WO2011032990A1 - Preparation of beta-amino acids - Google Patents
Preparation of beta-amino acids Download PDFInfo
- Publication number
- WO2011032990A1 WO2011032990A1 PCT/EP2010/063558 EP2010063558W WO2011032990A1 WO 2011032990 A1 WO2011032990 A1 WO 2011032990A1 EP 2010063558 W EP2010063558 W EP 2010063558W WO 2011032990 A1 WO2011032990 A1 WO 2011032990A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- hydantoinase
- group
- amino acid
- optionally substituted
- reaction
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 *C(C(*)N)C(O)=O Chemical compound *C(C(*)N)C(O)=O 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
- C12N9/86—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5) acting on amide bonds in cyclic amides, e.g. penicillinase (3.5.2)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/02—Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
- C12N9/80—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5) acting on amide bonds in linear amides (3.5.1)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P13/00—Preparation of nitrogen-containing organic compounds
- C12P13/001—Amines; Imines
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P13/00—Preparation of nitrogen-containing organic compounds
- C12P13/005—Amino acids other than alpha- or beta amino acids, e.g. gamma amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P13/00—Preparation of nitrogen-containing organic compounds
- C12P13/02—Amides, e.g. chloramphenicol or polyamides; Imides or polyimides; Urethanes, i.e. compounds comprising N-C=O structural element or polyurethanes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P13/00—Preparation of nitrogen-containing organic compounds
- C12P13/04—Alpha- or beta- amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y305/00—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
- C12Y305/01—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in linear amides (3.5.1)
- C12Y305/01087—N-Carbamoyl-L-amino-acid hydrolase (3.5.1.87)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y305/00—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
- C12Y305/02—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amides (3.5.2)
- C12Y305/02002—Dihydropyrimidinase (3.5.2.2), i.e. hydantoinase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y305/00—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
- C12Y305/02—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amides (3.5.2)
- C12Y305/02014—N-Methylhydantoinase (ATP-hydrolyzing) (3.5.2.14)
Definitions
- the present invention relates to a process for the biocatalytic production of a ⁇ - amino acid precursor from an optionally substituted dihydrouracil using a hydantoinase and/or a dihydropyrimidinase, a process for producing a ⁇ -amino acid from said precursor, a hydantoinase and its use in said process for the biocatalytic production of a ⁇ -amino acid precursor or a ⁇ -amino acid, and a method for obtaining said hydantoinase.
- Enantiomerically pure ⁇ -amino acids are valuable building blocks for novel therapeutics agents that possess a wide range of biological activity. Although a number of biocatalytic routes have been developed for their preparation, no single method has emerged as being universally applicable. Similarly, few chemo-catalytic routes to ⁇ - amino acids have been developed, most requiring stoichiometric quantities of chiral auxiliaries.
- Dihydropyrimidinases and hydantoinase are possible candidates for the biocatalytic synthesis of amino acids or their precursors. Gaebler and Keltch first reported hydantoinase cleaving activities in 1920s (Gaebler, O. H.; Keltch, A. K. On the metabolism of hydantoins and hydantoic acid, 1926; Vol. 70). It was initially suggested by Eadie et al. in the 1950s that microbial hydantoinases were identical to animal dihydropyrimidinase (Eadie, G.; Bernheim, F.; Bernheim, M. Journal of Biological Chemistry 181 : 449-458, 1949).
- Dihydropyrimidinase enzymes isolated from calf liver and plants, catalysed the hydrolysis of dihydrouracil and dihydrothymine into the N- carbamoyl ⁇ -alanine and /V-carbamoyl-2-methyl ⁇ -alanine, respectively. These enzymes also cleaved (R)-5-monosubsitituted hydantoin into (/ ⁇ -/V-carbamoyl-amino acid.
- hydantoinases are not necessarily the same enzyme (Syldatk, C; May, O.;
- Amidohydrolases also referred to as cyclic amidases [E.C.3.5.2] are a group of more than 14 enzymes all acting on cyclic amide rings and containing a number of highly conserved regions and invariant amino acid regions (Kim, G. J.; Cheon, Y. H.; Kim, H. S. Biotechnology and Bioengineering 1998, 61, 1 -13). Comprised in this group are
- cyclic amidases include dihydroorotase [E.C.3.5.2.3] and dihydropyrimidinase [E.C.3.5.2.2], the latter of which is commonly referred to as D-hydantoinase, due to its ability to hydrolyse ⁇ R)-5- monosubstituted hydantoin derivatives.
- This superfamily of proteins most likely evolved in prehistoric earth, when /V-carbamoyl-amino acids are hypothesised to have been the original synthons of prebiotic peptides.
