a neurotransmitter. Histamine triggers the inflammatory response. As part of an immune response to foreign pathogens, histamine is produced by basophils and by mast cells found in nearby connective tissues. Histamine increases the permeability of the capillaries to white blood cells and other proteins, in order to allow them to engage foreign invaders in the affected tissues. It is found in virtually all animal body cells.
  • histamine is detected in a blood or serum sample from a subject, for example, a subject suspected of having IBS.
  • histamine may be detected by an ELISA or chemiluminescent assay. Suitable ELISA kits for determining the presence or level of histamine in a serum sample are available from, e.g., Immunotech (Czech Republic) and Cayman Chemical Co. (Ann Arbor, MI). 4. Cytokines
  • cytokine includes any of a variety of polypeptides or proteins secreted by immune cells that regulate a range of immune system functions and encompasses small cytokines such as chemokines.
  • cytokine also includes adipocytokines, which comprise a group of cytokines secreted by adipocytes that function, for example, in the regulation of body weight, hematopoiesis, angiogenesis, wound healing, insulin resistance, the immune response, and the inflammatory response.
  • the presence or level of at least one cytokine including, but not limited to, TNF-a, TNF-related weak inducer of apoptosis (TWEAK), osteoprotegerin (OPG), IFN-a, IFN- ⁇ , IFN- ⁇ , IL- l a, IL- ⁇ ⁇ , IL-1 receptor antagonist (IL-l ra), IL-2, IL-4, IL- 5, IL-6, soluble IL-6 receptor (sIL-6R), IL-7, IL-8, IL-9, IL-10, IL-12, IL- 13, IL- 15, IL-17, IL-23, and IL-27 is determined in a sample.
  • TNF-a TNF-related weak inducer of apoptosis
  • OPG osteoprotegerin
  • IFN-a IFN- ⁇
  • IFN- ⁇ IFN- ⁇
  • IFN- ⁇ IL- ⁇
  • IL-l ra IL-1 receptor antagonist
  • the presence or level of at least one chemokine such as, for example, CXCLl/GRO l/GROa, CXCL2/GR02, CXCL3/GR03, CXCL4/PF-4, CXCL5/ENA-78, CXCL6/GCP-2, CXCL7/NAP-2,
  • CXCL9/MIG CXCLl O/IP- 10, CXCL1 1/I-TAC, CXCL12/SDF-1 , CXCL13/BCA-1 , CXCL14/BRAK, CXCL15, CXCL16, CXCL17/DMC, CCLl , CCL2/MCP-1 , CCL3/MIP-l a, CCL4/MIP-i p, CCL5/RANTES, CCL6/C10, CCL7/MCP-3, CCL8/MCP-2, CCL9/CCL10, CCLl 1/Eotaxin, CCL12/MCP-5, CCL13/MCP-4, CCL14/HCC-1 , CCL15/MIP-5,
  • the presence or level of at least one adipocytokine including, but not limited to, leptin, adiponectin, resistin, active or total plasminogen activator inhibitor- 1 (PAI- 1 ), visfatin, and retinol binding protein 4 (RBP4) is determined in a sample.
  • PAI- 1 active or total plasminogen activator inhibitor- 1
  • RBP4 retinol binding protein 4
  • the presence or level of IL-8, IL- ⁇ ⁇ , TWEAK, leptin, OPG, ⁇ -3 ⁇ , GROa, CXCL4/PF-4, and/or CXCL7/NAP-2 is determined.
  • the ratio of cytokine levels is determined in a sample.
  • the ratio of the level of TNF-a to the level of IL-10 (TNF-a/IL-10), or the ratio of the level of IL- 10 to the level of IL- 12 (IL- l O/IL- 12), may be diagnostic of IBS.
  • the ratio of the level any one cytokine to the level of any other one cytokine may be useful.
  • Non-limiting example of ratios that may be useful in the methods of the present invention include TNF-a/TWEAK, TNF-a/OPG, TNF-a/IFN-a, TNF-a/IFN- ⁇ , TNF- a/IFN- ⁇ , TNF-a/IL- 1 a, TNF-a/IL- ⁇ ⁇ , TNF-a/IL-l ra, TNF-a/IL-2, TNF-a/IL-4, TNF-a/IL-5, TNF-a/IL-6, TNF-a/sIL-6R, TNF-a/IL-7, TNF-a/IL-8, TNF-a/IL-9, TNF-a/IL- 10, TNF- a/IL- 12, TNF-a/IL- 13, TNF-a/IL-15, TNF-a/IL- 17, TNF-a/IL-23, TNF-a/IL-27,
  • TWEAK/OPG TWEAK/IFN-a
  • TWEAK/IFN- ⁇ TWEAK/IFN- ⁇
  • TWEAK/IL- 1 a TWEAK/OPG
  • TWEAK/IL- 12 TWEAK/IL- 13, TWEAK/IL-15, TWEAK/IL- 17, TWEAK/IL-23,
  • the presence or level of a particular cytokine is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay.
  • an assay such as, for example, a hybridization assay or an amplification-based assay.
  • the presence or level of a particular cytokine is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay.
  • Suitable ELISA kits for determining the presence or level of a cytokine such as IL-8, IL- ⁇ ⁇ , ⁇ -3 ⁇ , GROa, CXCL4/PF-4, or CXCL7/NAP-2 in a serum, plasma, saliva, or urine sample are available from, e.g., R&D Systems, Inc. (Minneapolis, MN), Neogen Corp. (Lexington, KY), Alpco Diagnostics (Salem, NH), Assay Designs, Inc. (Ann Arbor, MI), BD Biosciences Pharmingen (San Diego, CA), Invitrogen (Camarillo, CA), Calbiochem (San Diego, CA), CHEMICON International, Inc. (Temecula, CA), Antigenix America Inc. (Huntington Station, NY), QIAGEN Inc.
  • a cytokine such as IL-8, IL- ⁇ ⁇ , ⁇ -3 ⁇ , GROa, CXCL4/PF-4, or CXCL7/
  • TWEAK is a member of the TNF superfamily of structurally related cytokines. Full-length, membrane-anchored TWEAK can be found on the surface of many cell types and a smaller, biologically active form, generated via proteolytic processing, has also been detected in the extracellular milieu (see, e.g., Chicheportiche et al , J. Biol. Chem.,
  • TWEAK acts via binding to a TNF receptor superfamily member named fibroblast growth factor-inducible 14 (Fn l 4; also known as tumor necrosis factor receptor superfamily member 12A or TNFRSF12A).
  • Fn l 4 also known as tumor necrosis factor receptor superfamily member 12A or TNFRSF12A
  • TWEAK has multiple biological activities, including stimulation of cell growth and angiogenesis, induction of inflammatory cytokines, and stimulation of apoptosis (see, e.g., Wiley et al , Cytokine Growth Factor Rev., 14:241 -249 (2003)).
  • TWEAK has been shown to induce the expression of PGE 2 , MMP-1 , IL-6, IL-8, RANTES, and IP- 10 in fibroblasts and synoviocytes, and to upregulate ICAM-1 , E-selectin, IL-8, and MCP- 1 expression in endothelial cells (see, e.g., Campbell et al , Front. BioscL , 9:2273-2284 (2004)).
  • TWEAK binding to the Fnl4 receptor, or constitutive Fnl4 overexpression activates the NF- B signaling pathway, which plays an important role in immune and inflammatory processes, oncogenesis, cancer therapy resistance, and tumorigenesis (see, e.g., Winkles et al, Cancer Lett., 235: 1 1 -17 (2006); and Winkles et al, Front. BioscL , 12:2761 -2771 (2007)).
  • TWEAK is also known as tumor necrosis factor ligand superfamily member 12 (TNFSF12), AP03 ligand (AP03L), CD255, DR3 ligand, FN14, and UNQ181/PRO207.
  • Suitable ELISA kits for determining the presence or level of TWEAK in a biological sample such as a serum, plasma, saliva, or urine sample are available from, e.g., Antigenix America Inc. (Huntington Station, NY), Bender MedSystems Inc. (Burlingame, CA), Agdia Inc. (Elkhart, IN), American Research Products Inc. (Belmont, MA), Biomeda Corp. (Foster City, CA), BioVision, Inc. (Mountain View, CA), and Kamiya Biomedical Co. (Seattle, WA).
  • OPG is a 401 -amino acid member of the TNF superfamily of structurally related cytokines.
  • OPG which is homologous to the receptor activator of NF B (RANK), inhibits the differentiation of macrophages into osteoclasts and regulates the resorption of osteoclasts by acting as a soluble decoy receptor for RANK ligand (RANKL; also known as OPG ligand (OPGL)).
  • RNKL soluble decoy receptor for RANK ligand
  • OPG-RANK-RANKL system plays a direct and essential role in the formation, function, and survival of osteoclasts.
  • the OPG-RANK-RANKL system has also been shown to modulate cancer cell migration, thus controlling the development of bone metastases.
  • OPG osteoprotegrin and osteoclastogenesis inhibitory factor (OCIF).
  • OCIF osteoclastogenesis inhibitory factor
  • Leptin a member of the adipocytokine family of cytokines, is a 16-kD peptide hormone that plays a critical role in the regulation of body weight by inhibiting food intake and stimulating energy expenditure. It is predominantly synthesized by adipocytes and circulates in the plasma in amounts proportional to body fat content (see, e.g., Maffei et al , Nat. Med. , 1 : 1 155-1 161 ( 1995); Considine et al , Diabetes, 45:992-994 ( 1996)).
  • Leptin displays a high degree of homology among different species and it is also analogous in structure to other cytokines (see, e.g., Madej et al, FEBS Lett. , 373: 13-18 ( 1995)). Leptin acts through the leptin receptor, a single-transmembrane-domain receptor of the class I cytokine superfamily of receptors, which are characterized by extracellular motifs of four cysteine residues and a number of fibronectin type III domains (see, e.g., Heim, Eur. J. Clin. Invest. , 26: 1 -12 (1996)).
  • the leptin receptor is known to exist as a homodimer and is activated by conformational changes that occur following ligand binding to the receptor (see, e.g., Devos ei a/, , 7. Biol. Chem. , 272: 18304-1 8310 (1997)).
  • Six leptin receptor isoforms, generated by alternate slicing, have been identified to date (see, e.g., Wang et al , Nature, 393:684-688 (1998); Lee et al , Nature, 379:632-635 (1996)).
  • Suitable ELISA kits for determining the presence or level of leptin in a biological sample such as a serum, plasma, saliva, or urine sample are available from, e.g., R&D Systems, Inc. (Minneapolis, MN), B-Bridge International (Mountain View, CA), Neogen Corp. (Lexington, KY), Assay Designs, Inc. (Ann Arbor, MI), Invitrogen (Camarillo, CA), CHEMICON International, Inc. (Temecula, CA), Antigenix America Inc. (Huntington Station, NY), LINCO Research, Inc. (St. Charles, MO), Diagnostic Systems Laboratories, Inc. (Webster, TX), Immuno-Biological Laboratories, Inc. (Minneapolis, MN), and Cayman Chemical Co. (Ann Arbor, MI). 8. Growth Factors
  • growth factor includes any of a variety of peptides, polypeptides, or proteins that are capable of stimulating cellular proliferation and/or cellular differentiation.
  • the presence or level of at least one growth factor including, but not limited to, epidermal growth factor (EGF), heparin-binding epidermal growth factor (HB- EGF), vascular endothelial growth factor (VEGF), pigment epithelium-derived factor (PEDF; also known as SERPINF1 ), amphiregulin (AREG; also known as schwannoma-derived growth factor (SDGF)), basic fibroblast growth factor (bFGF), hepatocyte growth factor
  • EGF epidermal growth factor
  • HB- EGF heparin-binding epidermal growth factor
  • VEGF vascular endothelial growth factor
  • PEDF pigment epithelium-derived factor
  • AVG amphiregulin
  • SDGF basic fibroblast growth factor
  • bFGF basic fibroblast growth factor
  • HGF transforming growth factor-a
  • TGF- ⁇ transforming growth factor- ⁇
  • bone morphogenetic proteins e.g., BMP 1 -BMP 15
  • platelet-derived growth factor PDGF
  • nerve growth factor NGF
  • ⁇ -nerve growth factor ⁇ -NGF
  • neurotrophic factors e.g., brain- derived neurotrophic factor (BDNF), neurotrophin 3 (NT3), neurotrophin 4 (NT4), etc.
  • growth differentiation factor-9 GDF-9
  • G-CSF granulocyte-colony stimulating factor
  • GM-CSF granulocyte-macrophage colony stimulating factor
  • EPO erythropoietin
  • TPO thrombopoietin
  • TPO thrombopoietin
  • the presence or level of a particular growth factor is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay.
  • an assay such as, for example, a hybridization assay or an amplification-based assay.
  • the presence or level of a particular growth factor is detected at the level of protein expression using, for example, an assay for detecting the presence or level of a particular growth factor.
  • ELISA immunoassay
  • VEGF vascular endothelial growth factor
  • PEDF vascular endothelial growth factor
  • SDGF vascular endothelial growth factor
  • lipocalin includes any of a variety of small extracellular proteins that are characterized by several common molecular recognition properties: the ability to bind a range of small hydrophobic molecules; binding to specific cell-surface receptors; and the formation of complexes with soluble macromolecules (see, e.g., Flowers, Biochem. J., 318: 1 - 14 (1996)). The varied biological functions of lipocalins are mediated by one or more of these properties.
  • the lipocalin protein family exhibits great functional diversity, with roles in retinol transport, invertebrate cryptic coloration, olfaction and pheromone transport, and prostaglandin synthesis. Lipocalins have also been implicated in the regulation of cell homoeostasis and the modulation of the immune response, and, as carrier proteins, to act in the general clearance of endogenous and exogenous compounds. Although lipocalins have great diversity at the sequence level, their three-dimensional structure is a unifying characteristic. Lipocalin crystal structures are highly conserved and comprise a single eight-stranded continuously hydrogen-bonded antiparallel beta-barrel, which encloses an internal ligand-binding site.
  • the presence or level of at least one lipocalin including, but not limited to, neutrophil gelatinase-associated lipocalin (NGAL; also known as human neutrophil lipocalin (HNL) or lipocalin-2), von Ebner's gland protein (VEGP; also known as lipocalin- 1 ), retinol-binding protein (RBP), purpurin (PURP), retinoic acid-binding protein (RABP), 2u-globulin (A2U), major urinary protein (MUP), bilin-binding protein (BBP), a- crustacyanin, pregnancy protein 14 (PP14), ⁇ -lactoglobulin (Big), oti -microglobulin (AI M), the gamma chain of C8 (C8y), Apolipoprotein D (ApoD), lazarillo (LAZ), prostaglandin D2 synthase (PGDS), quiescence-specific protein (QSP), choroid plexus protein
  • NGAL neutrophil
  • the presence or level of at least one lipocalin complex including, for example, a complex of NGAL and a matrix metalloproteinase (e.g., NGAL/MMP-9 complex) is determined.
  • a complex of NGAL and a matrix metalloproteinase e.g., NGAL/MMP-9 complex
  • MMP-9 matrix metalloproteinase
  • the presence or level of a particular lipocalin is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay.
  • an assay such as, for example, a hybridization assay or an amplification-based assay.
  • the presence or level of a particular lipocalin is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay.
  • Suitable ELISA kits for determining the presence or level of a lipocalin such as NGAL in a serum, plasma, or urine sample are available from, e.g., AntibodyShop A/S (Gentofte, Denmark), LabClinics SA (Barcelona, Spain), Lucerna-Chem AG (Luzern, Switzerland), R&D Systems, Inc. (Minneapolis, MN), and Assay Designs, Inc. (Ann Arbor, MI).
  • Suitable ELISA kits for determining the presence or level of the NGAL/MMP-9 complex are available from, e.g., R&D Systems, Inc.
  • MMP matrix metalloproteinase
  • MMP-1 stromelysin-1
  • MMP-7 mimotoin-1
  • MMP-8 neurotrophil collagenase
  • MMP-9 gelatinase- B
  • MMP- 10 stromelysin-2
  • MMP- 1 1 stromelysin-3
  • MMP- 12 microphage
  • MMP-13 (collagenase-3), MMP-14, MMP-15, MMP-16, MMP-17, MMP- 18 (collagenase-4), MMP- 19, MMP-20 (enamel ysin), MMP-21 , MMP-23, MMP-24, MMP- 25, MMP-26 (matrilysin-2), MMP-27, and MMP-28 (epilysin) is determined in a sample.
  • MMP-9 is determined.
  • the presence or level of a particular MMP is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay. In certain other instances, the presence or level of a particular assay
  • MMP is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay.
  • an immunoassay e.g., ELISA
  • Suitable ELISA kits for determining the presence or level of an MMP such as MMP-9 in a serum or plasma sample are available from, e.g., Calbiochem (San Diego, CA), CHEMICON International, Inc. (Temecula, CA), and R&D Systems, Inc. (Minneapolis, MN).
  • MMP-9 e.g., MMP-9
  • MMP-9 e.g., MMP-9
  • R&D Systems, Inc. Meapolis, MN.
  • tissue inhibitor of metalloproteinase includes proteins capable of inhibiting MMPs.
  • the presence or level of at least one at least one TIMP including, but not limited to, TIMP-1 , TIMP-2, TIMP-3,and TIMP-4 is determined in a sample.
  • the presence or level of TIMP-1 is determined.
  • the presence or level of a particular TIMP is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay.
  • an assay such as, for example, a hybridization assay or an amplification-based assay.
  • the presence or level of a particular TIMP is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay.
  • Suitable ELISA kits for determining the presence or level of a TIMP such as TIMP-1 in a serum or plasma sample are available from, e.g., Alpco Diagnostics (Salem, NH), Calbiochem (San Diego, CA), Invitrogen (Camarillo, CA), CHEMICON International, Inc. (Temecula, CA), and R&D Systems, Inc. (Minneapolis, MN).
  • globulin includes any member of a heterogeneous series of families of serum proteins which migrate less than albumin during serum electrophoresis. Protein electrophoresis is typically used to categorize globulins into the following three categories: alpha-globulins (i.e., alpha- 1 -globulins or alpha-2-globulins); beta-globulins; and gamma-globulins.
  • alpha-globulins i.e., alpha- 1 -globulins or alpha-2-globulins
  • beta-globulins beta-globulins
  • gamma-globulins gamma-globulins.
  • Alpha-globulins comprise a group of globular proteins in plasma which are highly mobile in alkaline or electrically-charged solutions.
  • alpha-globulins include, but are not limited to, alpha-2-macroglobulin (a2-MG), haptoglobin (Hp), orosomucoid, alpha-1 - antitrypsin, alpha- 1 -antichymotrypsin, alpha-2-antiplasmin, antithrombin, ceruloplasmin, heparin cofactor II, retinol binding protein, and transcortin.
  • a2-MG alpha-2-macroglobulin
  • Hp haptoglobin
  • orosomucoid alpha-1 - antitrypsin
  • alpha- 1 -antichymotrypsin alpha-2-antiplasmin
  • antithrombin ceruloplasmin
  • ceruloplasmin heparin cofactor II
  • retinol binding protein and transcortin.
  • haptoglobin allotypes such as, for example, Hp precursor, ⁇ , Hpal , and ⁇ 2, are determined.
  • the presence or level of a particular globulin is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay.
  • an assay such as, for example, a hybridization assay or an amplification-based assay.
  • the presence or level of a particular globulin is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay.
  • Suitable ELISA kits for determining the presence or level of a globulin such as 2-MG, haptoglobin, or orosomucoid in a serum, plasma, or urine sample are available from, e.g., GenWay Biotech, Inc. (San Diego, CA) and/or Immundiagnostik AG (Bensheim, Germany)
  • actin-severing protein includes any member of a family of proteins involved in actin remodeling and regulation of cell motility.
  • Non-limiting examples of actin-severing proteins include gelsolin (also known as brevin or actin-depolymerizing factor), villin, fragmin, and adseverin.
  • gelsolin is a protein of leukocytes, platelets, and other cells which severs actin filaments in the presence of submicromolar calcium, thereby solating cytoplasmic actin gels.
  • the presence or level of a particular actin-severing protein is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay.
  • an assay such as, for example, a hybridization assay or an amplification-based assay.
  • the presence or level of a particular actin-severing protein is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay.
  • ELISA immunoassay
  • Suitable ELISA techniques for determining the presence or level of an actin-severing protein such as gelsolin in a plasma sample are described in, e.g., Smith et al, J. Lab. Clin. Med. , 1 10: 189-195 (1987); and Hiyoshi et al, Biochem. Mol Biol. Int., 32:755-762 (1994).
  • S I 00 protein includes any member of a family of low molecular mass acidic proteins characterized by cell-type-specific expression and the presence of 2 EF-hand calcium-binding domains. There are at least 21 different types of S 100 proteins in humans. The name is derived from the fact that S 100 proteins are 100% soluble in ammonium sulfate at neutral pH. Most S I 00 proteins are homodimeric, consisting of two identical polypeptides held together by non-covalent bonds.
  • S 100 proteins are structurally similar to calmodulin, they differ in that they are cell- specific, expressed in particular cells at different levels depending on environmental factors.
  • S- 100 proteins are normally present in cells derived from the neural crest (e.g., Schwann cells, melanocytes, glial cells), chondrocytes, adipocytes, myoepithelial cells, macrophages, Langerhans cells, dendritic cells, and keratinocytes.
  • S 100 proteins have been implicated in a variety of intracellular and extracellular functions such as the regulation of protein phosphorylation, transcription factors, Ca 2+ homeostasis, the dynamics of cytoskeleton constituents, enzyme activities, cell growth and differentiation, and the inflammatory response.
  • Calgranulin is an S 100 protein that is expressed in multiple cell types, including renal epithelial cells and neutrophils, and are abundant in infiltrating monocytes and granulocytes under conditions of chronic inflammation.
  • Examples of calgranulins include, without limitation, calgranulin A (also known as S 100A8 or MRP-8), calgranulin B (also known as S 100A9 or MRP- 14), and calgranulin C (also known as S 100A 12).
  • the presence or level of a particular S 100 protein is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay. In certain other instances, the presence or level of a particular S 100 protein is detected at the level of protein expression using, for example, an assay such as, for example, a hybridization assay or an amplification-based assay. In certain other instances, the presence or level of a particular S 100 protein is detected at the level of protein expression using, for example, an assay such assay or an assay.
  • ELISA immunoassay
  • S 100A8 calgranulin A
  • S 100A9 calgranulin B
  • Calprotectin the complex of S 100A8 and S 100A9, is a calcium- and zinc-binding protein in the cytosol of neutrophils, monocytes, and keratinocytes. Calprotectin is a major protein in neutrophilic granulocytes and macrophages and accounts for as much as 60% of the total protein in the cytosol fraction in these cells. It is therefore a surrogate marker of neutrophil turnover. Its concentration in stool correlates with the intensity of neutrophil infiltration of the intestinal mucosa and with the severity of inflammation.
  • calprotectin can be measured with an ELISA using small (50-100 mg) fecal samples (see, e.g., Johne et ah, Scand J Gastroenterol., 36:291 -296 (2001 )). 15. Tachykinins
  • tachykinin includes amidated neuropeptides that share the carboxy-terminal sequence Phe-X-Gly-Leu-Met-NH?.
  • Tachykinins typically bind to one or more tachykinin receptors (e.g., TACR 1 , TACR2, and/or TACR3).
  • TACR 1 tachykinin receptor 1
  • TACR2 tachykinin receptor 2
  • the presence or level of at least one tachykinin including, but not limited to, substance P, neurokinin A, and neurokinin B is determined in a sample.
  • Substance P is a peptide of 1 1 amino acids in length that is released by nerve endings in both the central and peripheral nervous systems.
  • substance P-releasing neurons are the skin, intestines, stomach, bladder, and cardiovascular system.
  • the presence or level of a particular tachykinin is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay.
  • an assay such as, for example, a hybridization assay or an amplification-based assay.
  • the presence or level of a particular tachykinin is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay.
  • Suitable ELISA kits for determining the presence or level of a tachykinin such as substance P in a serum, plasma, saliva, or urine sample are available from, e.g., MD Biosciences Inc. (St. Paul, MN), Assay Designs, Inc. (Ann Arbor, MI), R&D Systems, Inc. (Minneapolis, MN), Sigma-Aldrich Corp. (St. Louis, MO), and Cayman Chemical Co. (Ann Arbor, MI).
  • ghrelin includes a peptide of 28 amino acids that is an endogenous ligand for the growth hormone secretagogue receptor (GHSR) and is involved in regulating growth hormone release.