- hydantoinases for the enantioselective hydrolysis of racemic mixtures of 5-substituted hydantoins (R)-1 and (S)-1 to their corresponding /V-carbamoyl derivatives (R)-2 and (S)-2 is well established (cf. Scheme 1 below) and described in literature (Morin, Enzyme Microb. Technol. 15:208-214, 1993; Fan and Lee,
- the object of the present invention was solved by a process for the biocatalytic, stereospecific, in particular enantioselective, production of a ⁇ -amino acid precursor, comprising reacting at least one substrate of the general formula (I)
- R 1 and R 2 independently from each other are selected from
- an aldehyde group in stereoisomerically pure form, as for example (R)- or (S)-isomer, or as a mixture of stereoisomers, as for example as racemic mixture,
- a salt of said compound as for example an acid addition salt in the presence of at least one enzyme, catalyzing the hydrolytic cleavage of a hydantoin and/or dihydropyrimidin ring, in particular, selected among a hydantoinase and a dihydropyrimidinase, more particular being an hydantoinase, in particular an enzyme having preference for a particular stereoisomer of the compound to be converted; and optionally in the presence of at least one enzyme having the ability to interconvert the stereoisomers of said compound of formula (1 ), so that a ⁇ -amino acid precursor of the general formula (II)
- R 1 and R 2 are identified as above, is produced; said process being characterized in that the at least one enzyme catalyzing the hydrolytic cleavage of a hydantoin and/or dihydropyrimidin ring, in particular a hydantoinase and/or dihydropyrimidinase, is obtained from Vigna angularis and/or comprises at least one partial sequence having an identity of about 60 to 100 % to at least one of the following partial sequences: ITGPEGQRLAGP (SEQ ID N0:7)
- IELGITGPEGQRLAGPTVL (SEQ ID N0:1 )
- EEIARARKSGQRVIGEPVAS (SEQ ID N0:5), as for example comprises at least one partial sequence having an identity of between 60 % and 100 % to at least one of the partial sequences SEQ ID NO: 5 and 7.
- the process furthermore comprises an additional step by converting said ⁇ -amino acid precursor of formula (2) to the corresponding ⁇ - amino acid of the formula (III)
- R 1 and R 2 have the same meaning as previously defined.
- the conversion of the ⁇ -amino acid precursor takes place at an acidic pH, preferentially in the presence of nitrous acid, or in the presence of a carbamoylase.
- the at least one hydantoinase and/or dihydropyrimidinase is an enzyme obtainable from an organism of the genus Agrobacterium, Arthrobacter, Pseudomonas and Vigna, in particular Vigna angularis.
- R 2 is H and R 1 different from H in the general formulae (I) to (III).
- R 2 is H and R 1 is an optionally substituted aryl group in the general formulae (I) to (III).
- the compounds of formulae (II) and (III) and also of formula (I), wherein merely R 2 is H, and R 1 is different from H preferably are present as (S)-isomer in stereoisomerically pure form or in stereoisomeric excess (in particular having an ee- value of more than 93%, preferentially in the range of 95-99%, or more than 99%).
- the reaction is performed in a Tris-buffered or a borate-buffered reaction mixture, preferentially a Tris-buffered reaction mixture.
- the reaction is performed at a pH from about 7.0 to about 1 1 .0, preferentially at a pH from about 7.5 to about 10.0, and especially preferred at a pH from about 7.5 to about 8.0.
- the reaction is performed in the presence of approximately 1 % to approximately 20% dimethylsulfoxide, preferentially in the presence of approximately 10 % dimethylsulfoxide.
- the reaction is performed at a temperature in the range of about 30°C to about 60°C, preferentially from about 30°C to about 50°C, and in particular from about 40°C to about 50°C.
- the reaction is performed from about 1 hour to about 25 hours, preferentially from about 3 hours to about 10 hours, an in particular about 4 hours to about 5 hours.
- the at least one substrate is selected among a dihydrouracil, which is monosubstituted at the 5-position or at the 6-position, in particular 6-phenyldihydrouracil, 6-(4-fluoro-phenyl)-dihydrouracil, 6-(4-chloro-phenyl)- dihydrouracil, 5-methyldihydrouracil and 6-methyldihydrouracil.
- a dihydrouracil which is monosubstituted at the 5-position or at the 6-position
- 6-phenyldihydrouracil 6-(4-fluoro-phenyl)-dihydrouracil
- 6-(4-chloro-phenyl)- dihydrouracil 6-methyldihydrouracil and 6-methyldihydrouracil.
- a further aspect of the present invention relates to the use of a ⁇ -amino acid precursor or a ⁇ -amino acid as obtainable by a process according to the invention for manufacturing hydrolytically stable peptides, pharmaceutically active agents, in particular antibiotic, anticancer, antithrombotic, antifungal insecticidal, anthelminthic, nonpeptide integrin antagonist, alkaloids and/or cytotoxic agents.
- pharmaceutically active agents in particular antibiotic, anticancer, antithrombotic, antifungal insecticidal, anthelminthic, nonpeptide integrin antagonist, alkaloids and/or cytotoxic agents.
- a further aspect of the present invention relates to the use of a hydantoinase and/or a dihydropyrimidinase comprising at least one partial sequence having an identity of between 60 percent and 100 percent to at least one of the following partial sequences:
- EEIARARKSGQRVIGEPVAS as for example at least one of the partial sequences: SEQ ID NO: 5 and 7, for a process according to the invention.
- a further aspect of the present invention relates to a substantially pure hydantoinase, containing at least one of the following partial sequences comprising at least one partial sequence having an identity of between 60 percent and 100 percent, for example 100 percent to at least one of the following partial sequences:
- EEIARARKSGQRVIGEPVAS as for example at least one of the partial sequences: SEQ ID NO: 5 and 7.
- a further aspect of the present invention relates to a substantially pure hydantoinase, obtained by preparing a crude extract of cell material from an organism naturally or recombinantly expressing said enzyme activity, and subjecting said crude extract to the sequential purification steps of
- hydantoinase which comprise at least one of SEQ ID NO:1 to 5 and 7 and/or are isolated according to the aforementioned method.
- the hydantoinase is obtained from an organism of the genus Agrobacterium, Arthrobacter, Pseudomonas and Vigna, in particular Vigna angularis.
- a further aspect relates to a hydantoinase, which comprises at least one of SEQ ID NO:1 to 5 and 7, is obtained from Vigna angularis, in particular by a method substantially comprising the above purification steps in any order is isolated according to the aforementioned method, and shows after SDS PAGE, in particular under reducing conditions, a protein band at 55 ⁇ 10, 55 ⁇ 5 or 55 ⁇ 2 or about 55 kD.
- a fu rther aspect fo the i nvention relates to the use of an aformentioned hydantoinase for process for the biocatalytic production of a ⁇ -amino acid precursor or a ⁇ -amino acid according to the invention.
- the aforementioned hydantoinase may in particular be a hydantoinase from an organism of the genus Agrobacterium, Arthrobacter, Pseudomonas and Vigna, in particular Vigna angularis.
- a further aspect of the present invention relates to the use of any of the aforementioned hydantoinases for a method according to the invention.
- Fig. 1 shows an SDS PAGE gel of hydantoinase purified from Vigna angularis.
- Fig. 2 shows two exemplary ways for synthesizing racemic 6-substituted dihydrouracils.
- Fig. 3 shows the separation of N-carbamoyl-3-phenylalanine (NCBPA), 6- phenyldihydrouracil (6-PDHU) and enzyme by anion exchange chromatography (DEAE column).
- NCBPA N-carbamoyl-3-phenylalanine
- 6-PDHU 6- phenyldihydrouracil
- DEAE column enzyme by anion exchange chromatography
- Fig. 4. shows the results of a reverse phase chiral HPLC after hydantoinase catalysed hydrolysis of 6-PDHU.
- Fig. 5 shows the conversion rates over time of 6-PDHU into N-carbamoyl derivative (NCBPA) and the respective enantiomeric excess rates.
- Fig. 6 shows the cyclisation of N-carbamoyl-3-phenylalanine in the absence or presence of hydantoinase.
- Fig. 7 shows the pH dependency of chemical hydrolysis of 6-DPHU in Tris buffer devoid of hydantoinase.
- Fig. 8 shows the pH dependency of hydantoinase mediated enzymatic conversion of 6-DPHU.
- Fig. 9 shows the conversion rates of hydantoinase in different pH value/buffer combinations over time.
- Fig. 10 shows the reaction catalyzed by D-hydantoinase from Vigna angularis (Sigma).
- Fig. 1 1 shows the influence of organic co-solvents on hydantoinase-catalyzed conversion of 6-PDHU.
- Fig. 12 shows the influence of different hydantoinase concentrations on product formation and enantiomeric excess.
- Fig. 13 shows the production of NCBPA in 25 mL reactions.
- Fig. 14 shows the enantiomeric excess of S-NCBPA in 25 mL reactions.
- an enzyme catalyzing the hydrolytic cleavage of a hydantoin and/or dihydropyrimidin ring like a substituted hydantoin and/or substituted dihydropyrimidin ring, as for example 5-phenylhydantoin and 6-phenyldihydrouracil, has to show the ability to catalyze the hydrolytic cleavage of at least one compound of formula (I) to form a compound of formula (II).
- such an enzyme may also be referred to as hydantoinase and/or dihydroyrimidinase, wherein an enzyme, whose natural substrate is a hydantoin ring, preferably would be referred to as a
- hydantoinase and an enzyme, whose natural substrate is a dihydrouracil ring, preferably would be referred to as a dihydropyrimidinase.
- dihydropyrimidinases are characterized as enzymes which are capable of hydrolyzing dihydropyrimidines and, additionally, of hydrolyzing hydantoin (as shown in formula IV) and of resolving ( ⁇ )-5-monosubstituted hydantoins as shown in Scheme 3.
- hydantoins Suitable assays for hydrolysing hydantoin or dihydropyrimidine, and consequently for further defining enzymes applicable in the process of the invention, are for example described in Example 1.