  • Ghrelin can be acylated, typically with an n-octanoyl group at serine residue three, to form active ghrelin.
  • ghrelin can exist as an unacylated form (i.e., desacyl-ghrelin).
  • Ghrelin is primarily expressed in specialized enterochromaffin cells located mainly in the mucosa of the fundus of the stomach and has metabolic effects opposite to those of leptin. Ghrelin stimulates food intake, enhances the use of carbohydrates and reduces fat utilization, increases gastric motility and acid secretion, and reduces locomotor activity. [0318] In certain instances, the presence or level of ghrelin is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay. In certain other instances, the presence or level of ghrelin is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay.
  • an immunoassay e.g., ELISA
  • Suitable ELISA kits for determining the presence or level of active ghrelin or desacyl-ghrelin in a serum, plasma, saliva, or urine sample are available from, e.g., Alpco Diagnostics (Salem, NH), Cayman Chemical Co. (Ann Arbor, MI), LINCO Research, Inc. (St. Charles, MO), and Diagnostic Systems Laboratories, Inc. (Webster, TX).
  • Neurotensin The determination of the presence or level of neurotensin in a sample is also useful in the present invention.
  • the term "neurotensin” includes a tridecapeptide that is widely distributed throughout the central nervous system and the gastrointestinal tract. Neurotensin has been identified as an important mediator in the development and progression of several gastrointestinal functions and disease conditions, exerting its effects by interacting with specific receptors that act directly or indirectly on nerves, epithelial cells, and/or cells of the immune and inflammatory systems (see, e.g., Zhao et al , Peptides, 27:2434-2444 (2006)).
  • the presence or level of neurotensin is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay.
  • an assay such as, for example, a hybridization assay or an amplification-based assay.
  • the presence or level of neurotensin is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay.
  • ELISA immunoassay
  • Suitable ELISA techniques for determining the presence or level of neurotensin in a sample are described in, e.g., Davis et al , J. Neurosci. Methods, 14: 15-23 ( 1985); and Williams et al , J. Histochem. Cytochem. , 37:831 -841 (1989). 18. Corticotropin-Releasing Hormone
  • corticotropin-releasing hormone also known as corticotropin-releasing factor or CRF
  • CRF corticotropin-releasing factor
  • corticotropin-releasing hormone includes a 41 -amino acid peptide secreted by the paraventricular nucleus of the hypothalamus that mediates the proximal part of the response to stress in mammals such as humans.
  • CRH typically binds to one or more corticotropin- releasing hormone receptors (e.g., CRHR 1 and/or CRHR2).
  • CRH is expressed by the hypothalamus, spinal cord, stomach, spleen, duodenum, adrenal gland, and placenta.
  • the presence or level of CRH is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification- based assay.
  • an assay such as, for example, a hybridization assay or an amplification- based assay.
  • the presence or level of CRH is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunoassay.
  • Suitable ELISA kits for determining the presence or level of CRH in a serum, plasma, saliva, or urine sample are available from, e.g., Alpco Diagnostics (Salem, NH) and Cosmo Bio Co., Ltd. (Tokyo, Japan). 19. Anti-Neutrophil Antibodies
  • ANCA anti-neutrophil cytoplasmic antibody
  • ANCA antibodies directed to cytoplasmic and/or nuclear components of neutrophils.
  • ANCA activity can be divided into several broad categories based upon the ANCA staining pattern in neutrophils: ( 1 ) cytoplasmic neutrophil staining without perinuclear highlighting (cANCA); (2) perinuclear staining around the outside edge of the nucleus (pANCA); (3) perinuclear staining around the inside edge of the nucleus (NSNA); and (4) diffuse staining with speckling across the entire neutrophil (SAPPA).
  • pANCA staining is sensitive to DNase treatment.
  • ANCA encompasses all varieties of anti-neutrophil reactivity, including, but not limited to, cANCA, pANCA, NSNA, and SAPPA.
  • the term ANCA encompasses all immunoglobulin isotypes including, without limitation, immunoglobulin A and G.
  • ANCA levels in a sample from an individual can be determined, for example, using an immunoassay such as an enzyme-linked immunosorbent assay (ELISA) with alcohol-fixed neutrophils.
  • an immunoassay such as an enzyme-linked immunosorbent assay (ELISA) with alcohol-fixed neutrophils.
  • the presence or absence of a particular category of ANCA such as pANCA can be determined, for example, using an immunohistochemical assay such as an indirect fluorescent antibody (IFA) assay.
  • IFA indirect fluorescent antibody
  • the presence or absence of pANCA in a sample is determined using an immunofluorescence assay with DNase-treated, fixed neutrophils.
  • antigens specific for ANCA that are suitable for determining ANCA levels include, without limitation, unpurified or partially purified neutrophil extracts; purified proteins, protein fragments, or synthetic peptides such as histone H I or ANCA- reactive fragments thereof (see, e.g., U.S. Patent No. 6,074,835); histone H I -like antigens, porin antigens, Bacteroides antigens, or ANCA-reactive fragments thereof (see, e.g., U.S. Patent No. 6,033,864); secretory vesicle antigens or ANCA-reactive fragments thereof (see, e.g., U.S. Patent Application No.
  • ASCA-IgA and/or ASCA-IgG The determination of ASCA ⁇ e.g., ASCA-IgA and/or ASCA-IgG) levels in a sample is also useful in the present invention.
  • ASCA-IgA antibodies of the immunoglobulin A isotype that react specifically with S. cerevisiae.
  • anti-Saccharomyces cerevisiae immunoglobulin G or "ASCA-IgG” includes antibodies of the immunoglobulin G isotype that react specifically with S. cerevisiae.
  • ASCA-IgA or ASCA-IgG The determination of whether a sample is positive for ASCA-IgA or ASCA-IgG is made using an antigen specific for ASCA.
  • an antigen can be any antigen or mixture of antigens that is bound specifically by ASCA-IgA and/or ASCA-IgG.
  • ASCA antibodies were initially characterized by their ability to bind S. cerevisiae, those of skill in the art will understand that an antigen that is bound specifically by ASCA can be obtained from S. cerevisiae or from a variety of other sources so long as the antigen is capable of binding specifically to ASCA antibodies.
  • exemplary sources of an antigen specific for ASCA which can be used to determine the levels of ASCA-IgA and/or ASCA- IgG in a sample, include, without limitation, whole killed yeast cells such as Saccharomyces or Candida cells; yeast cell wall mannan such as phosphopeptidomannan (PPM);
  • oligosachharides such as oligomannosides; neoglycolipids; anti-ASCA idiotypic antibodies; and the like.
  • yeast such as S. cerevisiae strain Su l , Su2, CBS 1315, or BM 156, or Candida albicans strain VW32, are suitable for use as an antigen specific for ASCA-IgA and/or ASCA-IgG. Purified and synthetic antigens specific for yeast
  • ASCA are also suitable for use in determining the levels of ASCA-IgA and/or ASCA-IgG in a sample.
  • purified antigens include, without limitation, purified oligosaccharide antigens such as oligomannosides.
  • synthetic antigens include, without limitation, synthetic oligomannosides such as those described in U.S. Patent Publication No.
  • 20030105060 e.g., D-Man ⁇ (1 -2) D-Man ⁇ (1 -2) D-Man ⁇ ( 1 -2) D-Man-OR, D-Man ⁇ x(l -2) D-Man a(l -2) D-Man a( l -2) D-Man-OR, and D-Man a( l -3) D-Man ⁇ x(l -2) D-Man (l -2) D- Man-OR, wherein R is a hydrogen atom, a Ci to C 2 o alkyl, or an optionally labeled connector group.
  • Preparations of yeast cell wall mannans can be used in determining the levels of ASCA-IgA and/or ASCA-IgG in a sample.
  • Such water-soluble surface antigens can be prepared by any appropriate extraction technique known in the art, including, for example, by autoclaving, or can be obtained commercially (see, e.g., Lindberg et al , Gut, 33:909-913 (1992)).
  • the acid-stable fraction of PPM is also useful in the statistical algorithms of the present invention (Sendid et al , Clin. Diag. Lab. Immunol , 3:219-226 ( 1996)).
  • An exemplary PPM that is useful in determining ASCA levels in a sample is derived from S. uvarum strain ATCC #38926.
  • oligosaccharide antigens such as oligomannosides can also be useful in determining the levels of ASCA-IgA and/or ASCA-IgG in a sample.
  • the purified oligosaccharide antigens such as oligomannosides can also be useful in determining the levels of ASCA-IgA and/or ASCA-IgG in a sample.
  • oligomannoside antigens are preferably converted into neoglycolipids as described in, for example, Faille et al , Eur. J. Microbiol. Infect. Dis. , 1 1 :438-446 (1992).
  • One skilled in the art understands that the reactivity of such an oligomannoside antigen with ASCA can be optimized by varying the mannosyl chain length (Frosh et al , Proc Natl Acad. Sci. USA, 82: 1 194-1 198 (1985)); the anomeric configuration (Fukazawa et al , In "Immunology of Fungal Disease," E. Kurstak (ed.), Marcel Dekker Inc., New York, pp. 37-62 (1989);
  • Suitable oligomannosides for use in the methods of the present invention include, without limitation, an oligomannoside having the mannotetraose Man( l -3) Man(l -2) Man( l - 2) Man.
  • Such an oligomannoside can be purified from PPM as described in, e.g., Faille et al, supra.
  • An exemplary neoglycolipid specific for ASCA can be constructed by releasing the oligomannoside from its respective PPM and subsequently coupling the released
  • anti-outer membrane protein C antibody or "anti-OmpC antibody” includes antibodies directed to a bacterial outer membrane porin as described in, e.g., PCT Patent Publication No. WO 01/89361 .
  • the term "outer membrane protein C” or “OmpC” refers to a bacterial porin that is immunoreactive with an anti-OmpC antibody.
  • the level of anti-OmpC antibody present in a sample from an individual can be determined using an OmpC protein or a fragment thereof such as an immunoreactive fragment thereof.
  • Suitable OmpC antigens useful in determining anti-OmpC antibody levels in a sample include, without limitation, an OmpC protein, an OmpC polypeptide having substantially the same amino acid sequence as the OmpC protein, or a fragment thereof such as an immunoreactive fragment thereof.
  • an OmpC polypeptide generally describes polypeptides having an amino acid sequence with greater than about 50% identity, preferably greater than about 60% identity, more preferably greater than about 70% identity, still more preferably greater than about 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity with an OmpC protein, with the amino acid identity determined using a sequence alignment program such as CLUSTALW.
  • antigens can be prepared, for example, by purification from enteric bacteria such as E. coli, by recombinant expression of a nucleic acid such as Genbank Accession No. K00541 , by synthetic means such as solution or solid phase peptide synthesis, or by using phage display.
  • the determination of anti-I2 antibody levels in a sample is also useful in the present invention.
  • anti-I2 antibody includes antibodies directed to a microbial antigen sharing homology to bacterial transcriptional regulators as described in, e.g., U.S. Patent No. 6,309,643.
  • the term “12” refers to a microbial antigen that is immunoreactive with an anti-I2 antibody.
  • the microbial 12 protein is a polypeptide of 100 amino acids sharing some similarity weak homology with the predicted protein 4 from C. pasteurianum, Rv3557c from Mycobacterium tuberculosis, and a transcriptional regulator from Aquifex aeolicus.
  • the nucleic acid and protein sequences for the 12 protein are described in, e.g., U.S. Patent No. 6,309,643.
  • the level of anti-I2 antibody present in a sample from an individual can be determined using an 12 protein or a fragment thereof such as an immunoreactive fragment thereof.
  • Suitable 12 antigens useful in determining anti-I2 antibody levels in a sample include, without limitation, an 12 protein, an 12 polypeptide having substantially the same amino acid sequence as the 12 protein, or a fragment thereof such as an immunoreactive fragment thereof.
  • Such 12 polypeptides exhibit greater sequence similarity to the 12 protein than to the C. pasteurianum protein 4 and include isotype variants and homologs thereof.
  • an 12 polypeptide generally describes polypeptides having an amino acid sequence with greater than about 50% identity, preferably greater than about 60% identity, more preferably greater than about 70% identity, still more preferably greater than about 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity with a naturally-occurring 12 protein, with the amino acid identity determined using a sequence alignment program such as CLUSTALW.
  • Such 12 antigens can be prepared, for example, by purification from microbes, by recombinant expression of a nucleic acid encoding an 12 antigen, by synthetic means such as solution or solid phase peptide synthesis, or by using phage display.
  • anti-flagellin antibody includes antibodies directed to a protein component of bacterial flagella as described in, e.g., PCT Patent Publication No. WO 03/053220 and U.S. Patent Publication No. 20040043931 .
  • flagellin refers to a bacterial flagellum protein that is immunoreactive with an anti-flagellin antibody.
  • Microbial flagellins are proteins found in bacterial flagellum that arrange themselves in a hollow cylinder to form the filament.
  • the level of anti-flagellin antibody present in a sample from an individual can be determined using a flagellin protein or a fragment thereof such as an immunoreactive fragment thereof.
  • Suitable flagellin antigens useful in determining anti-flagellin antibody levels in a sample include, without limitation, a flagellin protein such as Cbir-1 flagellin, flagellin X, flagellin A, flagellin B, fragments thereof, and combinations thereof, a flagellin polypeptide having substantially the same amino acid sequence as the flagellin protein, or a fragment thereof such as an immunoreactive fragment thereof.
  • a flagellin polypeptide generally describes polypeptides having an amino acid sequence with greater than about 50% identity, preferably greater than about 60% identity, more preferably greater than about 70% identity, still more preferably greater than about 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity with a naturally-occurring flagellin protein, with the amino acid identity determined using a sequence alignment program such as CLUSTALW.
  • flagellin antigens can be prepared, e.g., by purification from bacterium such as Helicobacter Bills, Helicobacter mustelae, Helicobacter pylori, Butyrivibrio fibrisolvens, and bacterium found in the cecum, by recombinant expression of a nucleic acid encoding a flagellin antigen, by synthetic means such as solution or solid phase peptide synthesis, or by using phage display. 22. Mast Cell Markers
  • mast cell marker includes any protein or metabolite that is indicative of the presence or increased abundance of mast cells, or mastocytes. In certain embodiments, these mast cell markers may be present on the cell surface of a mast cell and/or be differentially expressed or present within a mast cell. Mast cells are generally found in connective tissue and harbor large granules containing high levels of histamine and heparin. These cells are believed to be derived from CD34+ bone marrow precursor cells and function in several biological processes including wound healing, defense against pathogens, allergy, and anaphylaxis. Non-limiting examples of mast cell markers include tryptase, histamine, prostaglandin E2 (PGE 2 ), prostaglandin D2 (PGD 2 ),
  • mast cells After being localized to the gastrointestinal tract, mast cells may be stimulated by allergens, microbial products, and/or neurotransmitters, to release a wide variety of bioactive mediators that stimulate the secreto-motor reflexes and increase the perceived sensation of abdominal pain. As such, the presence of increased levels of mast cells or mast cell metabolites in the gastrointestinal tract may be diagnostic of IBS.
  • biomarkers associated with mast cell degranulation such as tryptase, prostaglandin E2, histamine, and histamine metabolites (including 4-imidazoleacetic acid, t-methylhistamine, and t-methyl-4-imidazole acetic acid) are useful for the methods of the present invention.
  • biomarkers that are differentially released from mast cells including serotonin, nerve growth factor, vascular endothelial cell growth factor, TNF-a, TNF- ⁇ , IL-6, and IL-8 are useful for the methods of the present invention.
  • the presence or level of a mast cell marker is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an
  • amplification-based assay e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of a mast cell marker is detected at the level of protein expression using, e.g., an immunoassay ⁇ e.g., ELISA), an
  • the mast cell marker may be tryptase, histamine, prostaglandin E2 (PGE 2 ), or a combination thereof.
  • the presence or increased abundance of mast cells may be detected by using an anti-Ki antibody, such as a Ki-MC l or i-M l P monoclonal antibody (Hamann K. et ai, Br J Dermatol. (1995)), or with a fluorescent berberine binding assay (Berlin and Enerback, lnt Arch Allergy Appl Immunol.
  • gastrointestinal hormone includes a chemical or peptide present in the intestinal tract that is released by a cell, which alters the metabolism of a second cell located in the organism. Generally, hormones promote a response in a target cell after binding to a specific receptor located on the surface of the cell. In animals, hormones are commonly transported throughout the body in the bloodstream, however, they may also be translocated by diffusion.
  • gastrointestinal hormones suitable for use as IBS markers include calcitonin gene-related peptide (CGRP), substance P, nerve growth factor (NGF), neurokinin A, neurokinin B, vasoactive intestinal peptide (VIP), glucagon-like peptide 1 (GLP-1 ), glucagon-like peptide 2 (GLP-2), motilin, pituitary adenylate cyclase-activating peptide (PACAP), secretin, cholescystokinin, neuropeptide Y, pancreatic polypeptide, peptide YY, enteroglucagon, and glucose-dependent insulinotropic peptide.
  • CGRP calcitonin gene-related peptide
  • substance P nerve growth factor
  • NEF nerve growth factor
  • VIP vasoactive intestinal peptide
  • GLP-1 glucagon-like peptide 1
  • GLP-2 glucagon-like peptide 2
  • motilin motilin
  • PACAP pituit
  • the presence or level of a gut peptide hormone marker is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of a peptide hormone marker is detected at the level of protein expression using, e.g., an immunoassay ⁇ e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • CGRP is a member of the calcitonin family of peptides, which in humans exists in two mature forms, -CGRP and ⁇ -CGRP.
  • a-CGRP is a 37 amino acid peptide:
  • ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (SEQ ID NO: l ) formed from the alternative splicing of the calcitonin/CGRP gene.
  • ⁇ -CGRP is a related 37 amino acid polypeptide ACNT ATC VTHRLAGLLS RS GGM VKSNFVPTN VGS KAF-NH 2 (SEQ ID NO:2) formed from the calcitonin-related polypeptide, beta precursor gene.
  • CGRP may consist of a calcitonin isoform CGRP preproprotein (NP_001029125), or variant thereof (such as NP_001029124 or NP_001732), CGRP propeptide (CAA34070), or calcitonin-related polypeptide, beta precursor (NP_0007 19).
  • CGRP is one of the most abundant peptides produced in both peripheral and central neurons (Rosenfeld MG et al , Nature (1983)), and is the most potent peptide vasodilator and can function in the transmission of pain (Brian SD et al , Nature (1985); McCulloch et al , PNAS ( 1986)). CGRP is thought to play a role in cardiovascular homeostasis and nociception by mediating its effects though a heteromeric receptor composed of a G protein-coupled receptor called calcitonin receptor-like receptor (CLR) and a receptor activity-modifying protein (RAMP1 ) (Poyner DR et al , Pharmacol Rev, (2002)).
  • CLR calcitonin receptor-like receptor
  • RAMP1 receptor activity-modifying protein
  • the presence or level of a CGRP or precursor thereof is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of a peptide hormone marker is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of a CGRP in a serum, plasma, saliva, or urine sample are available from, e.g., Cayman Chemical Co. (Ann Arbor, MI), Bachem Holding AG/ Peninsula Laboratories, LLC (San Carlos, CA), and BioPorto Diagnostics (Denmark). 25. Substance P
  • Substance P is a peptide of 1 1 amino acids in length (RPKPQQFFGLM-NH 2 ; SEQ ID NO: 3) that is released by nerve endings in both the central and peripheral nervous systems.
  • substance P-releasing neurons include the skin, intestines, stomach, bladder, and cardiovascular system.
  • Substance P is derived from a polypeptide precursor after differential splicing of the preprotachyknin A gene (TAC1 ; NM_003182).
  • substance P or a substance P precursor protein may be useful as a marker of IBS, for example a TAC 1 polypeptide (NP_003173; NP_054704; NP_054702; and NP_054703) or transcript thereof.
  • the presence or level of substance P or precursor thereof is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of a peptide hormone marker is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of substance P in a serum, plasma, saliva, or urine sample are available from, e.g., Cayman Chemical Co. (Ann Arbor, MI), Bachem Holding AG/ Peninsula Laboratories, LLC (San Carlos, CA), and MD Biosciences Inc. (St. Paul, MN). 26. Nerve Growth Factor (NGF)
  • NGF is a member of the NGF-beta family and is a secreted protein which homodimerizes and is incorporated into a larger complex. NGF has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons, a small secreted protein which induces the differentiation and survival of particular target neurons. NGF binds to at least two receptors on the surface of cells which are capable of responding to this growth factor, TrkA and LNGFR. NGF is a small polypeptide (residues 122-241 of NP_002497) that is derived from a precursor polypeptide (NP_002497) encoded by the NGF gene (NM_002506). In certain embodiments, NGF, an NGF precursor polypeptide, or NGF propeptide (residues 19- 121 of NP_002497) may be useful as an IBS marker.
  • the presence or level of NGF or a precursor thereof is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of NGF, a precursor thereof, or a proprotein thereof is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of NGF in a serum, plasma, saliva, or urine sample are available from, e.g., Millipore (Billerica, MA), CUSABIO Biotech Co., Ltd. (Newark, DE), Emelca Biosciences (Belgium), and Signosis, Inc. (Sunnyvale, CA). 27. Neurokinin A
  • Neurokinin A is a peptide of 10 amino acids in length (HKTDSFVGLM; SEQ ID NO:4) derived from a polypeptide precursor after differential splicing of the preprotachyknin A gene (TAC1 ; NM_003182).
  • the peptide is a member of the tachykinin family of neuropeptide neurotransmitters.
  • neurokinin A or a neurokinin A precursor protein may be useful as a marker of IBS, for example a TAC 1 polypeptide (NPJ303173 and NP 054703) or transcript thereof.
  • the presence or level of neurokinin A or precursor thereof is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of neurokinin A is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of neurokinin A in a serum, plasma, saliva, or urine sample are available from, e.g., Abeam (Cambridge, MA), Fitzgerald Industries (North Acton, MA), and RayBiotech, Inc (Norcross, GA). 28. Neurokinin B