- a substantially pure protein or enzyme means that the desired purified protein is essentially free (for example more than 90, 92, 93, 94, 95, 96, 97, 98, 99, or 99,9% (of dry weight) constitute said protein) from contaminating cellular components, as evidenced by a single band following polyacrylamide-sodium dodecyl sulfate gel electrophoresis (SDS-PAGE).
- SDS-PAGE polyacrylamide-sodium dodecyl sulfate gel electrophoresis
- substantially pure is further meant to describe a molecule, which is homogeneous by one or more purity or homogeneity characteristics used by those of skill in the art. For example, a substantially pure protein will show constant and reproducible characteristics within standard
- the residues R 1 and/or R 2 of a substrate according to the general formula (1 ) can be selected among linear or branched lower alkyl groups, which optionally may be substituted at one or more positions.
- the residues R 1 and R 2 can in particular be groups comprising straight chain or branched alkyl groups containing 1 to 10 carbon atoms, in particular 2 to 6 carbon atoms, such as an methyl group, an ethyl group, an i- or n-propyl group, a sec- or tert-butyl group, an n-pentyl group, a 2-methyl-butyl group, an n-hexyl group, a heptyl group, an octyl group, an nonyl group, a decyl group.
- Examples for branched alkyl groups include isopropyl, isobutyl, isopentyl, 2,2- dimethylpropyl, isohexyl, 3-methylpentyl, 2,2-dimethylbutyl, 2,3-dimethylbutyl, isoheptyl, 2-ethylbutyl, 3-methylhexyl, 2,2-dimethylpentyl, 2,3-dimethylpentyl, 2,4- dimethylpentyl, 2,2,3-trimethylbutyl, isooctyl, 3-methylheptyl, 4-methylheptyl, 2,2- dimethylhexyl, 2,4-dimethylhexyl, 2,5-dimethylhexyl, 2,2,3-trimethylpentyl, 2,2,4- trimethylpentyl, 2,2,5-trimethylpentyl and isononyl groups.
- the residues R 1 and/or R 2 of a the substrate according to the general formula (1 ) can furthermore be selected among linear or branched lower alkenyl groups, which can be substituted at one or more positions.
- Examples comprise unsaturated analogues of lower alkyl groups, comprising one or more carbon-carbon double bonds at any possible position of the carbon chain.
- Examples are vinyl groups, allyl groups (2- propenyl), but-1 -enyl groups, cis-but-2-enyl groups, trans-but-2-enyl groups, pent-1 - enyl groups, cis-pent-2-enyl groups, trans-pent-2-enyl groups, 2-methyl-but-1 -enyl groups, 2-methyl-but-2-enyl groups, 3-methyl-but-1 -enyl groups, hex-1 -enyl groups, hex-2-enyl groups both as cis- or trans-isomeres, hex-3-enyl groups, 2-methyl-pent-1 - enyl groups, 2-methyl-pent-2-enyl groups, 3-methyl-pent-2-enyl groups, 4-methyl-pent- 1 -enyl groups, 4-methyl-pent-2-enyl groups, 2-ethyl-but-1 -enyl groups, 2,3-dimethyl- but-1 -enyl
- the residues R 1 and/or R 2 of a the substrate according to the general formula (1 ) can furthermore be selected among cyclic alkyl groups comprising compounds with a cyclic carbon backbone, in particular compounds with a cyclic carbon backbone of 3 to 10 carbon atoms, i.e. cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, cyclononyl.
- mono- or polyunsaturated analogues of cyclic alkyl groups such as cyclo-butenyl groups, cyclopentenyl groups,
- cyclopentadienyl groups cyclohexenyl groups, cycloheptenyl groups, cyclohexadienyl groups, and cycloheptadienyl groups.
- the cyclic alkyl groups or their mono- or polyunsaturated analogues may be substituted at one or more positions.
- the residues R 1 and R 2 of a the substrate according to the general formula (1 ) can furthermore be selected among mono- or polycyclic aryl groups, which may be substituted at one or more positions.
- aryl groups are mono- or polycyclic (in particular dicyclic) aromatic groups, in particular phenyl groups or naphthyl groups bonded via any carbon atom of the ring, for example 1 -naphthyl and 2-naphthyl.
- the residues R 1 and/or R 2 of a the substrate according to the general formula (1 ) can furthermore be selected among mono- or polycyclic heteroaryl groups, which may be substituted at one or more positions.
- heteroaryl groups may be derived form pyrrolidine, tetrahydrofuran, tetrahydrothiophene, piperidine, tetrahydropyrane, tetrahydrothiopyrane, pyrinide, morpholine, pyrrole, furane, thiophene, pyrazole, imidazole, oxazole, thioazole, pyran, pyrimidine, pyridazine and pyrazine.
- dicyclic groups examples are condensates of the aforementioned aryl groups or heteroaryl groups, or their respective derivatives, with an additional aryl group, a heteroaryl group or their respective derivatives, such as groups derived from cumarole, indole, chinoline, purine and naphthalene.
- the mono- or polycyclic heteroaryl groups may be substituted at one or more positions, and may be linked to the respective carbon atom in the general formula (1 ) via any atom of the ring, preferentially via a carbon atom of the ring.
- suitable groups include 2-thienyl groups, 3-thienyl groups, 2-furanyl groups, 3-furanyl groups, 2-pyridyl groups, 3-pyridyl groups, 4-pyridyl groups, 2- thiazolyl groups, 4-thiazolyl groups, 5-thiazolyl groups, 4-methyl-2-thienyl groups, 3- ethyl-2-thienyl groups, , 2-methyl-3-thienyl groups, 4-propyl-3-thienyl groups, 5n-butyl- 2-thienyl groups, 4-methyl-3-thienyl groups, 3-methyl-2-thienyl groups, 3-chloro-2- thienyl groups, 4-bromo-3-thienyl groups, 2-iodine-3-thienyl groups, 5-iodine-3-thienyl groups, 4-flouro-2-thienyl groups, 2-bromo-3-thienyl groups and 4-chloro-2-thienyl groups.
- the residues R 1 and/or R 2 of the substrate according to the general formula (1 ) can furthermore be selected among linear or branched alkoxy groups, which optionally may be substituted at one or more positions.
- the compound of the general formula (1 ) is linked via an oxygen atom with a group according to any of the aforementioned definitions, e.g. a linear or branched, optionally substituted, lower alkyl group;a linear or branched, optionally substituted, lower alkenyl group;an optionally substituted cyclic alkyl group;a mono- or polycyclic, optionally substituted aryl group (which may also be referred to a aryloxy group); a mono- or polycyclic, or an optionally substituted heteroaryl group.
- alkoxy groups are the methoxy group (-0- CH 3 ), the ethoxy group (-0-C 2 H 5 ) and groups of the general formula -0-C n H 2n+ i , wherein n preferentially is an integer from 1 to 10.
- the residues R 1 and/or R 2 of the substrate according to the general formula (1 ) can furthermore be selected among an amino group and linear or branched alkylamino groups, which optionally may be substituted at one or more positions.
- the compound of the general formula (1 ) is linked via a nitrogen atom, which itself is linked to two hydrogen atoms (primary amine, amino group), one hydrogen and one organic residue (secondary amine, -NHR 1 ), or two organic residues (tertiary amine, -NR 1 R 2 ), wherein the organic residues R 1 and R 2 independently from each other may be selected from any group according to the aforementioned definitions for linear or branched, optionally substituted, lower alkyl groups; linear or branched, optionally substituted, lower alkenyl groups; optionally substituted cyclic alkyl group;a mono- or polycyclic, optionally substituted aryl groups, and mono- or polycyclic, or an optionally substituted heteroaryl group.
- amino groups are the primary amino group (-NH2),.
- secondary amino groups are the methylamino group (-NH-CH3), the ethylamino group (-NH-C2H5) and groups of the general formula -NH-CnH2n+1 , wherein n preferentially is an integer between 1 and 10.
- tertiary amino groups are the dimethylamino group (-N(CH 3 ) 2 ), the diethylamino group (-N(CH 2 CH 3 )2), the dipropylamino group (-N(CH2CH 2 CI-l3)2), the dibutylamino group
- the residues R 1 and/or R 2 of the substrate according to the general formula (1 ) can furthermore be selected among linear or branched alkylthio groups, which optionally may be substituted at one or more positions.
- the compound of the general formula (1 ) is linked via a sulfur atom with a group according to any of the aforementioned definitions, e.g.
- alkylthio groups are the thiomethyl group (-S-CH 3 ), the thioethyl group (-S-C 2 H 5 ) and groups of the general formula -S-C n H 2n +i, wherein n preferentially is an integer from 1 to 10.
- the residues R 1 and/or R 2 of the substrate according to the general formula (1 ) can furthermore be selected among linear or branched acyl groups, which optionally may be substituted at one or more positions.
- Acyl groups have the general formula -C- C(0)-R, wherein R may be any alkyl group, aryl group or heteroaryl group as defined herein. When R is hydrogen or OH, the group -C(0)-R is an aldehyde group or a carboxyl group, respectively.
- the aforementioned groups may optionally be substituted at one or more positions.
- the hydrogen atoms of the carbon atoms may for example independently from each other be substituted by further carbon compounds, such as linear or branched lower alkyl or alkenyl groups, cyclic alkyl groups, aryl or heteroaryl group, halogen, such as fluorine, chlorine, bromine and iodine, or heteroatoms or compounds containing heteroatoms.
- heteroatom containing compounds are -OH, - SH, -NO2, -NO3, -NH2, -SO3, -SO4 groups, alkoxy groups and NR 3 R 4 , wherein R 3 and R 4 independently from each other represent H, a methyl group or an ethyl group.
- R 2 is H.
- R 2 is H
- R 1 is concomitantly selected from H, a methyl group, an optionally substituted aryl group, in particular an optionally substituted monocyclic aryl group.
- Preferred examples are a phenyl group, a mono- or polysubstituted phenyl group, wherein the substitutents independently form each other may be selected from, e.g. a halogen, methyl, ethyl, -OH, -NH 2 , -N0 2 , and -S0 3 H.