  • Neurokinin B is a peptide of 10 amino acids in length (DMHDFFVGLM-NH 2 ; SEQ ID NO:5) derived from the tachykinin 3 precursor (NP_037383), which is encoded by the tachykinin 3 gene (TAC3; NM_003182).
  • the peptide is a member of the tachykinin family of neuropeptide neurotransmitters.
  • neurokinin B or a neurokinin B precursor protein may be useful as a marker of IBS, for example a TAC3 polypeptide
  • the presence or level of neurokinin B or precursor thereof is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of neurokinin B is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of neurokinin B in a serum, plasma, saliva, or urine sample are available from, e.g., Abeam (Cambridge, MA), Bachem Holding AG/ Peninsula Laboratories, LLC (San Carlos, CA), and RayBiotech, Inc (Norcross, GA).
  • VIP Vasoactive Intestinal Peptide
  • HSDVFTDNYTRLRKQMAVKKYLNSILN found in the gut, pancreas, and hypothalamus of humans.
  • This peptide induces smooth muscle relaxation, causes inhibition of gastric acids secretion and absorption from the intestinal lumen, and stimulates the secretion of water into pancreatic juice and bile.
  • VIP is derived from a polypeptide precursor after differential splicing of the vasoactive intestinal peptide gene (Entrez GenelD: 7432).
  • VIP a VIP precursor protein (such as NP_919416 or NP_003372), a VIP propeptide, or a transcript encoding a VIP peptide (such as NM_003381 or NM_ 194435) may be useful as a marker of IBS.
  • the presence or level of VIP is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of VIP, a precursor thereof, or a propeptide thereof is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunoassay (e.g., ELISA), an enzyme-derived from a sample.
  • an immunoassay e.g., ELISA
  • ELISA kits for determining the presence or level of VIP in a serum, plasma, saliva, or urine sample are available from, e.g., Phoenix Pharmaceuticals, Inc. (Burlingame, CA), BioPorto Diagnostics (Denmark), and RayBiotech, Inc (Norcross, GA).
  • GLP-2 GIucagon-Like Peptide 2
  • GLP-2 is a 33 amino acid peptide hormone
  • GLP-2 is known to be co-secreted with GLP-1 into the intestines, where it functions to regulate gastric motility, secretion, sugar transport, and cellular differentiation and proliferation.
  • GLP-2 is derived from proglucagon, a polypeptide precursor encoded by the glucagon gene (CGC; NM_002054).
  • GLP-2 may be useful as a marker of IBS.
  • a GLP-2 precursor protein such as NP_002045
  • a GLP-2 propeptide such as NM_002054
  • a transcript encoding a GLP-2 peptide such as NM_002054
  • the presence or level of GLP-2 is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of GLP-2, a precursor thereof, or a propeptide thereof is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of GLP-2 in a serum, plasma, saliva, or urine sample are available from, e.g., RayBiotech, Inc (Norcross, GA), BioSupply UK (England), and BioCat GmbH (Germany). 31. Motilin
  • Motilin is a 22 amino acid peptide hormone (FVPIFTYGELQRMQEKERNKGQ; SEQ ID NO:8) that is secreted from endocrine M cells located in the small intestines. Once released, motilin stimulates the production of pepsin and regulates migrating motor complexes, which are responsible for the transportation of indigestible substances through the digestive tract.
  • Motilin is derived from promotilin, a precursor polypeptide encoded by the motilin gene (MLN; Entrez GenelD: 4295). Transcription of the MLN gene undergoes differential splicing into one of two isoforms (NM_002418 and NMJX) 1040109), which result in the translation of two different precursor polypeptides (NPJ302409 and
  • motilin a motilin precursor polypeptide, a motilin propeptide (such as motilin-associated peptide), or a transcript encoding motilin may be useful as a marker of IBS.
  • the presence or level of motilin is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of motilin, a precursor thereof, or a propeptide thereof is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of motilin in a serum, plasma, saliva, or urine sample are available from, e.g., Abeam (Cambridge, MA), CUSABIO Biotech Co., Ltd. (Newark, DE), and Phoenix Biotech (China).
  • PACAP is a vasoactive neuropeptide (VN) found throughout the nervous system, gastrointestinal tract, and lymphatic system. VNs, such as PACAP and VIP, function as neurotransmitters, neuroregulators, neurotropic stimulators, hormonal regulators, vasodilators, and immune and nociception modulators.
  • PACAP is a precursor protein (NP_001 108) encoded by the Adenylate Cyclase Activating Polypeptide 1 (pituitary) gene (ADCYAP1 ; Entrez GenelD: 1271617). Transcription of the ADCY API gene undergoes differential splicing into one of two isoforms (NMJX) 1099733 and NM_001 1 17), which result in the translation of two different precursor polypeptides (NP_001093203 and
  • PACAP polypeptide is further processed into various smaller peptides, including two propeptides, PACAP-related peptide
  • PACAP a PACAP precursor polypeptide
  • PACAP propeptide such as PACAP-related peptide, pituitary adenylate cyclase-activating polypeptide 38, and pituitary adenylate cyclase-activating polypeptide 27
  • a transcript encoding PACAP may be useful as a marker of IBS.
  • the presence or level of PACAP is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of PACAP, a precursor thereof, or a propeptide thereof is detected at the level of protein expression using, e.g., an immunoassay ⁇ e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of PACAP in a serum, plasma, saliva, or urine sample are available from, e.g., Santa Cruz Biotechnology, Inc. (Santa Cruz, CA), US Biological (Swampscott, MA), and Novus Biologicals (Littleton, CO).
  • serotonin metabolite includes serotonin, serotonin biosynthesis intermediates, and serotonin metabolites.
  • Serotonin is primarily found in the gastrointestinal tract, where it functions to regulate intestinal movements, and to a lesser extent in the central nervous systems, where it participates in the regulation of mood, appetite, sleep, muscle contraction, and various cognitive functions. Serotonin levels are upregulated in the gastrointestinal tracts of IBS patients. Further, serotonin concentrations are higher in IBS(D) than IBS(C).
  • serotonin metabolites may be detected in biological samples, such as blood and urine, in order to reflect the concentration of serotonin in the gut, for the diagnosis of IBS.
  • Non-limiting examples of serotonin metabolites suitable for use as IBS markers include tryptophan, 5-HT-o-sulfate, serotonin O-sulfate (5- Hydroxytryptamine O-sulfate; 5-HT-o-sulfate), 5-Hydroxyindoleacetic acid (5-HIAA), 5-HT glucuronide (5-HT-GA), and 5-hydroxytrytophol (5-HTOL).
  • the presence or level of a serotonin metabolite is detected with a mass spectrometry based assay, a proton magnetic resonance spectroscopy based assay, a chromatographic assay (e.g., liquid chromatographic assay or HPLC), an immunoassay, (e.g., ELISA), and the like.
  • a mass spectrometry based assay e.g., a proton magnetic resonance spectroscopy based assay
  • a chromatographic assay e.g., liquid chromatographic assay or HPLC
  • an immunoassay e.g., ELISA
  • enteric nervous system serum metabolite includes dopamine, norepinephrine, epinephrine, tyrosine, phenylalanine, dopamine, norepinephrine, epinephrine biosynthesis intermediates, and dopamine, norepinephrine, epinephrine metabolites.
  • enteric nervous system serum metabolites may be detected in biological samples, such as blood and urine, in order to diagnose, sub-type, or provide a prognosis for IBS.
  • an elevated level of tyrosine is associated with or indicative of IBS or associated with an increased likelihood of IBS. In other embodiments, an elevated level of tyrosine is associated with or indicative of IBS-D or IBS-M. In another embodiment, an elevated level of phenylalanine is associated with or indicative of IBS or associated with an increased likelihood of IBS. In other embodiments, an elevated level of phenylalanine is associated with or indicative of IBS-D or IBS-M.
  • the presence or level of an enteric nervous system serum metabolite is detected with a mass spectrometry based assay, a proton magnetic resonance spectroscopy based assay, a chromatographic assay (e.g., liquid chromatographic assay or HPLC), an immunoassay, (e.g., ELISA), and the like.
  • a mass spectrometry based assay e.g., a proton magnetic resonance spectroscopy based assay
  • a chromatographic assay e.g., liquid chromatographic assay or HPLC
  • an immunoassay e.g., ELISA
  • serotonin pathway marker includes genes, proteins, and enzymes involved in the biosynthesis or metabolism of serotonin, or the regulation of serotonin levels in the gastrointestinal tract.
  • Non-limiting examples of serotonin pathway markers suitable for use as IBS markers include UDP-glucuronosyltransferase 1 -6 (uGTl A6), serotonin reuptake transporter (SERT), tryptophan hydroxylase 1 (TPH 1 ), monoamine oxidase A (MAO-A), monoamine oxidase B (MAO-B), and hydroxytryptamine receptor 3A (5-HT3A; 5-HT3R). .
  • UDP-glucuronosyltransferase 1-6 (UGT1A6)
  • UGTl A6 is a member of UDP-glucuronosyl/UDP-glucosyltransferase superfamily of membrane-bound enzymes of the ER, which catalyze the glucuronidation of various substrates.
  • the UDP-glucuronosyl/UDP-glucosyltransferase superfamily of enzymes catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule.
  • Mammalian UDP-glucuronosyltransferases are described in, e.g., Burchell et al., DNA Cell Biol., 10(7):487-94 (1991 ).
  • UGT1 A6 an E.C.2.4.1.17 enzyme, is encoded by the UDP glucuronosyl transferase 1 family, polypeptide A6 gene (UGTl A6; Entrez GenelD: 54578) and matures from one of two precursor polypeptides (NP_001063 and NP_995584) after alternative splicing of the transcript (NM_001072 and NM_205862).
  • UGTl A6 UGTl A6* l
  • UGT1A6*2 UGTl A6*3
  • UGTl A6*4 Nagar S. et al., Pharmacogenetics (2004).
  • UGTl A6 SNPs contain various combinations of known UGTl A6 SNPs, which include rs6759892 ( 158 T>G), rsl042708 (348 C>A), rs2070959 (680 A>G), rsl 105879 (691 A>G), and rs l 042709 ( 1667 G>C).
  • UGTl A6, a precursor protein thereof, a UGTl A6 mRNA, or a UGTl A6 SNP, haplotype, or genotype may be useful as a marker of IBS.
  • the presence or level of UGTl A6 is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of UGTl A6 or a precursor thereof is detected at the level of protein expression using, e.g., an immunoassay ⁇ e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of UGTl A6 in- a serum, plasma, saliva, or urine sample are available from, e.g., Abnova (Walnut CA) and Santa Cruz Biotechnology, Inc. (Santa Cruz, CA).
  • a SNP or particular haplotype or genotype of the UGTl A6 gene is detected with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT- PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • SERT Serotonin-Selective Reuptake Transporter
  • SERT is a member of the monoamine transporter family of membrane-bound receptors that facilitate the transport of monoamine neurotransmitters into and out of cells.
  • the serotonin receptor (SERT) mediates the uptake of serotonin into neurons and platelets, thereby regulating serotonin levels in vivo.
  • Polymorphisms in the SERT gene have previously been associated with various diseases, including sudden infant death syndrome (SIDS), Alzheimer's disease, post-traumatic stress disorder, depression, pulmonary hypertension, myocardial infarction, and IBS (for review, see, Murphy DL et ai, Mol Interv. (2004)).
  • SIDS sudden infant death syndrome
  • Alzheimer's disease post-traumatic stress disorder
  • depression depression
  • pulmonary hypertension myocardial infarction
  • IBS for review, see, Murphy DL et ai, Mol Interv. (2004).
  • SERT is a 70 kDa transmembrane receptor (NP_001036) encoded by the solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 gene (SLC6A4; Entrez GenelD: 6532; NM_001045).
  • SLC6A4 solute carrier family 6
  • Various SNPs have been identified in the SLC6A4 gene, including rs6355 (472 G>C), rs2228673 (908 G>C), rs28914832 (1578 A>C), rs28914833 (1698 T>C), rs28914834 (1953 C>G), rs6352 (2120 A>C), and I425V.
  • polymorphisms in the promoter region of the SLC6A4 gene including an A>G
  • SERT SLC6A4 mRNA
  • SLC6A4 SNP haplotype, polymorphic variant, or genotype may be useful as a marker of IBS.
  • the presence or level of SERT is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of SERT is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of SERT in a serum, plasma, saliva, or urine sample are available from, e.g., Abgent, Inc.
  • a SNP, polymorphism, or particular haplotype or genotype of the SLC6A4 gene is detected with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • TPH1 Tryptophan Hydroxylase 1
  • TPH1 is an E.C. I .14.16.4 enzyme that catalyzes the hydroxylation of L-tryptophan to form 5-hydroxytryptophan, an intermediate of serotonin biosynthesis.
  • Two isoforms of tryptophan hydroxylase (TPH 1 and TPH2) are found in the gut and central nervous systems of mammals.
  • TPH1 is the predominant isoform found in the gut and TPH2 is the
  • TPHs are expressed in several cell lineages, including raphe neurons, pinealocytes, mast cells, mononuclear leukocytes, beta-cells of the islets of Langerhans, and intestinal and pancreatic enterochromaffin cells.
  • TPH 1 is a 50 kDa protein (NP_004170) encoded by the tryptophan hydroxylase 1 gene (TPH 1 ; Entrez GenelD: 7166; NM_004179).
  • TPH 1 SNPs have been identified in the TPH 1 gene, including rsl 72423 (301 + 1281 G>A), rs21 1 102 (930+629 A>G), rs 10488683 (402+ 1276 A>G), rs684302 (1 17+1840 C>T), rs503964 (723 C>T), rs490895 (789 C>T), rs41274350 (820 C>A), rs41274348 (929 C>T), and rs56151798 ( 1095 T>C).
  • TPH 1 SNPs are associated with psychiatric disorders, including impulsive- aggression measures (New AS et ah, Am J Med Genet.
  • TPH1 a TPH1 mRNA, or a TPH1 SNP, haplotype, polymorphic variant, or genotype may be useful as a marker of IBS.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of TPH1 is detected at the level of protein expression using, e.g., an immunoassay ⁇ e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • an immunoassay e.g., ELISA
  • ELISA immunohistochemical assay
  • mass spectrometry based assay e.g., mass spectrometry kits.
  • Suitable ELISA kits for determining the presence or level of TPH1 in a serum, plasma, saliva, or urine sample are available from, e.g., Novus Biologicals (Littleton, CO) and Abeam (Cambridge, MA).
  • a SNP, polymorphism, or particular haplotype or genotype of the TPH 1 gene is detected with an assay such as, e.g., a
  • hybridization assay an amplification-based assay, e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • an amplification-based assay e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • MAO-A an E.C.1.4.3.4 enzyme
  • MAO-A is a member of the enzyme family of flavin- containing amine oxidoreductases. This enzyme, which is localized to the outer
  • MAO- A is 59.7 kDa protein (NP_000231 ) encoded by the monoamine oxidase A gene (MAOA; Entrez GenelD: 4128; NM_000240).
  • rs l 800464 (566 A>C), rs58524323 (696 G>A), rsl 137068 (818 G>T), rs72554632 ( 1067 C>T), rs6323 ( 1072 G>T), rs61730725 ( 1074 T>C), rs 1799835 ( 1 121 T>G), rs 1 800465 ( 1207 A>T), rs 1803987 ( 1324 G>T), rs7065428 ( 1342 A>G), rs 1803986 ( 15 16 G>T), rs l 137070 (1591 T>C), rs 1800466 ( 1740 A>G), rs3788862 (NT_079573.3, position 6369131 A/C), and rsl 465108 (NT_079573.3, position 6389976 A/G).
  • MAOA SNPs have been associated with disorders, including autism spectrum disorder (Yoo HJ et al , Neurosci Res. (2009)), bipolar affective disorder (Lin et al., Behav Brain Funct. (2008)), and Attention-deficit/hyperactivity disorder (Rommelse NN et al. , Am J Med Genet B
  • MAO-A an MAOA mRNA, or an MAOA SNP, haplotype, polymorphic variant, or genotype may be useful as a marker of IBS.
  • the presence or level of MAOA is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of MAO-A is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • an immunoassay e.g., ELISA
  • an immunohistochemical assay e.g., an immunohistochemical assay
  • a mass spectrometry based assay e.g., mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of MAO-A in a serum, plasma, saliva, or urine sample are available from, e.g., Novus
  • a SNP, polymorphism, or particular haplotype or genotype of the MAOA gene is detected with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • MAO-B an E.C. I .4.3.4 enzyme, is a member of the enzyme family of flavin- containing amine oxidoreductases.
  • MAO-B shares about 70% sequence identity with MAO- A, and like MAO-A is localized to the outer mitochondrial membrane and catalyzes the deamination of neuroactive and vasoactive amines.
  • MAO-B preferentially deaminates benzylamine, phenylethylamine, and dopamine. Due to the fact that MAO-A deaminates serotonin and epinephrine with higher affinity than MAO-B, MAO-B inhibitors are preferred over MAO-A inhibitors for first-line treatment of depression.
  • MAO-B is 58.8 kDa protein (NP_000889) encoded by the monoamine oxidase B gene (MAOB; Entrez GenelD: 4129;
  • NM_000898 Several SNPs have been identified in the MAO-B gene, including rsl 2010260 (260 G>T), rs l 7856663 (289 G>A), rs l 7852046 (565 OA), rs l 2845783 (767 A>C), rsl 2850496 (775 C>A), rs l 2845773 (777 A>C), rs7879356 (782 A>G), rs55815323 (1087 C>T), rs5952696 ( 1229 A>G), rs6324 ( 1637 OT), rs 1040399 (NT_079573.3, position 6477166 C/T), and rs6651806 (NTJ379573.3, position 6540731 A/C).
  • MAOB SNPs have been associated with disorders, including attention deficit hyperactivity disorder (Li J et al, Am J Med Genet B Neuropsychiatr Genet. (2008) and vulnerability of major depression (Dlugos AM et al, J Neural Transm. (2009)).
  • MAO-B, an MAOB mRNA, or an MAOB SNP, haplotype, polymorphic variant, or genotype may be useful as a marker of IBS.
  • the presence or level of MAOB is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of MAO-B is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of MAO-B in a serum, plasma, saliva, or urine sample are available from, e.g., Novus Biologicals (Littleton, CO), Abeam (Cambridge, MA), and Santa Cruz Biotechnology, Inc. (Santa Cruz, CA).
  • a SNP, polymorphism, or particular haplotype or genotype of the MAOB gene is detected with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • 5-HT3R is a member of the ligand-gated ion channel receptor superfamily.
  • the 5- HT3R polypeptide is a subunit of the pentameric transmembrane 5-HT 3 receptors, which may consist of homopentameric 5-HT3R or heteropentameric structures containing at least one 5- HT3R subunit.
  • the 5-HT 3 receptor is an ion conducting pore that when bound by serotonin elicits a conformational change resulting in an excitatory response in neurons. It has been recently shown that microRNAs contribute to the regulation of HT3R receptors (Kapeller J et al., Hum Mol Genet. (2008)).
  • the 5-HT3R protein is encoded by the 5-hydroxytryptamine (serotonin) receptor 3A gene (HTR3A; Entrez GenelD: 3359) and is processed by removal of a signal peptide from the precursor polypeptide (NP_000860, NP_001 155244, and
  • NP_998786 after alternative splicing of the transcript (NM_000869, NM_001 161772, and NM_213621 ).
  • SNPs have been identified in the HTR3A gene, including rs33940208 (168 C>T), rs72466464 ( 170 OT), rs72466465 (205 G>A), rs72466467 (705 G>T), rs34327364 (714 G>A), rs4938063 (896 G>A), rs56232120 (969 G>A), rs35815285 ( 1 169 G>A), rs 12285005 ( 1 198 OT), rs35592083 ( 1320 C>T), rs341 1 1946 ( 1471 G>A), rs35944954 ( 1479 OT), rsl 176713 ( 1515 A>G), rs l 150220 (NT 033899.7, position 17420302 C/T), and
  • HTR3A SNPs have been associated with disorders, including treatment-resistant schizophrenia (Ji X et al , Ne rosci Lett. (2008)) and autism (Anderson BM et al, Neurogenetics (2009)).
  • 5-HT3R, an HTR3A mRNA, an HTR3A microRNA, or an HTR3A SNP, haplotype, polymorphic variant, or genotype may be useful as a marker of IBS.
  • the presence or level of HTR3A is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of 5-HT3R is detected at the level of protein expression using, e.g., an immunoassay ⁇ e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of 5-HT3R in a serum, plasma, saliva, or urine sample are available from, e.g., RayBiotech, Inc (Norcross, GA) and Santa Cruz Biotechnology, Inc. (Santa Cruz, CA).
  • a SNP, polymorphism, or particular haplotype or genotype of the HTR3A gene is detected with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT- PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • stress marker includes any peptide, hormone, metabolite, protein or gene that functions to mediate the central nervous system's response to stress. These markers include hormones released in response to stress, metabolites that are differentially produced in response to stress, genes and proteins that are differentially expressed in response to stress, and cellular receptors that bind stress-dependent hormones and metabolites.
  • IBS markers include corticotrophin-releasing hormone (CRH; CRF), Urocortin (Ucn),
  • CRFBP Corticotropin-releasing hormone-binding protein
  • ACTH Adrenocorticotropic hormone
  • CRF Corticotrophin-releasing hormone
  • CRH is a neuroendocrine hormone involved in the stress response of the central nervous system. This hormone mediates many of the stress-related peripheral effects and behavioral responses. CRH has been shown to be involved in stress-induced motility in both the upper and lower gastrointestinal tract. CRH is a 41 -amino acid peptide hormone
  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII SEQ ID NO: 12
  • a precursor polypeptide corticotrophin releasing hormone precursor
  • NP_000747 encoded by the corticotropin releasing hormone gene (CRH; Entrez
  • GeneID 1392; NM_000756.
  • SNPs SNPs have been identified in the CRH gene, including rs l 272151 1 ( 189 OG), rs72556398 (236 G>C), rs3832590 (330 -CCG>CGCCCG), rs6159 (473 A>C), rs28364016 (692 G>C), rs28364017 (NT_008183.18, position 18943997 A/G), and rs28364014 (NT_008183.18, position 18943683 C/G).
  • CRH a CRH precursor polypeptide, a CRH propeptide, a CRH mRNA, or a CRH SNP, haplotype, polymorphic variant, or genotype may be useful as a marker of IBS.
  • the presence or level of CRH is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of CRH is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of CRH in a serum, plasma, saliva, or urine sample are available from, e.g., IBL America (Minneapolis, MN) and Abbiotec (San Diego, CA).
  • a SNP, polymorphism, or particular haplotype or genotype of the CRH gene is detected with an assay such as, e.g., a
  • hybridization assay an amplification-based assay, e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • an amplification-based assay e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • Ucn is a peptide hormone and member of the sauvagine/corticotropin-releasing factor/urotensin I family.
  • Urocortin has high affinity for both the CRF- 1 and CRF-2 receptors and is a more potent anorectic than CRH.
  • CRH which is predominantly produced in the hypothalamus
  • UCN is produced in the gastrointestinal tract and as such, is more easily detected in plasma than is CRH.
  • UCN is a 40-amino acid peptide hormone (DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV; SEQ ID NO: 13) that is derived from a precursor polypeptide (urocortin preproprotein; NP_003344) encoded by urocortin gene (UCN; Entrez GeneID:7349; NM_003353).
  • urocortin preproprotein NP_003344