- the substituted phenyl group may, e.g., be 2-F-C 6 H 4 , 3-F-C 6 H 4 , 4-F-C 6 H 4 , 2-CI-C 6 H 4 , 3-CI- C 6 H 4 , 4-CI-C 6 H 4 , 2,3-F-C 6 H 3 , 2,4-F-C 6 H 3 , 2,5-F-C 6 H 3 , 2,3-CI-C 6 H 3 , 2,4-CI-C 6 H 3 , 2,5-CI- C 6 H 3 , and the like.
- R 2 is H and R 1 is selected from the group comprising H, -CH 3 , -CH 2 CH2CH2NH-C(NH)NH2 , -CH 2 CONH2, -CH 2 COOH, -CH 2 SH, -CH2CH2CONH2, -CH2CH2COOH, -CH 2 (C 3 H 3 N 2 ), wherein C 3 H 3 N 2 denotes an imidazole group, -CH(CH 3 )CH 2 CH 3 , -CH 2 CH(CH 3 ) 2 , -CH2CH2CH2CH2NH2, - CH 2 CH 2 SCH 3 , -CH 2 (C 6 H 5 ), -CH 2 OH, -CH(OH)CH 3 , -CH 2 (C 8 H 6 N), wherein C 8 H 6 N denotes an indole residue, -CH 2 (C 6 H 4 )OH, -CH(CH 3 ) 2 , -CH 2 -SeH,
- the at least one enzyme selected among a hydantoinase and a
- dihydropyrimidinase which is present during the method for producing a ⁇ -amino acid precursor, can be present in living cells naturally or recombinantly producing the enzyme or enzymes, in harvested cells, in dead cells, in permeabilized cells, in crude cell extracts, in purified extracts, or in essentially pure or completely pure form.
- the at least one enzyme may be present in solution or an enzyme immobilized on a carrier.
- One or several enzymes may simulaneously be present in soluble and immobilised form.
- the method according to the invention can be performed in common reactors, which are known to those skilled in the art, and in different ranges of scale, e.g. from a laboratory scale (few millilitres to dozens of liters of reaction volume) to an industrial scale (several liters to thousands of cubic meters of reaction volume). If the
- hydantoinase and/or dihydropyrimidinase is used in a form encapsulated by non-living, optionally permeabilized cells, in the form of a more or less purified cell extract or in purified form, a chemical reactor can be used.
- the chemical reactor usually allows controlling the amount of the at least one enzyme, the amount of the at least one substrate, the pH, the temperature and the circulation of the reaction medium.
- the process will be a fermentation.
- the biocatalytic production will take place in a bioreactor (fermenter), where parameters necessary for suitable living conditions for the living cells (e.g.
- culture medium with nutrients, temperature, aeration, presence or absence of oxygen or other gases, antibiotics, and the like can be controlled.
- Those skilled in the art are familiar with chemical reactors or bioreactors, e.g. with procedures for upscaling chemical or biotechnological methods from laboratory scale to industrial scale, or for optimizing process parameters, which are also extensively described in the literature (for biotechnological methods see e.g. Crueger und Crueger, Biotechnologie - Lehrbuch der angewandten Mikrobiologie, 2. Ed., R. Oldenbourg Verlag, Mijnchen, Wien, 1984).
- Cells containing the at least one hydantoinase and/or dihydropyrimidinase can be permeabilized by physical or mechanical means, such as ultrasound or
- radiofrequency pulses such as hypotonic media, lytic enzymes and detergents present in the medium, or combination of such methods.
- detergents are digitonin, n-dodecylmaltoside, octylglycoside, Triton® X- 100, Tween ® 20, deoxycholate, CHAPS (3-[(3-Cholamidopropyl)dimethylammonio]-1 - propansulfonate), Nonidet ® P40 (Ethylphenolpoly(ethyleneglycolether), and the like. If the at least one enzym is immobilised, it is attached to an inert carrier.
- Suitable carrier materials are known in the art and are, e.g., disclosed in EP-A-1 149849, EP-A-1 069 183 and DE-OS 100193773 as well as the literature references cited therein (all of which are specifically enclosed with regard to carrier materials).
- suitable carrier materials are clays, clay minerals such as kaolinite, diatomeceous erth, perlite, silica, alumina, sodium carbonate, calcium carbonate, cellulose powder, anion exchanger materials, synthetic polymers, such as polystyrene, acrylic resins, phenol formaldehyde resins, polyurethanes and polyolefines, such as polyethylene and polypropylene.
- the carrier materials usually are used in the form of fine powders, wherein porous forms are preferred.
- the particle size of the carrier material usually does not exceed 5 mm, in particular 2 mm.
- the at least one enzyme is present in a whole-cell-preparation, said whole-cell-preparation may be present in a free or immobilised form.
- Suitable carrier materials are e.g. Ca- alginate or Carrageenan.