  • UCN is a 40-amino acid peptide hormone (DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV; SEQ ID NO: 13) that is derived from a precursor polypeptide (urocortin preproprotein; NP_003344) encoded by urocortin gene (UCN; Entrez GeneID:7349; NM_003353).
  • rs l 1557508 (NT_022184.14; position 6347221 C/T)
  • rs28364046 (NT_022184.14; position 6346948 A/G)
  • rs354031 14 (NT_022184.14; position 6346902 C/T)
  • rs6709781 (NT_022184.14; position 6346798 C/G)
  • rs28364045 (525 C>T
  • rs l 1557507 (NT_022184.14; position 63461 1 8 G/T).
  • UCN a UCN precursor polypeptide, a UCN propeptide, a UCN mRNA, or a UCN SNP, haplotype, polymorphic variant, or genotype may be useful as a marker of IBS.
  • the presence or level of UCN is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of UCN is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • an immunoassay e.g., ELISA
  • ELISA immunohistochemical assay
  • mass spectrometry based assay e.g., mass spectrometry kits.
  • Suitable ELISA kits for determining the presence or level of UCN in a serum, plasma, saliva, or urine sample are available from, e.g., Novus Biologicals (Littleton, CO), Abeam (Cambridge, MA), and US Biological (Swampscott, MA).
  • a SNP, polymorphism, or particular haplotype or genotype of the UCN gene is detected with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT- PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT- PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • CHLBP Corticotropin-releasing hormone-binding protein
  • CRHBP binds with high affinity to both CRH and Ucn, preventing CRF receptor activation and thus modulating the bioactivity and bioavailability of these peptide hormones. Strikingly, these interactions are mediated by distinct binding surfaces on CRHBP (Huising et al., J Biol Chem. (2008)).
  • CRHBP is a secreted glycoprotein derived from a precursor polypeptide (NP_001873) encoded by the corticotropin releasing hormone binding protein gene (CRHBP; Entrez GeneID: 1393; NM_001882).
  • rsl 133082 (372 C>A), rsl 053967 (529 OT), rs34347676 (544 G>A), rs26844303 (547 C>G), rs3792738 (NT_006713.14, position 26842142 A/C), rs41272246 (NT_006713.14, position 26843420 A/C), and rs2135078 (NT_006713.14, position 26859826 C/T).
  • CRHBP SNPs have been associated with disorders, including anxiety and alcohol abuse disorders (Enoch MA et al , PLoS One (2008)) and spontaneous preterm birth (Velez DR et al, PLoS One (2008)).
  • CRHBP, a CRHBP mRNA, or a CRHBP SNP, haplotype, polymorphic variant, or genotype may be useful as a marker of IBS.
  • the presence or level of CRHBP is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of CRHBP is detected at the level of protein expression using, e.g., an immunoassay ⁇ e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of CRHBP in a serum, plasma, saliva, or urine sample are available from, e.g., Abgent, Inc. (San Diego, CA), Abbiotec (San Diego, CA), and Alpco (Salem, NH).
  • a SNP, polymorphism, or particular haplotype or genotype of the CRHBP gene is detected with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT- PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • Cortisol is a corticosteroid hormone produced in the adrenal gland in response to stress and anxiety. Production of the glucocorticoid is regulated by CRH and the
  • Cortisol After being released in response to stress or anxiety, Cortisol functions to help restore homeostasis, and affects the levels of multiple metabolites in the body, including insulin, collagen free amino acids in serum, gastric acid secretion, sodium, potassium, water, and copper.
  • a mass spectrometry based assay e.g. , a proton magnetic resonance spectroscopy based assay, a chromatographic assay (e.g. , liquid chromatographic assay or HPLC), an immunoassay, (e.g., ELISA), a fluorescence resonance energy transfer (FRET) based assay (Yu et al.
  • ACTH Adrenocorticotropic hormone
  • ACTH is commonly produced in response to biological stress and affects the increased production of androgens and Cortisol from the adrenal cortex. ACTH is derived from the mature form of the pro-opiomelanocortin preprotein (NP_000930; NP_001030333) which is translated after alternative splicing of the proopiomelanocortin gene(POMC; Entrez GeneID:5443; NM_000939; NM_001035256).
  • Pro-opiomelanocortin preprotein is heavily processed into 1 1 potential polypeptides, including NPP (residues 27- 102), Melanotropin gamma (residues 77-87), a potential peptide (residues (105-134), corticotrophin (residues 138- 176), melanotropin alpha (residues 138- 150), corticotropin-like intermediary peptide (residues 156- 176), lipotropin beta (residues 179-267), lipotropin gamma (residues 179-234), melanotropin beta (residues 217-234), beta- endorphin (residues 237-267), and Met-enkephalin (residues 237-241 ).
  • rs8192605 (281 C>T), rs28932470 (421 A>G), rs28932471 (448 C>T), rs28930368 (545 OT), rs35254395 (552insAGCAGCGGC), rs 10654394 (560insGCCGCTGCT), rs34650613 (609 C>T), rs8192606 (657 C>G), rs45463492 (697 G>T), rs2071345 (848 OT), rs28932472 (969 C>G), rs3754860
  • NT_022184.14 position 4209187 C/T
  • rs 1009388 NT_022184.14, position 4207034 C/G
  • rs l 042571 NT_022184.14, position 4199820 C/T.
  • Parkinson's disease Shadrina M et al , Neurosci Lett. (2006)
  • obesity Ahituv N et al, Am J Hum Genet. (2007)
  • substance dependence Zhang H et al , Biol Psychiatry (2009).
  • ACTH, a POMC mRNA, or a POMC SNP, haplotype, polymorphic variant, or genotype may be useful as a marker of IBS.
  • the presence or level of POMC is detected at the level of mRNA expression with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, or a mass spectrometry based assay.
  • the presence or level of ACTH is detected at the level of protein expression using, e.g., an immunoassay (e.g., ELISA), an immunohistochemical assay, or a mass spectrometry based assay.
  • Suitable ELISA kits for determining the presence or level of ACTH in a serum, plasma, saliva, or urine sample are available from, Calbiotech (Spring Valley, CA), GenWay Biotech, Inc. (San Diego, CA), and MD Bioproducts (St. Paul, MN).
  • a SNP, polymorphism, or particular haplotype or genotype of the POMC gene is detected with an assay such as, e.g., a hybridization assay, an amplification-based assay, e.g. qPCR assay, RT-PCR assay, a single nucleotide sequencing assay, or a mass spectrometry based assay.
  • the determination of the presence or level of lactoferrin in a sample is also useful in the present invention.
  • the presence or level of lactoferrin is detected at the level of mRNA expression with an assay such as, for example, a hybridization assay or an amplification-based assay.
  • the presence or level of lactoferrin is detected at the level of protein expression using, for example, an immunoassay (e.g., ELISA) or an immunohistochemical assay.
  • ELISA immunoassay
  • a lactoferrin ELISA kit available from Calbiochem (San Diego, CA) can be used to detect human lactoferrin in a plasma, urine, bronchoalveolar lavage, or cerebrospinal fluid sample.
  • an ELISA kit available from U.S. Biological can be used to determine the level of lactoferrin in a plasma sample.
  • U.S. Patent Publication No. 20040137536 describes an ELISA assay for determining the presence of elevated lactoferrin levels in a stool sample.
  • U.S. Patent Publication No. 20040137536 describes an ELISA assay for determining the presence of elevated lactoferrin levels in a stool sample.
  • 20040033537 describes an ELISA assay for determining the concentration of endogenous lactoferrin in a stool, mucus, or bile sample. In some embodiments, then presence or level of anti-lactoferrin antibodies can be detected in a sample using, e.g., lactoferrin protein or a fragment thereof.
  • CDT carbohydrate deficient transferrin
  • the determination of the presence or level of carbohydrate deficient transferrin (CDT) in a sample is also useful in the present invention.
  • CDT is a diagnostic test currently used to detect the presence of heavy alcohol consumption.
  • the test measures the level of carbohydrate deficient transferrin proteins, i.e. transferrin polypeptides modified by zero, one, or two sialic acid chains, generally in a blood, serum, hair, or urine sample.
  • CDT tests are used to identify individuals with alcohol abuse problems or alcoholism.
  • CDT tests or CDT levels may be useful as a marker of IBS.
  • the presence or level of CDT is detected by an electrophoretic assay, as sold by Consumer Genetics, Inc.
  • the presence or level of CDT is detected using, e.g., an immunoassay (e.g., ELISA), an isoelectric focusing assay, an immunohistochemical assay, or a mass spectrometry based assay.
  • an immunoassay e.g., ELISA
  • an isoelectric focusing assay e.g., an isoelectric focusing assay
  • an immunohistochemical assay e.g., a mass spectrometry based assay.
  • Immunoassays such as ELISA are also particularly useful for determining the presence or level of C-reactive protein (CRP) in a sample.
  • CRP C-reactive protein
  • a sandwich colorimetric ELISA assay available from Alpco Diagnostics (Salem, NH) can be used to determine the level of CRP in a serum, plasma, urine, or stool sample.
  • an ELISA kit available from Biomeda Corporation can be used to detect CRP levels in a sample.
  • Other methods for determining CRP levels in a sample are described in, e.g., U.S. Patent Nos. 6,838,250 and 6,406,862; and U.S. Patent Publication Nos. 20060024682 and 20060019410.
  • hemoccult fecal occult blood
  • various kits have been developed to monitor gastrointestinal bleeding.
  • Hemoccult SENSA a Beckman Coulter product
  • Fibrinogen is a plasma glycoprotein synthesized in the liver composed of 3 structurally different subunits: alpha (FGA); beta (FGB); and gamma (FGG).
  • Thrombin causes a limited proteolysis of the fibrinogen molecule, during which fibrinopeptides A and B are released from the N-terminal regions of the alpha and beta chains, respectively.
  • Fibrinopeptides A and B which have been sequenced in many species, may have a physiological role as vasoconstrictors and may aid in local hemostasis during blood clotting.
  • human fibrinopeptide A comprises the sequence: Ala-Asp-Ser-Gly-Glu-Gly-Asp-Phe-Leu- Ala-Glu-Gly-Gly-Gly-Val-Arg (SEQ ID NO: 15).
  • human fibrinopeptide B comprises the sequence: Glp-Gly-Val-Asn-Asp-Asn-Glu-Glu-Gly-Phe-Phe- Ser-Ala-Arg (SEQ ID NO: 16).
  • An ELISA kit available from American Diagnostica Inc. (Stamford, CT) can be used to detect the presence or level of human fibrinopeptide A in plasma or other biological fluids.
  • CGRP calcitonin gene-related peptide
  • Calcitonin is a 32-amino acid peptide hormone synthesized by the parafollicular cells of the thyroid. It causes reduction in serum calcium, an effect opposite to that of parathyroid hormone.
  • CGRP is derived, with calcitonin, from the CT/CGRP gene located on chromosome 1 1.
  • CGRP is a 37-amino acid peptide and is a potent endogenous vasodilator. CGRP is primarily produced in nervous tissue; however, its receptors are expressed throughout the body.
  • An ELISA kit available from Cayman Chemical Co. (Ann Arbor, MI) can be used to detect the presence or level of human CGRP in a variety of samples including plasma, serum, nervous tissue, CSF, and culture media.
  • an anti-tissue transglutaminase (tTG) antibody in a sample is useful in the present invention.
  • anti-tTG antibody includes any antibody that recognizes tissue
  • transglutaminase or a fragment thereof.
  • Transglutaminases are a diverse family of Ca 2+ -dependent enzymes that are ubiquitous and highly conserved across species. Of all the transglutaminases, tTG is the most widely distributed.
  • the anti-tTG antibody is an anti-tTG IgA antibody, anti-tTG IgG antibody, or mixtures thereof.
  • An ELISA kit available from ScheBo Biotech USA Inc. (Marietta, GA) can be used to detect the presence or level of human anti-tTG IgA antibodies in a blood sample.
  • polymorphisms in the NOD2/CARD 15 gene in a sample is also useful in the present invention.
  • polymorphisms in the NOD2 gene such as a C2107T nucleotide variant that results in a R703W protein variant can be identified in a sample from an individual ⁇ see, e.g., U.S. Patent Publication No.
  • NOD2 mRNA levels can be used as a diagnostic marker of the present invention to aid in classifying IBS.
  • SERT serotonin reuptake transporter
  • polymorphisms in the promoter region of the SERT gene have effects on transcriptional activity, resulting in altered 5-HT reuptake efficiency. It has been shown that a strong genotypic association was observed between the SERT-P deletion/deletion genotype and the IBS phenotype ⁇ see, e.g., Yeo Gut, 53: 1396-1399 (2004)).
  • SERT mRNA levels can be used as a diagnostic marker of the present invention to aid in classifying IBS ⁇ see, e.g., Gershon, J. Clin. Gastroenterol., 39(5 Suppl.):S 184-193 (2005)).
  • the level of tryptophan hydroxylase- 1 mRNA is a diagnostic marker.
  • tryptophan hydroxylase- 1 mRNA has been shown to be significantly reduced in IBS ⁇ see, e.g., Coats, Gastroenterology, 126: 1897-1899 (2004)).
  • a lactulose breath test to measure methane which is indicative of bacterial overgrowth, can be used as a diagnostic marker for IBS.
  • Additional diagnostic markers include, but are not limited to, L-selectin/CD62L, anti-Ul -70 kDa autoantibodies, zona occludens 1 (ZO-1 ), vasoactive intestinal peptide (VIP), serum amyloid A, gastrin, NB3 gene polymorphisms, NCI1 gene polymorphisms, fecal leukocytes, a2A and a2C adrenoreceptor gene polymorphisms, IL-10 gene polymorphisms, TNF-a gene polymorphisms, TGF- ⁇ gene polymorphisms, a-adrenergic receptors, G- proteins, 5-HT 2A gene polymorphisms, 5-HTT LPR gene polymorphisms, 5-HT 4 receptor gene polymorphisms, zonulin, and the 33-mer peptide (Shan et al , Science, 297:2275-2279 (2002); PCT Patent Publication No. WO 03
  • classification markers are suitable for use in the methods, systems, and code of the present invention for classifying IBS into a category, form, or clinical subtype such as, for example, IBS-constipation (IBS-C), IBS-diarrhea (IBS-D), IBS-mixed (IBS-M), IBS-alternating (IBS-A), or post-infectious IBS (IBS-PI).
  • IBS-C IBS-constipation
  • IBS-D IBS-diarrhea
  • IBS-M IBS-mixed
  • IBS-A IBS-alternating
  • IBS-PI post-infectious IBS
  • classification markers include, without limitation, any of the diagnostic markers described above (e.g., leptin, serotonin reuptake transporter (SERT), tryptophan hydroxylase- 1 , 5-hydroxytryptamine (5- HT), tryptase, PGE 2 , histamine, and the like), as well as antrum mucosal protein 8, keratin-8, claudin-8, zonulin, corticotropin-releasing hormone receptor- 1 (CRHR 1 ), corticotropin- releasing hormone receptor-2 (CRHR2), and the like.
  • diagnostic markers e.g., leptin, serotonin reuptake transporter (SERT), tryptophan hydroxylase- 1 , 5-hydroxytryptamine (5- HT), tryptase, PGE 2 , histamine, and the like
  • antrum mucosal protein 8 keratin-8, claudin-8, zonulin, corticotropin-releasing hormone receptor- 1 (
  • Examples 1 and 2 below illustrate that measuring ⁇ -tryptase levels is particularly useful for distinguishing IBS-C patient samples from IBS-A and IBS-D patient samples.
  • mucosal SERT and tryptophan hydroxylase- 1 expression have been shown to be decreased in IBS-C and IBS-D (see, e.g., Gershon, /. Clin.
  • serum levels of histamine and PGE 2 is also particularly useful for distinguishing IBS-D patient samples from IBS-A, IBS-C, and healthy control patient samples.
  • the present invention provides methods, assays, systems, and code for classifying whether a sample is associated with IBS using a statistical algorithm or process to classify the sample as an IBS sample or non-IBS sample.
  • the present invention provides methods, systems, and code for classifying whether a sample is associated with IBS using a first statistical algorithm or process to classify the sample as a non-IBD sample or IBD sample (i.e., IBD rule-out step), followed by a second statistical algorithm or process to classify the non-IBD sample as an IBS sample or non-IBS sample (i.e., IBS rule-in step).
  • the statistical algorithms or processes independently comprise one or more learning statistical classifier systems.
  • a combination of learning statistical classifier systems advantageously provides improved sensitivity, specificity, negative predictive value, positive predictive value, and/or overall accuracy for classifying whether a sample is associated with IBS.
  • the methods, assays, systems, and code provided herein use a combination of at least two statistical algorithms.
  • the first statistical algorithm is a learning statistical classifier system selected from the group consisting of a random forest (RF), classification and regression tree (C&RT), boosted tree, neural network (NN), support vector machine (SVM), general chi-squared automatic interaction detector model, interactive tree, multiadaptive regression spline, machine learning classifier, and combinations thereof.
  • the first statistical algorithm is a single learning statistical classifier system.
  • the single learning statistical classifier system comprises a tree-based statistical algorithm such as a RF or C&RT.
  • the first statistical algorithm is a combination of at least two learning statistical classifier systems, e.g., used in tandem or parallel.
  • a RF can first be used to generate a prediction or probability value based upon the diagnostic marker profile, alone or in combination with a symptom profile, and a NN ⁇ e.g., artificial NN) can then be used to classify the sample as a non-IBD sample or IBD sample based upon the prediction or probability value and the same or different diagnostic marker profile or combination of profiles.
  • a NN e.g., artificial NN
  • the hybrid RF/NN learning statistical classifier system of the present invention typically classifies the sample as a non-IBD sample with a sensitivity, specificity, positive predictive value, negative predictive value, and/or overall accuracy of at least about 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
  • the second statistical algorithm comprises any of the learning statistical classifier systems described above.
  • the second statistical algorithm is a single learning statistical classifier system such as, for example, a tree-based statistical algorithm ⁇ e.g., RF or C&RT).
  • the second statistical algorithm is a combination of at least two learning statistical classifier systems, e.g., used in tandem or parallel.
  • a RF can first be used to generate a prediction or probability value based upon the diagnostic marker profile, alone or in combination with a symptom profile, and a NN ⁇ e.g., artificial NN) or SVM can then be used to classify the non-IBD sample as a non-IBS sample or IBS sample based upon the prediction or probability value and the same or different diagnostic marker profile or combination of profiles.
  • a NN e.g., artificial NN
  • SVM can then be used to classify the non-IBD sample as a non-IBS sample or IBS sample based upon the prediction or probability value and the same or different diagnostic marker profile or combination of profiles.
  • the hybrid RF/NN or RF/SVM learning statistical classifier system described herein typically classifies the sample as an IBS sample with a sensitivity, specificity, positive predictive value, negative predictive value, and/or overall accuracy of at least about 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
  • the data obtained from using the learning statistical classifier system or systems can be processed using a processing algorithm.
  • Such a processing algorithm can be selected, for example, from the group consisting of a multilayer perceptron, backpropagation network, and Levenberg-Marquardt algorithm. In other instances, a combination of such processing algorithms can be used, such as in a parallel or serial fashion.
  • the term "statistical algorithm” or “statistical process” includes any of a variety of statistical analyses used to determine relationships between variables.
  • the variables are the presence or level of at least one marker of interest and/or the presence or severity of at least one IBS-related symptom. Any number of markers and/or symptoms can be analyzed using a statistical algorithm described herein.
  • 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, or more biomarkers and/or symptoms can be included in a statistical algorithm.
  • logistic regression is used.
  • linear regression is used.
  • the statistical algorithms of the present invention can use a quantile measurement of a particular marker within a given population as a variable.
  • Quantiles are a set of "cut points" that divide a sample of data into groups containing (as far as possible) equal numbers of observations.
  • quartiles are values that divide a sample of data into four groups containing (as far as possible) equal numbers of observations.
  • the lower quartile is the data value a quarter way up through the ordered data set; the upper quartile is the data value a quarter way down through the ordered data set.
  • Quintiles are values that divide a sample of data into five groups containing (as far as possible) equal numbers of observations.
  • the present invention can also include the use of percentile ranges of marker levels (e.g., tertiles, quartile, quintiles, etc.), or their cumulative indices (e.g., quartile sums of marker levels, etc.) as variables in the algorithms (just as with continuous variables).
  • the statistical algorithms of the present invention comprise one or more learning statistical classifier systems.
  • learning statistical classifier system includes a machine learning algorithmic technique capable of adapting to complex data sets (e.g., panel of markers of interest and/or list of IBS-related symptoms) and making decisions based upon such data sets.
  • a single learning statistical classifier system such as a classification tree (e.g., random forest) is used.
  • a combination of 2, 3, 4, 5, 6, 7, 8, 9, 10, or more learning statistical classifier systems are used, preferably in tandem.
  • Examples of learning statistical classifier systems include, but are not limited to, those using inductive learning (e.g., decision/classification trees such as random forests, classification and regression trees (C&RT), boosted trees, etc. ), Probably Approximately Correct (PAC) learning, connectionist learning (e.g., neural networks (NN), artificial neural networks (ANN), neuro fuzzy networks (NFN), network structures, perceptrons such as multi-layer perceptrons, multi-layer feed-forward networks, applications of neural networks, Bayesian learning in belief networks, etc.), reinforcement learning (e.g., passive learning in a known environment such as naive learning, adaptive dynamic learning, and temporal difference learning, passive learning in an unknown environment, active learning in an unknown environment, learning action-value functions, applications of reinforcement learning, etc.), and genetic algorithms and evolutionary programming.
  • inductive learning e.g., decision/classification trees such as random forests, classification and regression trees (C&RT), boosted trees, etc.
  • PAC Probably Approximately Correct
  • connectionist learning e.g., neural
  • learning statistical classifier systems include support vector machines (e.g., Kernel methods), multivariate adaptive regression splines (MARS), Levenberg- Marquardt algorithms, Gauss-Newton algorithms, mixtures of Gaussians, gradient descent algorithms, and learning vector quantization (LVQ).
  • support vector machines e.g., Kernel methods
  • MMARS multivariate adaptive regression splines
  • Levenberg- Marquardt algorithms e.g., Gauss-Newton algorithms
  • mixtures of Gaussians e.g., Gauss-Newton algorithms
  • mixtures of Gaussians e.g., gradient descent algorithms
  • LVQ learning vector quantization
  • Random forests are learning statistical classifier systems that are constructed using an algorithm developed by Leo Breiman and Adele Cutler. Random forests use a large number of individual decision trees and decide the class by choosing the mode (i.e., most frequently occurring) of the classes as determined by the individual trees. Random forest analysis can be performed, e.g., using the RandomForests software available from Salford Systems (San Diego, CA). See, e.g., Breiman, Machine Learning, 45:5-32 (2001 ); and http://stat-www.berkeley.edu/users/breiman/RandomForests/cc_home.htm, for a description of random forests. [0404] Classification and regression trees represent a computer intensive alternative to fitting classical regression models and are typically used to determine the best possible model for a categorical or continuous response of interest based upon one or more predictors.
  • Classification and regression tree analysis can be performed, e.g., using the CART software available from Salford Systems or the Statistica data analysis software available from
  • Neural networks are interconnected groups of artificial neurons that use a mathematical or computational model for information processing based on a connectionist approach to computation.
  • neural networks are adaptive systems that change their structure based on external or internal information that flows through the network.
  • neural networks include feed-forward neural networks such as perceptrons, single-layer perceptrons, multi-layer perceptrons, backpropagation networks, AD ALINE networks, MADALINE networks, Learnmatrix networks, radial basis function (RBF) networks, and self-organizing maps or Kohonen self-organizing networks; recurrent neural networks such as simple recurrent networks and Hopfield networks; stochastic neural networks such as Boltzmann machines; modular neural networks such as committee of machines and associative neural networks; and other types of networks such as
  • Neural network analysis can be performed, e.g., using the Statistica data analysis software available from StatSoft, Inc. See, e.g., Freeman et ai, In “Neural Networks: Algorithms, Applications and Programming Techniques," Addison- Wesley Publishing Company ( 1991 ); Zadeh, Information and Control, 8:338-353 (1965); Zadeh, “IEEE Trans, on Systems, Man and Cybernetics," 3:28-44 ( 1973); Gersho et ai, In “Vector Quantization and Signal Compression,” Kluywer Academic Publishers, Boston, Dordrecht, London (1992); and Hassoun, “Fundamentals of Artificial Neural Networks,” MIT Press, Cambridge, Massachusetts, London ( 1995), for a description of neural networks.
  • Statistica data analysis software available from StatSoft, Inc. See, e.g., Freeman et ai, In “Neural Networks: Algorithms, Applications and Programming Techniques," Addison
  • Support vector machines are a set of related supervised learning techniques used for classification and regression and are described, e.g., in Cristianini et ai, "An Introduction to Support Vector Machines and Other Kernel-Based Learning Methods," Cambridge
  • Support vector machine analysis can be performed, e.g., using the SVM /3 ⁇ 4/l? software developed by Thorsten Joachims (Cornell University) or using the
  • the learning statistical classifier systems described herein can be trained and tested using a cohort of samples (e.g., serological samples) from healthy individuals, IBS patients, IBD patients, and/or Celiac disease patients.
  • samples e.g., serological samples
  • Samples from patients diagnosed with IBD can also be stratified into Crohn's disease or ulcerative colitis using an immunoassay as described in, e.g., U.S. Patent Nos.
  • Samples from patients diagnosed with IBS using a published criteria such as the Manning, Rome I, Rome II, or Rome III diagnostic criteria are suitable for use in training and testing the learning statistical classifier systems of the present invention.
  • Samples from healthy individuals can include those that were not identified as IBD and/or IBS samples.
  • One skilled in the art will know of additional techniques and diagnostic criteria for obtaining a cohort of patient samples that can be used in training and testing the learning statistical classifier systems of the present invention.
  • sensitivity refers to the probability that a diagnostic method, system, or code of the present invention gives a positive result when the sample is positive, e.g., having IBS.
  • Sensitivity is calculated as the number of true positive results divided by the sum of the true positives and false negatives. Sensitivity essentially is a measure of how well a method, system, or code of the present invention correctly identifies those with IBS from those without the disease.
  • the statistical algorithms can be selected such that the sensitivity of classifying IBS is at least about 60%, and can be, for example, at least about 65%, 70%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
  • the sensitivity of classifying IBS is at least about 90% when a combination of learning statistical classifier systems is used (see, Example 10 from US Patent Publication No.
  • the term "specificity" refers to the probability that a diagnostic method, system, or code of the present invention gives a negative result when the sample is not positive, e.g., not having IBS. Specificity is calculated as the number of true negative results divided by the sum of the true negatives and false positives. Specificity essentially is a measure of how well a method, system, or code of the present invention excludes those who do not have IBS from those who have the disease.
  • the statistical algorithms can be selected such that the specificity of classifying IBS is at least about 70%, for example, at least about 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
  • the specificity of classifying IBS is at least about 86% when a combination of learning statistical classifier systems is used (see, Example 10 from US Patent Publication No. 2008/0085524, which is incorporated herein by reference in its entirety for all purposes) or at least about 84% when a single learning statistical classifier system is used (see, Example 1 1 from US Patent Publication No. 2008/0085524, which is incorporated herein by reference in its entirety for all purposes).
  • negative predictive value refers to the probability that an individual identified as not having IBS actually does not have the disease. Negative predictive value can be calculated as the number of true negatives divided by the sum of the true negatives and false negatives. Negative predictive value is determined by the characteristics of the diagnostic method, system, or code as well as the prevalence of the disease in the population analyzed.
  • the statistical algorithms can be selected such that the negative predictive value in a population having a disease prevalence is in the range of about 70% to about 99% and can be, for example, at least about 70%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
  • the negative predictive value of classifying IBS is at least about 87% when a combination of learning statistical classifier systems is used (see, Example 10 from US Patent Publication No. 2008/0085524, which is incorporated herein by reference in its entirety for all purposes).
  • Positive predictive value refers to the probability that an individual identified as having IBS actually has the disease. Positive predictive value can be calculated as the number of true positives divided by the sum of the true positives and false positives. Positive predictive value is determined by the characteristics of the diagnostic method, system, or code as well as the prevalence of the disease in the population analyzed. The statistical algorithms can be selected such that the positive predictive value in a population having a disease prevalence is in the range of about 80% to about 99% and can be, for example, at least about 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
  • the positive predictive value of classifying IBS is at least about 90% when a combination of learning statistical classifier systems is used (see, Example 10 from US Patent Publication No. 2008/0085524, which is incorporated herein by reference in its entirety for all purposes).
  • Predictive values are influenced by the prevalence of the disease in the population analyzed.
  • the statistical algorithms can be selected to produce a desired clinical parameter for a clinical population with a particular IBS prevalence.
  • learning statistical classifier systems can be selected for an IBS prevalence of up to about 1 %, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, or 70%, which can be seen, e.g., in a clinician's office such as a
  • gastroenterologist's office or a general practitioner's office are examples of gastroenterologist's office.
  • the term “overall agreement” or “overall accuracy” refers to the accuracy with which a method, system, or code of the present invention classifies a disease state. Overall accuracy is calculated as the sum of the true positives and true negatives divided by the total number of sample results and is affected by the prevalence of the disease in the population analyzed.
  • the statistical algorithms can be selected such that the overall accuracy in a patient population having a disease prevalence is at least about 60%, and can be, for example, at least about 65%, 70%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
  • the overall accuracy of classifying IBS is at least about 80% when a combination of learning statistical classifier systems is used (see, Example 10 from US Patent Publication No. 2008/0085524, which is incorporated herein by reference in its entirety for all purposes).
  • FIG. 13 illustrates a disease classification system (DCS) (200) according to one embodiment of the present invention.
  • a DCS includes a DCS intelligence module (205), such as a computer, having a processor (215) and memory module (210).
  • the intelligence module also includes communication modules (not shown) for transmitting and receiving information over one or more direct connections (e.g., USB, Firewire, or other interface) and one or more network connections (e.g., including a modem or other network interface device).
  • the memory module may include internal memory devices and one or more external memory devices.
  • the intelligence module also includes a display module (225), such as a monitor or printer.
  • the intelligence module receives data such as patient test results from a data acquisition module such as a test system (250), either through a direct connection or over a network (240).
  • a data acquisition module such as a test system (250)
  • the test system may be configured to run multianalyte tests on one or more patient samples (255) and automatically provide the test results to the intelligence module.
  • the data may also be provided to the intelligence module via direct input by a user or it may be downloaded from a portable medium such as a compact disk (CD) or a digital versatile disk (DVD).
  • the test system may be integrated with the intelligence module, directly coupled to the intelligence module, or it may be remotely coupled with the intelligence module over the network.
  • the intelligence module may also communicate data to and from one or more client systems (230) over the network as is well known. For example, a requesting physician or healthcare provider may obtain and view a report from the intelligence module, which may be resident in a laboratory or hospital, using a client system (230).
  • the network can be a LAN (local area network), WAN (wide area network), wireless network, point-to-point network, star network, token ring network, hub network, or other configuration.
  • TCP/IP Transfer Control Protocol and Internet Protocol
  • IP Transfer Control Protocol and Internet Protocol
  • the Internet often referred to as the "Internet” with a capital "I,” that will be used in many of the examples herein, but it should be understood that the networks that the present invention might use are not so limited, although TCP/IP is the currently preferred protocol.
  • the intelligence module could be implemented as a desktop personal computer, workstation, mainframe, laptop, etc.
  • Each client system could include a desktop personal computer, workstation, laptop, PDA, cell phone, or any WAP-enabled device or any other computing device capable of interfacing directly or indirectly to the Internet or other network connection.
  • a client system typically runs an HTTP client, e.g., a browsing program, such as Microsoft's Internet Explorer browser, Netscape's Navigator browser, Opera's browser, or a WAP-enabled browser in the case of a cell phone, PDA or other wireless device, or the like, allowing a user of the client system to access, process, and view information and pages available to it from the intelligence module over the network.
  • HTTP client e.g., a browsing program, such as Microsoft's Internet Explorer browser, Netscape's Navigator browser, Opera's browser, or a WAP-enabled browser in the case of a cell phone, PDA or other wireless device, or the like
  • Each client system also typically includes one or more user interface devices, such as a keyboard, a mouse, touch screen, pen or the like, for interacting with a graphical user interface (GUI) provided by the browser on a display ⁇ e.g., monitor screen, LCD display, etc.) (235) in conjunction with pages, forms, and other information provided by
  • the present invention is suitable for use with the Internet, which refers to a specific global internetwork of networks.
  • the Internet refers to a specific global internetwork of networks.
  • other networks can be used instead of the Internet, such as an intranet, an extranet, a virtual private network (VPN), a non-TCP/IP based network, any LAN or WAN, or the like.
  • VPN virtual private network
  • non-TCP/IP based network any LAN or WAN, or the like.
  • each client system and all of its components are operator configurable using applications, such as a browser, including computer code run using a central processing unit such as an Intel ® Pentium ® processor or the like.
  • applications such as a browser, including computer code run using a central processing unit such as an Intel ® Pentium ® processor or the like.
  • the intelligence module and all of its components might be operator configurable using application(s) including computer code run using a central processing unit (215) such as an Intel Pentium processor or the like, or multiple processor units.
  • Computer code for operating and configuring the intelligence module to process data and test results as described herein is preferably downloaded and stored on a hard disk, but the entire program code, or portions thereof, may also be stored in any other volatile or non-volatile memory medium or device as is well known, such as a ROM or RAM, or provided on any other computer readable medium (260) capable of storing program code, such as a compact disk (CD) medium, digital versatile disk (DVD) medium, a floppy disk, ROM, RAM, and the like.
  • the computer code for implementing various aspects and embodiments of the present invention can be implemented in any programming language that can be executed on a computer system such as, for example, in C, C++, C#, HTML, Java, JavaScript, or any other scripting language, such as VBScript. Additionally, the entire program code, or portions thereof, may be embodied as a carrier signal, which may be transmitted and downloaded from a software source (e.g., server) over the Internet, or over any other conventional network connection as is well known (e.g., extranet, VPN, LAN, etc.) using any communication medium and protocols (e.g., TCP/I P, HTTP, HTTPS, Ethernet, etc.) as are well known.
  • a software source e.g., server
  • any other conventional network connection e.g., extranet, VPN, LAN, etc.
  • any communication medium and protocols e.g., TCP/I P, HTTP, HTTPS, Ethernet, etc.
  • the intelligence module implements a disease classification process for analyzing patient test results and/or questionnaire responses to determine whether a patient sample is associated with IBS.
  • the data may be stored in one or more data tables or other logical data structures in memory (210) or in a separate storage or database system coupled with the intelligence module.
  • One or more statistical processes are typically applied to a data set including test data for a particular patient.
  • the test data might include a diagnostic marker profile, which comprises data indicating the presence or level of at least one marker in a sample from the patient.
  • the test data might also include a symptom profile, which comprises data indicating the presence or severity of at least one symptom associated with IBS that the patient is experiencing or has recently experienced.
  • a statistical process produces a statistically derived decision classifying the patient sample as an IBS sample or non-IBS sample based upon the diagnostic marker profile and/or symptom profile.
  • a first statistical process produces a first statistically derived decision classifying the patient sample as an IBD sample or non-IBD sample based upon the diagnostic marker profile and/or symptom profile. If the patient sample is classified as a non-IBD sample, a second statistical process is applied to the same or a different data set to produce a second statistically derived decision classifying the non- IBD sample as an IBS sample or non-IBS sample.
  • the first and/or the second statistically derived decision may be displayed on a display device associated with or coupled to the intelligence module, or the decision(s) may be provided to and displayed at a separate system, e.g., a client system (230).
  • the displayed results allow a physician to make a reasoned diagnosis or prognosis.
  • the methods, systems, and code of the present invention can further comprise administering to the individual a therapeutically effective amount of a drug useful for treating one or more symptoms associated with IBS (i.e., an IBS drug).
  • a drug useful for treating one or more symptoms associated with IBS i.e., an IBS drug
  • the IBS drug can be administered alone or co-administered in combination with one or more additional IBS drugs and/or one or more drugs that reduce the side-effects associated with the IBS drug.
  • IBS drugs can be administered with a suitable pharmaceutical excipient as necessary and can be carried out via any of the accepted modes of administration.
  • administration can be, for example, intravenous, topical, subcutaneous, transcutaneous, transdermal, intramuscular, oral, buccal, sublingual, gingival, palatal, intra-joint, parenteral, intra-arteriole, intradermal, intraventricular, intracranial, intraperitoneal, intralesional, intranasal, rectal, vaginal, or by inhalation.
  • co-administer it is meant that an IBS drug is administered at the same time, just prior to, or just after the administration of a second drug (e.g., another IBS drug, a drug useful for reducing the side-effects of the IBS drug, etc.).
  • a second drug e.g., another IBS drug, a drug useful for reducing the side-effects of the IBS drug, etc.
  • a therapeutically effective amount of an IBS drug may be administered repeatedly, e.g., at least 2, 3, 4, 5, 6, 7, 8, or more times, or the dose may be administered by continuous infusion.
  • the dose may take the form of solid, semi-solid, lyophilized powder, or liquid dosage forms, such as, for example, tablets, pills, pellets, capsules, powders, solutions, suspensions, emulsions, suppositories, retention enemas, creams, ointments, lotions, gels, aerosols, foams, or the like, preferably in unit dosage forms suitable for simple administration of precise dosages.
  • unit dosage form refers to physically discrete units suitable as unitary dosages for human subjects and other mammals, each unit containing a predetermined quantity of an IBS drug calculated to produce the desired onset, tolerability, and/or therapeutic effects, in association with a suitable pharmaceutical excipient (e.g., an ampoule).
  • a suitable pharmaceutical excipient e.g., an ampoule
  • more concentrated dosage forms may be prepared, from which the more dilute unit dosage forms may then be produced.
  • the more concentrated dosage forms thus will contain substantially more than, e.g., at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, or more times the amount of the IBS drug.
  • the dosage forms typically include a conventional pharmaceutical carrier or excipient and may additionally include other medicinal agents, carriers, adjuvants, diluents, tissue permeation enhancers, solubilizers, and the like.
  • Appropriate excipients can be tailored to the particular dosage form and route of administration by methods well known in the art (see, e.g., REMINGTON'S PHARMACEUTICAL SCIENCES, supra).
  • excipients include, but are not limited to, lactose, dextrose, sucrose, sorbitol, mannitol, starches, gum acacia, calcium phosphate, alginates, tragacanth, gelatin, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, saline, syrup, methylcellulose, ethylcellulose, hydroxypropylmethylcellulose, and polyacrylic acids such as Carbopols, e.g., Carbopol 941 , Carbopol 980, Carbopol 98 1 , etc.
  • Carbopols e.g., Carbopol 941 , Carbopol 980, Carbopol 98 1 , etc.
  • the dosage forms can additionally include lubricating agents such as talc, magnesium stearate, and mineral oil; wetting agents; emulsifying agents; suspending agents; preserving agents such as methyl-, ethyl-, and propyl -hydroxy-benzoates (i.e., the parabens); pH adjusting agents such as inorganic and organic acids and bases; sweetening agents; and flavoring agents.
  • lubricating agents such as talc, magnesium stearate, and mineral oil
  • wetting agents such as talc, magnesium stearate, and mineral oil
  • emulsifying agents such as methyl-, ethyl-, and propyl -hydroxy-benzoates (i.e., the parabens)
  • pH adjusting agents such as inorganic and organic acids and bases
  • sweetening agents and flavoring agents.
  • the dosage forms may also comprise biodegradable polymer beads, dextran, and cyclodextrin inclusion complexes.
  • the therapeutically effective dose can be in the form of tablets, capsules, emulsions, suspensions, solutions, syrups, sprays, lozenges, powders, and sustained-release formulations.
  • Suitable excipients for oral administration include pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, gelatin, sucrose, magnesium carbonate, and the like.
  • the therapeutically effective dose takes the form of a pill, tablet, or capsule, and thus, the dosage form can contain, along with an IBS drug, any of the following: a diluent such as lactose, sucrose, dicalcium phosphate, and the like; a disintegrant such as starch or derivatives thereof; a lubricant such as magnesium stearate and the like; and a binder such a starch, gum acacia, polyvinylpyrrolidone, gelatin, cellulose and derivatives thereof.
  • An IBS drug can also be formulated into a suppository disposed, for example, in a polyethylene glycol (PEG) carrier.
  • PEG polyethylene glycol
  • Liquid dosage forms can be prepared by dissolving or dispersing an IBS drug and optionally one or more pharmaceutically acceptable adjuvants in a carrier such as, for example, aqueous saline (e.g., 0.9% w/v sodium chloride), aqueous dextrose, glycerol, ethanol, and the like, to form a solution or suspension, e.g., for oral, topical, or intravenous administration.