- Enzymes as well as cells may directly be linked by glutaraldehyde.
- immobilisation methods is known in the art (e.g. J. Lalonde and A. Margolin ..Immobilization of Enzymes" in K. Drauz und H. Waldmann, Enzyme Catalysis in Organic Synthesis 2002, Vol. Ill, 991 -1032, Wiley-VCH,
- the at least one enzyme to be used in the process for biocatalytic production of a ⁇ -aminoacid precursor is selected among a hydantoinase and a dihydropyrimidinase, preferentially any hydantoinase or any dihydropyrimidinase obtainable from Vigna angularis.
- a hydantoinase and a dihydropyrimidinase preferentially any hydantoinase or any dihydropyrimidinase obtainable from Vigna angularis.
- a hydantoinases one or several dihydropyrimidinases, or any combination thereof may be present.
- at least one hydantoinase is present.
- the at least one enzyme preferentially is an enantioselective enzyme, preferentially a D- dihydropyrimidinase and/or a D-hydantoinase.
- the enzyme is a D- hydantoinase.
- the at least one enzyme is preferentially capable of producing the corresponding (S ⁇ /V-carbamoyl ⁇ -amino acid by hydrolyzing a ( ⁇ )-6-monosubstituted dihydrouracil, e.g. a (S ⁇ /V-carbamoyl ⁇ -phenylalanine from ( ⁇ )-6-phenyl dihydrouracil.
- the at least one enzyme is to be purified, common methods known to those skilled in the art can be used. After disruptions of cells crude extracts can be obtained by centrifugation or filtration, in particular for separation proteins from cell debris, membrane fragments or cell ghosts. Additional or alternative purifications steps comprise gel filtration, ion exchange chromatography (e.g. using Q-Sepharose), hydrophobic chromatography, reverse phase chromatography, ultrafiltration, crystallization, salting out, dialysis, native gelelectrophoresis, immuneprecipitation, affinity chromatography, and the like. Suitable methods are e.g. described in Cooper, F.
- the at least one enzyme is present in at least partially purified form or in essentially purified form.
- the enzymes are in an essentially purified form, if other proteins normally present in a cell or an organism used as source for the enzyme cannot be clearly detected by Coomassie staining after sodium dodecylsulfate polyacrylamide
- SDS PAGE gelelectrophoresis
- Preferred extraction methods include at least three, in particular at least four, at least five, or all of the following steps, preferentially to be performed in the following sequential order:
- hydrophobic chromatography e.g using a phenyl sepharose column
- gel filtration e.g. using a Superdex Prep Grade 200 Gel Filtration column
- affinity chromatography e.g. using a Blue HiTrap 5 ml affinity
- anion exchange chromatography e.g. using a Mono Q HR 5/5 anion exchange column
- Suitable sources for the at least one hydantoinase and/or dihydropyrminidase are microorganisms and and higher organisms, such as bacteria and a rchea bacteria, yeasts, fungi, plants and animals, fungi, yeasts, bacteria and archaebaceria.
- bacteria are Acidovorax (e.g. A. avenae); Agrobacterium (e.g. A. radiobacter, A. tumefaciens, A. sp IP 1-671 , A. tumefaciens RU-OR, and A. tumefaciens NRRL B 1 1291 ); Arthrobacter (e.g. A. A.
- crystallopoietes AM2 crystallopoietes AM2
- Aurantimonas e.g. A. sp. SI85- 9A1
- Brucella e.g. B. canis, B. ceti, B. ovis, B. pinnipedialis, B. suis
- Burckholderia e.g. B. sp. H160, B. phymatum, B. phytofirmans
- Dickeya e.g. D. dadantii
- Jannaschia e.g. J. sp. CCS1
- Mesorhizobium e.g. M. loti
- Oceanicola e.g. O.
- Ochrobactrum e.g. O. intermedium, O. sp. G21 , O. anthropi
- Polaromonas e.g. P. naphthalenivorans
- Reinekea e.g. R. sp. MED297
- Rhizobium e.g. R.
- leguminosarum leguminosarum
- Verminephrobacter e.g. V. eiseniae
- Rhodobacter e.g. R.
- Trichoplax adherens examples for lower and higher plants are Arabidopsis (e.g. A. thaliana); Bradyrhizobium (e.g B. sp. ORS278; B.
- troglodytes troglodytes
- Xenopus e.g. X. laevis, X. tropicalis
- Particularly preferred sources of the at least one hydantoinase and/or dihydropyrimidinase are the genera Vigna (in particular Vigna angularis), Agrobacterium, Arthrobacter and Pseudomonas (in particular Burckholderia according to recent taxonomy).
- Hydantoinase from Vigna angularis is commercially obtainable from Sigma-Aldrich (Sigma-Aldrich Corp., St. Louis, MO, USA).
- hydantoinases and/or dihydropyrimidinases which comprise at least one partial sequence having an identity of between 60 percent and 100 percent to at least one of the following partial sequences:
- the degree of identity with any of SEQ ID NO: 1 -5 or 7 can be at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85% or at least 90 %.