  • a carrier such as, for example, aqueous saline (e.g., 0.9% w/v sodium chloride), aqueous dextrose, glycerol, ethanol, and the like, to form a solution or suspension, e.g., for oral, topical, or intravenous administration.
  • An IBS drug can also be formulated into a retention enema.
  • the therapeutically effective dose can be in the form of emulsions, lotions, gels, foams, creams, jellies, solutions, suspensions, ointments, and transdermal patches.
  • an IBS drug can be delivered as a dry powder or in liquid form via a nebulizer.
  • the therapeutically effective dose can be in the form of sterile injectable solutions and sterile packaged powders.
  • injectable solutions are formulated at a pH of from about 4.5 to about 7.5.
  • the therapeutically effective dose can also be provided in a lyophilized form.
  • dosage forms may include a buffer, e.g., bicarbonate, for reconstitution prior to
  • the buffer may be included in the lyophilized dosage form for
  • the lyophilized dosage form may further comprise a suitable vasoconstrictor, e.g., epinephrine.
  • a suitable vasoconstrictor e.g., epinephrine.
  • the lyophilized dosage form can be provided in a syringe, optionally packaged in combination with the buffer for reconstitution, such that the reconstituted dosage form can be immediately administered to an individual.
  • an IBS drug can be administered at the initial dosage of from about 0.001 mg/kg to about 1000 mg/kg daily.
  • the dosages may be varied depending upon the requirements of the individual, the severity of IBS symptoms, and the IBS drug being employed. For example, dosages can be empirically determined considering the severity of IBS symptoms in an individual classified as having IBS according to the methods described herein.
  • the dose administered to an individual should be sufficient to affect a beneficial therapeutic response in the individual over time.
  • the size of the dose can also be determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of a particular IBS drug in an individual. Determination of the proper dosage for a particular situation is within the skill of the practitioner. Generally, treatment is initiated with smaller dosages which are less than the optimum dose of the IBS drug.
  • the dosage is increased by small increments until the optimum effect under circumstances is reached.
  • the total daily dosage may be divided and administered in portions during the day, if desired.
  • IBS drug includes all pharmaceutically acceptable forms of a drug that is useful for treating one or more symptoms associated with IBS.
  • the IBS drug can be in a racemic or isomeric mixture, a solid complex bound to an ion exchange resin, or the like.
  • the IBS drug can be in a solvated form.
  • IBS drug is also intended to include all pharmaceutically acceptable salts, derivatives, and analogs of the IBS drug being described, as well as combinations thereof.
  • the pharmaceutically acceptable salts of an IBS drug include, without limitation, the tartrate, succinate, tartarate, bitartarate, dihydrochloride, salicylate, hemisuccinate, citrate, maleate, hydrochloride, carbamate, sulfate, nitrate, and benzoate salt forms thereof, as well as combinations thereof and the like.
  • Any form of an IBS drug is suitable for use in the methods of the present invention, e.g., a pharmaceutically acceptable salt of an IBS drug, a free base of an IBS drug, or a mixture thereof.
  • Suitable drugs that are useful for treating one or more symptoms associated with IBS include, but are not limited to, serotonergic agents, antidepressants, chloride channel activators, chloride channel blockers, guanylate cyclase agonists, antibiotics, opioids, neurokinin antagonists, antispasmodic or anticholinergic agents, belladonna alkaloids, barbiturates, glucagon-like peptide- 1 (GLP- 1 ) analogs, corticotropin releasing factor (CRF) antagonists, probiotics, free bases thereof, pharmaceutically acceptable salts thereof, derivatives thereof, analogs thereof, and combinations thereof.
  • Other IBS drugs include bulking agents, dopamine antagonists, carminatives, tranquilizers, dextofisopam, phenytoin, timolol, and diltiazem.
  • Serotonergic agents are useful for the treatment of IBS symptoms such as constipation, diarrhea, and/or alternating constipation and diarrhea.
  • IBS symptoms such as constipation, diarrhea, and/or alternating constipation and diarrhea.
  • serotonergic agents are described in Cash et al., Aliment. Pharmacol. Ther.
  • 5-HT 3 receptor agonists ⁇ e.g., MKC-733, etc.
  • 5-HT 4 receptor agonists e.g., tegaserod (ZelnormTM), prucalopride, AGl -001 , etc.
  • 5-HT 3 receptor antagonists e.g., alosetron (Lotronex ® ), cilansetron, ondansetron, granisetron, dolasetron, ramosetron, palonosetron, E-3620, DDP-225, DDP-733, etc.
  • mixed 5-HT receptor antagonists/5-HT 4 receptor agonists e.g., cisapride, mosapride, renzapride, etc.
  • free bases thereof pharmaceutically acceptable salts thereof, derivatives thereof, analogs thereof, and combinations thereof.
  • amino acids like glutamine and glutamic acid which regulate intestinal permeability by affecting neuronal or glial cell signaling can be
  • Antidepressants such as selective serotonin reuptake inhibitor (SSRI) or tricyclic antidepressants are particularly useful for the treatment of IBS symptoms such as abdominal pain, constipation, and/or diarrhea.
  • SSRI antidepressants include citalopram, fluvoxamine, paroxetine, fluoxetine, sertraline, free bases thereof,
  • tricyclic antidepressants include, but are not limited to, desipramine, nortriptyline, protriptyline, amitriptyline, clomipramine, doxepin, imipramine, trimipramine, maprotiline, amoxapine, clomipramine, free bases thereof, pharmaceutically acceptable salts thereof, derivatives thereof, analogs thereof, and combinations thereof.
  • Chloride channel activators are useful for the treatment of IBS symptoms such as constipation.
  • a non-limiting example of a chloride channel activator is lubiprostone
  • (AmitizaTM), a free base thereof, a pharmaceutically acceptable salt thereof, a derivative thereof, or an analog thereof.
  • chloride channel blockers such as crofelemer are useful for the treatment of IBS symptoms such as diarrhea.
  • Guanylate cyclase agonists such as MD- 1 100 are useful for the treatment of constipation associated with IBS (see, e.g., Bryant et al, Gastroenterol. , 128:A-257 (2005)).
  • Antibiotics such as neomycin can also be suitable for use in treating constipation associated with IBS (see, e.g., Park et ah , Gastroenterol. , 128:A-258 (2005)).
  • Non-absorbable antibiotics like rifaximin are suitable to treat small bowel bacterial overgrowth and/or constipation associated with IBS (see, e.g., Sharara et al. , Am. J. Gastroenterol., 101 :326-333 (2006)).
  • Opioids such as kappa opiods (e.g., asimadoline) may be useful for treating pain and/or constipation associated with IBS.
  • Neurokinin (NK) antagonists such as talnetant, saredutant, and other NK2 and/or NK3 antagonists may be useful for treating IBS symptoms such as oversensitivity of the muscles in the colon, constipation, and/or diarrhea.
  • Antispasmodic or anticholinergic agents such as dicyclomine may be useful for treating IBS symptoms such as spasms in the muscles of the gut and bladder.
  • Other antispasmodic or anticholinergic agents such as belladonna alkaloids (e.g., atropine, scopolamine,
  • hyoscyamine, etc. can be used in combination with barbiturates such as phenobarbital to reduce bowel spasms associated with IBS.
  • GLP- 1 analogs such as GTP-010 may be useful for treating IBS symptoms such as constipation.
  • CRF antagonists such as astressin and probiotics such as VSL#3 ® may be useful for treating one or more IBS symptoms.
  • IBS drugs currently in use or in development that are suitable for treating one or more symptoms associated with IBS.
  • An individual can also be monitored at periodic time intervals to assess the efficacy of a certain therapeutic regimen once a sample from the individual has been classified as an IBS sample. For example, the levels of certain markers change based on the therapeutic effect of a treatment such as a drug. The patient is monitored to assess response and understand the effects of certain drugs or treatments in an individualized approach.
  • patients may not respond to a drug, but the markers may change, suggesting that these patients belong to a special population (not responsive) that can be identified by their marker levels. These patients can be discontinued on their current therapy and alternative treatments prescribed.
  • Example 1 A Tryptase ELISA for Predicting IBS.
  • FIG. 1 This example describes a sensitive ELISA for detecting the presence or level of mast cell ⁇ -tryptase. See also, Figures 1 -7.
  • FIG. 1 Background: Mast cells play an important role in the pathogenesis of irritable bowel syndrome (IBS). Increased mast cell infiltration and activation in distal gut segments are associated with symptom onset and severity of IBS. Mast cells have been implicated in the elevated response of visceral afferent nerves to mucosal stimulus in IBS patients.
  • IBS irritable bowel syndrome
  • ELISA assay was developed for the determination of serum mast cell ⁇ -tryptase level using rabbit anti-tryptase as capture antibody and alkaline phosphatase conjugated G3 as detecting antibody.
  • Luminescent substrate CPSD diisodium 3-(4-methoxyspiro ⁇ 1 ,2- dioxetane-3,2'-(5'-chloro)tricyclo[3.3.1 .13,7]decan ⁇ -4-yl)phenyl phosphate
  • Linear dose-response curve was observed over the standard range of 1 - 1000 ng/ml for ⁇ -tryptase in buffer with 5% BSA and 10% normal human serum.
  • the low limit of the assay was 0.019 ng/ml, the intra-assay and inter-assay coefficients of variation were below 15% at 1 ng/ml and 1000 ng/ml tryptase concentrations.
  • the recovery of known amounts of purified tryptase added to serum was 88%.
  • the assay sensitivity for IBS-C and IBS-D were 21.5% and 24.9% respectively.
  • serum tryptase levels may help differentiate IBS-D from other types of irritable bowel syndrome.
  • IBS irritable bowel syndrome
  • results The average serum tryptase level in healthy controls was 7.1 +2.5 ng/ml. IBS-D and IBS-A patients showed higher serum tryptase concentrations ( 10.3+8.7ng/ml for IBS-D and 12.1 + 10.7ng/ml for IBS-A) than the healthy control subjects, while the average tryptase level was 9.6+9.4 ng/ml for IBS-C. There was a statistical difference of serum tryptase levels between the IBS-C and IBS-D groups (p ⁇ 0.01 ).
  • Serum tryptase concentration is the first biomarker developed so far that differentiates IBS-D from IBS-C patients. Serum tryptase levels can be combined with other IBS biomarkers to improve the accuracy of diagnosing IBS.
  • Figure 8 shows the dose-dependent responses of human tryptase in the tryptase ELISA described herein.
  • Protocol A 96-well microtiter plate was coated with 100ml of 2mg/ml of anti-human tryptase antibody in sodium carbonate (pH 9.6) at 4°C overnight. After washing with PBST, the plate was incubated with 300 ml/well of blocking/assay buffer (5% BSA in PBS) at room temperature (RT) for 30 minutes with gentle agitation. After washing, 100 ml/well of serially diluted ( 1 :8 in assay buffer) human tryptase were added to the plate.
  • blocking/assay buffer 5% BSA in PBS
  • Figure 9 shows the optimization of the tryptase ELISA described herein.
  • IBS-C constipation predominant
  • IBS-A alternating symptoms.
  • Each value is the average of duplicate determinations.
  • Solid lines are the median value from each group. The cutoff value of 12ng/ml was calculated from healthy subjects with median plus 2SD (dotted line). *p ⁇ 0.0001 vs healthy subjects; **p ⁇ 0.0001 vs IBS-D; Mann Whitney U test.
  • Figure 1 1 shows the increased serum level of histamine and PGE 2 in IBS patients vs healthy controls.
  • PGE 2 was measured in 50 ⁇ of serum by ELISA using a kit from Cayman. Histamine was measured in 10 ⁇ of serum using an Immunotech EIA kit. The samples were tested in duplicate. The solid line is the median of each group.
  • IBS-D may be diagnosed or distinguished from other clinical subtypes of IBS by detecting a higher level of PGE 2 relative to healthy control, IBS-A, and/or IBS-C samples or standards.
  • IBS-D or IBS-A may be diagnosed or distinguished from IBS-C by detecting a higher level of histamine relative to healthy control and/or IBS-C samples or standards.
  • Example 3 Questionnaire for Identifying the Presence or Severity of Symptoms Associated with IBS.
  • This example illustrates a questionnaire that is useful for identifying the presence or severity of one or more IBS-related symptoms in an individual.
  • the questionnaire can be completed by the individual at the clinic or physician's office, or can be brought home and submitted when the individual returns to the clinic or physician's office, e.g., to have his or her blood drawn.
  • the questionnaire comprises a first section containing a set of questions asking the individual to provide answers regarding the presence or severity of one or more symptoms associated with IBS.
  • the questionnaire generally includes questions directed to identifying the presence, severity, frequency, and/or duration of IBS-related symptoms such as chest pain, chest discomfort, heartburn, uncomfortable fullness after having a regular-sized meal, inability to finish a regular-sized meal, abdominal pain, abdominal discomfort, constipation, diarrhea, bloating, and/or abdominal distension.
  • the first section of the questionnaire includes all or a subset of the questions from a questionnaire developed by the Rome Foundation Board based on the Rome III criteria, available at http://www.romecriteria.org/questionnaires/.
  • the questionnaire can include all or a subset of the 93 questions set forth on pages 920-936 of the Rome III Diagnostic Questionnaire for the Adult Functional GI Disorders (Appendix C), available at http://www.romecriteria.org/pdfs/AdultFunctGIQ.pdf.
  • the first section of the questionnaire contains 16 of the 93 questions set forth in the Rome III
  • the first section of the questionnaire can contain a subset ⁇ e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15) of the 16 questions shown in Table 3.
  • the following 10 questions set forth in Table 3 can be included in the questionnaire: Question Nos. 2, 3, 5, 6, 9, 10, 1 1 , 13, 15, and 16.
  • the first section of the questionnaire can comprise questions similar to the questions shown in Table 3 regarding pain, discomfort, and/or changes in stool consistency.
  • Table 3 Exemplary first section of a questionnaire for identifying the presence or severity of IBS-related symptoms.
  • the questionnaire comprises a second section containing a set of questions asking the individual to provide answers regarding the presence or severity of negative thoughts or feelings associated with having IBS-related pain or discomfort.
  • the questionnaire can include questions directed to identifying the presence, severity, frequency, and/or duration of anxiety, fear, nervousness, concern, apprehension, worry, stress, depression, hopelessness, despair, pessimism, doubt, and/or negativity when the individual is experiencing pain or discomfort associated with one or more symptoms of IBS.
  • the second section of the questionnaire includes all or a subset of the questions from a questionnaire described in Sullivan et ai , The Pain Catastrophizing Scale: Development and Validation, Psychol. Assess.
  • the second section of the questionnaire can contain 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, or more questions or statements related to identifying the presence or severity of negative thoughts or feelings associated with having IBS-related pain or discomfort.
  • an individual can be asked to rate the degree to which he or she has one or more of the following thoughts and feelings when experiencing pain: "I worry all the time about whether the pain will end”; “I feel I can't stand it anymore”; “I become afraid that the pain will get worse”; “I anxiously want the pain to go away”; and “I keep thinking about how much it hurts.”
  • the questionnaire can comprise similar questions regarding negative thoughts or feelings associated with having IBS-related pain or discomfort.
  • the questionnaire includes only questions from the first section of the questionnaire or a subset thereof (see, e.g., Table 3). In other embodiments, the questionnaire includes only questions from the second section of the questionnaire or a subset thereof.
  • the numbers corresponding to the answers to each question can be summed and the resulting value can be combined with the analysis of one or more diagnostic markers in a sample from the individual and processed using the statistical algorithms described herein to increase the accuracy of predicting IBS.
  • a "Yes” or “No” answer from the individual to the following question: "Are you currently experiencing any symptoms?" can be combined with the analysis of one or more of the biomarkers described herein and processed using a single statistical algorithm or a combination of statistical algorithms to increase the accuracy of predicting IBS.
  • Example 4 Blood based diagnostic assay for the diagnosis of Irritable Bowel Syndrome (IBS).
  • IBS Irritable Bowel Syndrom
  • the total cohort used to develop the present assay consisted of 1 ,721 serum samples.
  • the validation cohort used consisted of 516 serum samples, of which 50% were diagnosed with IBS according to Rome II or Rome III criteria; 36% were Non-IBS disease controls; and 14% were normal healthy controls.
  • the sensitivity of the assay is 50% and the specificity is 88%.
  • IBS When ruling in IBS, wherein the physician has determined that there is about a 75% probability of disease in the patient, 94% of the positive test results are true positives, while 38% of the negative test results are true negatives.
  • IBS When ruling out IBS, wherein the physician has determined that there is about a 25% probability of disease in the patient, 86% of the negative test results are true negatives, while 61 % of the positive test results are true positives.
  • the assay involves the quantitative analysis of bio-markers combined with a two learning statistical classifier system consisting of a random forest classifier and a neural network classifier.
  • the specimen requirements for the assay consist of the physician obtaining 2.0 ml of separated serum in, for example, an SST tube.
  • the sample should be centrifuges and refrigerates within 2 hours of collection.
  • the samples should be refrigerated or frozen.
  • the samples should be stored, prior to use, for no more than 7 days at 4°C or 30 days if frozen.
  • ELISAs enzyme-linked immunosorbent assays
  • chemi luminescent assays are performed for the IBS biomarkers BDNF, NGAL, TWEAK, GRO- ⁇ , IL- 1 ⁇ , and TIMP- 1 . Reference values for the normal range of these markers in healthy subjects are provided in Table 4.
  • information from the detection of the IBS biomarkers described above can be combined with symptom information provided by the patient.
  • the patient may fill out a checklist of their symptoms, the information from which can be combined with the information from the IBS biomarkers to further aid the clinician in the diagnosis of IBS.
  • An example of a checklist that may be used in this fashion is provided in Table 5.
  • Abnormal stool form (lumpy/hard or loose/watery stool)
  • Abnormal stool passage (straining, urgency, or feeling of incomplete
  • Example 5 Identification of Novel Metabolites in Serum of Patients with Irritable Bowel Syndrome.
  • 5-Hydroxytryptamine is converted from tryptophan catalyzed by tryptophan dehydrogenase. Over 95% of 5-HT in the body is released from the enterohromaffin cells of the gastrointestinal tract. 5-HT acts through various receptor subtypes located on submucosal and myenteric neurons of the enteric nerve system is known to play a key role in the normal functioning of the GI tract. Abnormal level of 5-HT is associated with pathogenesis of irritable bowel syndrome.
  • 5-HT Hydrotryptamines
  • Serum metabolites were investigated in samples from 12 IBS-C, 24 IBS-DJ 4 IBS- M patients and 38 healthy subjects using high performance liquid chromatography (HPLC).
  • HPLC high performance liquid chromatography
  • Plasma, serum and urine samples from the same subjects were compared for levels of 5-HT and its metabolites.
  • Liquid chromatography was performed using an Agilent 1200 HPLC system consisting of a quaternary pump, an autosampler, a DAD and a FLD. Chromatographic separation was performed on a Varian Pursuit Diphenyl 5 ⁇ 4.6 x 150 mm column, protected by a Metaguard Pursuit XR 10 ⁇ C I 8 guard column, as well as, a SunFire 5 ⁇ 4.6 x 20 mm C I 8 guard column. For the first 20 minuets of the analysis a gradient from 100% buffer A to 100% buffer B was employed. After 55 minutes, the mobile phase was changed from 100% buffer B to 100% buffer A over 1 minute. Buffer A was then kept at 100% for 10 minutes in preparation for the next injection.
  • Mobile phase A consisted of a 10 mM sodium acetate buffer, pH 4 using glacial acetic acid.
  • Mobile phase B is the same as buffer A but with 12% methanol.
  • 5-HT as well as other indoles, were detected using the FLD set at an excitation of 225 and emission of 342. Tryptophan and Kynurenine are detected with the UV set at the wavelengths of, respectively, 278 and 360.
  • the calibration curves are linear through the range of 10-200 pg/mL.
  • Method validation was performed according to internationally accepted criteria. Blood was collected from healthy controls and IBS subjects.
  • Example 6 Effect of inflammatory cytokine treatment on 5-HT metabolism and mast cell activation in human blood cells.
  • Irritable bowel syndrome is a multi-factorial functional GI disorder. Inflammatory stimulation in local gut mucosa has been implicated as a trigger for IBS disease onset.
  • the present example provides a study of the interactions of those pathways in inflammatory cytokine treated blood samples from healthy volunteers. Changes in 5-HT metabolism and plasma level of mast cell and stress markers were measured. It was found that inflammatory stimulation alter tryptophan and 5-HT
  • Irritable bowel syndrome is a heterogenous disorder.
  • Gastrointestinal infection may serve as a triggering factor for onset of symptoms.
  • IBS is often described as a "brain-get disorder”. Alterations in gastrointestinal motility and secretion may underlie irregularities in bowel habits that may be mediated by dysregulation of serotonin signaling system.
  • Activated mast cells in proximity to colonic nerves correlated with abnormal pain in patients with IBS.
  • Mast cells are well known for capable of releasing and producing a variety of inflammatory mediators upon activation. It remains unclear how those pathways communicate with each other and whether the interactions behave the same in IBS patients as in healthy subjects.
  • Blood samples were collected and treated as follows. Fresh human blood samples from healthy volunteers were collected into heparin tubes. The samples were aliquoted into seven 15 ml colloquial tubes and treated with inflammatory cytokines, TNF-a, IL- ⁇ ⁇ , TIMP1 , NGAL, 2-Plex (BDNF and TWEAK), 5-Plex (Gro-a, ASCA, ANCA, tTG, CBirl ) for 2 day at 37°C in cell culture incubator. In order to measure the levels of metabolites in the samples, chemicals from 300 ⁇ of treated plasma samples were extracted by isoproponol and acitonitrile. Metabolites were separated by HPLC using a diphenol column (Aligant system).

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biotechnology (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • General Health & Medical Sciences (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Food Science & Technology (AREA)
  • Cell Biology (AREA)
  • Wood Science & Technology (AREA)
  • Biophysics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2010/054810 2009-10-30 2010-10-29 Methods for diagnosing irritable bowel syndrome Ceased WO2011053831A1 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
AU2010313292A AU2010313292A1 (en) 2009-10-30 2010-10-29 Methods for diagnosing irritable bowel syndrome
PH1/2012/500850A PH12012500850A1 (en) 2009-10-30 2010-10-29 Methods for diagnosing irritable bowel syndrome
EP10827556.1A EP2494074A4 (en) 2009-10-30 2010-10-29 METHOD FOR DIAGNOSING IRRITATION SYNDROME
JP2012537132A JP2013509593A (ja) 2009-10-30 2010-10-29 過敏性腸症候群の診断方法
MX2012005015A MX2012005015A (es) 2009-10-30 2010-10-29 Metodos para diagnosticar sindrome de intestino irritable.
RU2012122180/15A RU2012122180A (ru) 2009-10-30 2010-10-29 Способы диагностики синдрома раздраженного кишечника
CN2010800605536A CN102712956A (zh) 2009-10-30 2010-10-29 肠易激综合征的诊断方法
CA2778539A CA2778539A1 (en) 2009-10-30 2010-10-29 Methods for diagnosing irritable bowel syndrome
BR112012010108A BR112012010108A2 (pt) 2009-10-30 2010-10-29 métodos para auxiliar no diagnóstico e para monitorar a progressão ou regressão da síndrome do intestino irritável, meio legível por computador, e, sistema para classificar se uma amostra de soro ou sangue de um indivíduo está associada com a síndrome do intestino irritável
US13/441,658 US20120315630A1 (en) 2009-10-30 2012-04-06 Methods for diagnosing irritable bowel syndrome
IL219317A IL219317A0 (en) 2009-10-30 2012-04-19 Methods for diagnosing irritable bowel syndrome
ZA2012/03718A ZA201203718B (en) 2009-10-30 2012-05-22 Methods for diagnosing irritable bowel syndrome

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US25671709P 2009-10-30 2009-10-30
US61/256,717 2009-10-30
US26458809P 2009-11-25 2009-11-25
US61/264,588 2009-11-25
US32617610P 2010-04-20 2010-04-20
US61/326,176 2010-04-20

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US13/441,658 Continuation US20120315630A1 (en) 2009-10-30 2012-04-06 Methods for diagnosing irritable bowel syndrome

Publications (1)

Publication Number Publication Date
WO2011053831A1 true WO2011053831A1 (en) 2011-05-05

Family

ID=43922588

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2010/054810 Ceased WO2011053831A1 (en) 2009-10-30 2010-10-29 Methods for diagnosing irritable bowel syndrome

Country Status (14)

Country Link
US (1) US20120315630A1 (enExample)
EP (1) EP2494074A4 (enExample)
JP (1) JP2013509593A (enExample)
KR (1) KR20120101038A (enExample)
CN (1) CN102712956A (enExample)
AU (1) AU2010313292A1 (enExample)
BR (1) BR112012010108A2 (enExample)
CA (1) CA2778539A1 (enExample)
IL (1) IL219317A0 (enExample)
MX (1) MX2012005015A (enExample)
PH (1) PH12012500850A1 (enExample)
RU (1) RU2012122180A (enExample)
WO (1) WO2011053831A1 (enExample)
ZA (1) ZA201203718B (enExample)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012158831A1 (en) 2011-05-16 2012-11-22 Prometheus Laboratories Inc. Performance of a biomarker panel for irritable bowel syndrome
WO2013176763A1 (en) * 2012-05-19 2013-11-28 Salix Pharmaceuticals, Ltd Compositions and methods for treatment of irritable bowel syndrome with 5-aminosalicylate
JP2015533213A (ja) * 2012-10-05 2015-11-19 ネステク ソシエテ アノニム Ibsの診断マーカーとしての微生物バイオームに対する抗体、ストレス因子及びマスト細胞マーカー
JP2016520199A (ja) * 2013-05-24 2016-07-11 ネステク ソシエテ アノニム 過敏性腸症候群を診断するための経路特異的マーカー
US11340237B2 (en) 2016-09-16 2022-05-24 Takeda Pharmaceutical Company Limited Metabolite biomarkers for diseases associated with the contact activation system
US11488699B1 (en) 2018-12-09 2022-11-01 Cerner Innovation, Inc. Microbiota activity sensor and decision support tool
US11842795B1 (en) * 2018-12-17 2023-12-12 Cerner Innovation, Inc. Irritable bowel syndrome diagnostic sensor and decision support tool

Families Citing this family (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP5857503B2 (ja) * 2010-07-29 2016-02-10 小野薬品工業株式会社 ストレス性疾患のバイオマーカー
WO2014082034A1 (en) * 2012-11-26 2014-05-30 Lexicon Pharmaceuticals, Inc. Methods for treating irritable bowel syndrome
CN103175971B (zh) * 2013-02-28 2016-10-05 苏州和锐医药科技有限公司 一种IgA抗体检测试剂盒
EP3800470A1 (en) * 2013-03-15 2021-04-07 Sera Prognostics, Inc. Biomarkers and methods for predicting preterm birth
GB201305708D0 (en) * 2013-03-28 2013-05-15 Clasado Inc Novel use
CA2930330A1 (en) * 2013-12-27 2015-07-02 Dignity Health Diagnosing and treating alzheimer's disease
JP6713723B2 (ja) * 2014-02-18 2020-06-24 小野薬品工業株式会社 過敏性腸症候群の診断用バイオマーカー
US10392665B2 (en) 2015-06-19 2019-08-27 Sera Prognostics, Inc. Biomarker pairs for predicting preterm birth
CN106446599A (zh) * 2015-08-11 2017-02-22 中国科学院青岛生物能源与过程研究所 一种筛选婴幼儿龋病的口腔致病性生物标记物的方法
CN105687225B (zh) * 2016-02-26 2018-07-06 四川好医生攀西药业有限责任公司 一种治疗肠易激综合征的药物组合物及其制备方法和应用
GB201605110D0 (en) * 2016-03-24 2016-05-11 Mologic Ltd Detecting sepsis
US10817778B2 (en) 2016-06-27 2020-10-27 International Business Machines Corporation Customized cooking utilizing deep learning neuromorphic computing of hyperspectral input
RU2668496C2 (ru) * 2017-03-16 2018-10-01 Государственное бюджетное учреждение здравоохранения города Москвы Московский клинический научно-практический центр Департамента здравоохранения города Москвы Способ диагностики тяжести течения синдрома раздраженного кишечника
CN106990057A (zh) * 2017-05-05 2017-07-28 贵州普洛迈德生物工程有限公司 一种检测5‑羟吲哚乙酸试剂及制备方法
US11662351B2 (en) 2017-08-18 2023-05-30 Sera Prognostics, Inc. Pregnancy clock proteins for predicting due date and time to birth
KR102330639B1 (ko) * 2019-01-18 2021-11-24 주식회사 천랩 과민성대장증후군 특이적 미생물 바이오마커와 이를 이용하여 과민성대장증후군의 위험도를 예측하는 방법
US20220146527A1 (en) * 2019-09-17 2022-05-12 Chang Gung University Method of creating characteristic profiles of mass spectra and identification model for analyzing and identifying features of microorganisms
US20240124524A1 (en) * 2019-10-17 2024-04-18 University Of Copenhagen Agonist of Tacr2
CN112921100A (zh) * 2019-12-06 2021-06-08 宁波海尔施基因科技有限公司 一种检测人类压力敏感度基因型的试剂盒和方法
EP3913371A1 (en) * 2020-05-18 2021-11-24 Neuroimmun GmbH Method and kit for diagnosting irritable bowel syndrome and for its relief through dietary interventions
CN111784683B (zh) * 2020-07-10 2022-05-17 天津大学 病理切片检测方法及装置、计算机设备及存储介质
CN111905111B (zh) * 2020-09-16 2023-03-31 地奥集团成都药业股份有限公司 一种评价复方谷氨酰胺组方对腹泻型肠易激综合征疗效的方法
US20220208375A1 (en) * 2020-12-29 2022-06-30 Kpn Innovations, Llc. System and method for generating a digestive disease functional program
CN115328117B (zh) * 2022-07-15 2023-07-14 大理大学 基于强化学习的蛋白质动态配体通道最优路径分析方法

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6303617B1 (en) * 1998-05-04 2001-10-16 Neotherapeutics, Inc. Serotonin-like 9-substituted hypoxanthine and methods of use
WO2002020841A2 (en) * 2000-09-06 2002-03-14 Glaxo Group Limited 5-hydroxytryptamine receptor gene polymorphisms and response to treatment
US20080085524A1 (en) * 2006-08-15 2008-04-10 Prometheus Laboratories Inc. Methods for diagnosing irritable bowel syndrome

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2778685B1 (en) * 2009-06-25 2017-04-26 Nestec S.A. Methods for diagnosing irritable bowel syndrome

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6303617B1 (en) * 1998-05-04 2001-10-16 Neotherapeutics, Inc. Serotonin-like 9-substituted hypoxanthine and methods of use
WO2002020841A2 (en) * 2000-09-06 2002-03-14 Glaxo Group Limited 5-hydroxytryptamine receptor gene polymorphisms and response to treatment
US20080085524A1 (en) * 2006-08-15 2008-04-10 Prometheus Laboratories Inc. Methods for diagnosing irritable bowel syndrome

Non-Patent Citations (13)

* Cited by examiner, † Cited by third party
Title
BEARCROFT ET AL.: "Postprandial plasma 5-hydroxytryptamine in diarrhoea predominant irritable bowel syndrome: a pilot study", GUT, vol. 42, 1998, pages 42 - 46 *
DUNLOP ET AL.: "Abnormalities of 5-hydroxytryptamine metabolism in irritable bowel syndrome", CLINICAL GASTROENTEROLOGY AND HEPATOLOGY, vol. 3, no. IS.4, April 2005 (2005-04-01), pages 349 - 357 *
GERSHON ET AL.: "RADIOISOTOPIC STUDIES OF THE BINDING, EXCHANGE, AND DISTRIBUTION OF 5-HYDROXYTRYPTAMINE SYNTHESIZED FROM ITS RADIOACTIVE PRECURSOR.", J. PHYSIOL., vol. 186, 1966, pages 451 - 476 *
KAPELLER ET AL.: "First evidence for an association of a functional variant in the microRNA-510 target site of the serotonin receptor-type 3E gene with diarrhea predominant irritable bowel syndrome.", HUMAN MOLECULAR GENETICS, vol. 17, no. 19, 2008, pages 2967 - 2977 *
KAROLYI ET AL.: "Altered anxiety and weight gain in corticotropin-releasing hormone-binding protein -deficient mice.", PROC. NATL. ACAD. SCI. USA, vol. 96, September 1999 (1999-09-01), pages 11595 - 11600 *
KILKENS ET AL.: "Acute tryptophan depletion affects brain-gut responses in irritable bowel syndrome patients and controls.", GUT, vol. 53, 2004, pages 1794 - 1800 *
KISHIMOTO ET AL.: "Synthesis and Properties of Serotonin O-Sulfate.", THE JOURNAL OF BIOCHEMISTRY, vol. 49, no. 5, 1961 *
LAUFFER ET AL.: "Biological relevance of pituitary adenylate cyclase-activating polypeptide (PACAP) in the gastrointestinal tract.", REGULATORY PEPTIDES, vol. 84, no. IS.1-3, 22 October 1999 (1999-10-22) *
PERDUE ET AL.: "Stress Impairs Murine Intestinal Barrier Function: Improvement by Glucagon-Like Peptide-2.", JPET, vol. 314, 2005, pages 214 - 220 *
POSSERUD ET AL.: "Altered visceral perceptual and neuroendocrine response in patients with irritable bowel syndrome during mental stress.", GUT, vol. 53, 2004, pages 1102 - 1108 *
See also references of EP2494074A4 *
SIMREN ET AL.: "An exaggerated sensory component of the gastrocolonic response in patients with irritable bowel syndrome", GUT, vol. 48, 2001, pages 20 - 27 *
TACHE ET AL.: "CRF1 receptor signaling pathways are involved in stress-related alterations of colonic function and viscerosensitivity: implications for irritable bowel syndrome.", BRITISH JOURNAL OF PHARMACOLOGY, vol. 141, 2004, pages 1321 - 1330 *

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012158831A1 (en) 2011-05-16 2012-11-22 Prometheus Laboratories Inc. Performance of a biomarker panel for irritable bowel syndrome
WO2013176763A1 (en) * 2012-05-19 2013-11-28 Salix Pharmaceuticals, Ltd Compositions and methods for treatment of irritable bowel syndrome with 5-aminosalicylate
AU2013266857B2 (en) * 2012-05-19 2016-02-11 Dr. Falk Pharma Gmbh Compositions and methods for treatment of irritable bowel syndrome with 5-aminosalicylate
JP2015533213A (ja) * 2012-10-05 2015-11-19 ネステク ソシエテ アノニム Ibsの診断マーカーとしての微生物バイオームに対する抗体、ストレス因子及びマスト細胞マーカー
US10184940B2 (en) 2012-10-05 2019-01-22 Nestec S.A. Antibodies to microbiome, stress factors and mast cell markers as diagnostic markers for IBS
JP2016520199A (ja) * 2013-05-24 2016-07-11 ネステク ソシエテ アノニム 過敏性腸症候群を診断するための経路特異的マーカー
JP2019194600A (ja) * 2013-05-24 2019-11-07 ソシエテ・デ・プロデュイ・ネスレ・エス・アー 過敏性腸症候群を診断するための経路特異的マーカー
US11340237B2 (en) 2016-09-16 2022-05-24 Takeda Pharmaceutical Company Limited Metabolite biomarkers for diseases associated with the contact activation system
US12188948B2 (en) 2016-09-16 2025-01-07 Takeda Pharmaceutical Company Limited Metabolite biomarkers for diseases associated with the contact activation system
US11488699B1 (en) 2018-12-09 2022-11-01 Cerner Innovation, Inc. Microbiota activity sensor and decision support tool
US11842795B1 (en) * 2018-12-17 2023-12-12 Cerner Innovation, Inc. Irritable bowel syndrome diagnostic sensor and decision support tool

Also Published As

Publication number Publication date
US20120315630A1 (en) 2012-12-13
ZA201203718B (en) 2014-11-26
RU2012122180A (ru) 2013-12-10
MX2012005015A (es) 2012-06-12
IL219317A0 (en) 2012-06-28
PH12012500850A1 (en) 2013-01-07
CN102712956A (zh) 2012-10-03
JP2013509593A (ja) 2013-03-14
CA2778539A1 (en) 2011-05-05
AU2010313292A1 (en) 2012-06-07
EP2494074A4 (en) 2013-06-12
KR20120101038A (ko) 2012-09-12
BR112012010108A2 (pt) 2016-05-31
EP2494074A1 (en) 2012-09-05

Similar Documents

Publication Publication Date Title
US20120315630A1 (en) Methods for diagnosing irritable bowel syndrome
AU2017213566B2 (en) Methods for diagnosing irritable bowel syndrome
US8463553B2 (en) Methods for diagnosing irritable bowel syndrome
EP2710383B1 (en) Performance of a biomarker panel for irritable bowel syndrome

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201080060553.6

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 10827556

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 219317

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2778539

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2012537132

Country of ref document: JP

Ref document number: MX/A/2012/005015

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 12012500850

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 1095/KOLNP/2012

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 2010827556

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2010313292

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 20127013948

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2012122180

Country of ref document: RU

ENP Entry into the national phase

Ref document number: 2010313292

Country of ref document: AU

Date of ref document: 20101029

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112012010108

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 1201001901

Country of ref document: TH

ENP Entry into the national phase

Ref document number: 112012010108

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20120427