- the degree of identity with any of SEQ ID NO:1 -5 or 7 can be at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%.
- any of SEQ ID NO:1 -5 or 7 may be identical to a sequence comprised in a hydantoinase and/or dihydropyrimidinase (100% identity). The hydantoinase and/or dihydropyrimidinase character of any given protein may easily be determined by the hydantoinase and/or dihydropyrimidinase assays described in this specification.
- hydantoinases and/or dihydropyrimidinases present in organisms or microorganisms or extracted thereof, functional equivalents of those hydantoinases and/or dihydropyrimidinases may be used.
- Functional equivalents are mutants which in at least one position differ from the natural amino acid sequence while still retaining at least partially the enzymatic activity of a hydantoinase and/or dihydropyrimidinase.
- Functional equivalents may comprise one or more, as for example 1 to 20, 1 to 15 or 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid additions, substitutions, deletions and/or inversion, which may occur at any sequence position as long as they do not completely abolish the catalytic activity.
- Functional equivalents may also be enzymes with altered turnover speed of substrate and/or product, altered affinity for substrate and/or product, and/or altered selectivity of particular substrates (e.g. functional equivalents accepting substrates with more bulky or hydrophobic groups R 1 and/or R 2 ).
- substitutions with high probability of at least partially preserving the enzymatic activity are listed below: original amino acid residue possible substitution by
- Salts comprise salts of carboxyl groups and acid addition salts of amino groups.
- Salts of carboxyl groups may be produced according to methods known in the art and comprise inorganic salts, such as sodium, calcium, ammonia, iron and zinc salts, as well as salts formed with organic bases such as amines, e.g. triethanol amine, arginine, lysine, piperidin and the like.
- Acid additions salts comprise salts with mineral acids, such as hydrochloric acid or sulphuric acid, and salts formed with organic acids, such as acetic acid and oxalic acid.
- Functional equivalents may also be obtained by modifying naturally occurring hydantoinases and/or dihydropyrimidinases at one or more amino acid side chains or the N- or C-termini.
- Such derivatives may for example comprise aliphatic esters of carboxyl groups, amides of carboxyl groups, obtainable by reaction with ammonia or a primary or secondary amine, N-acyl derivatives or free amine groups, obtainable by reaction with acyl groups, or O-acyl derivatives of free hydroxyl groups, obtainable by reaction with acyl groups.
- functional equivalents obtainable by a glycosylation pattern differing from the natural pattern (e.g. after artificial glycosylation or deglycosylation).
- Functional equivalents furthermore comprise enzymes obtained from other organisms or microorganisms, as well as naturally occurring variants of the reference enzyme.
- Functional equivalents furthermore comprise single domains or sequence motives having the desired activity of hydantoinases and/or dihydropyrimidinases.
- functional equivalents may be fusion proteins comprising naturally occurring sequences or functional equivalents thereof in combination with at least one functionally different sequence in N-terminal or C-terminal linkage, which do not abolish the hydantoinase and/or dihydropyrimidinase activity of the protein.
- functionally different sequence are signalpeptides (e.g. directing the excretion of the fusion protein), enzymes (e.g. for adding additional enzymatic activities) or parts of immuneglobulins (e.g. for immobilising the fusion protein).
- Functional equivalents also comprise homologues of the naturally occurring proteins.
- Said homologues have a homology of at least 60%, preferentially at least 75%, and in particular at least 85%, such as 90%, 95% or 99% compared to a naturally occurring amino acid sequence (as calculated by the algorithm of Pearson and Lipman, Proc. Natl. Acad, Sci. (USA) 85(8), 1988, 2444-2448).
- "% homology" of a given polypeptide in particular denotes the percentage of identity of the amino acid residues in relation to the total length of the reference enzyme or enzyme subunit.
- Jerpseth B (1996) An efficient random mutagenesis technique using an E.coli mutator strain.
- Trower MK (Hrsg.) In vitro mutagenesis protocols. Humana Press, New Jersey), or DNA shuffling, wherein first a pool of closely related genes is formed and digested, and subsequently the obtained fragments are used as templates for a polymerase chain reaction, wherein full length mosaic genes are created by repeated strand separation and annealing (Stemmer WPC (1994) Nature 370:389; Stemmer WPC (1994) Proc Natl Acad Sci USA 91 :10747).
- those skilled in the art may introduce either purely random or more directed mutations into genes or non-coding regions (which may be relevant for the regulation of expression) and subsequently create gene banks.
- the methods required are known to those skilled in the art, and are described, e.g., in Sambrook und Russell, Molecular Cloning. 3. Edition, Cold Spring Harbor Laboratory Press 2001 .
- the gene banks are expressed in a suitable way, e.g. by bacteria or phage display systems.
- suitable expression vectors are known in the art. Proteins may be localized intracellular ⁇ in the cytoplasm, in membranes upon addition of a membrane anchor, or extracellularly by addition of a signal peptide containing a recognition sequence for a signal peptidase.
- clones which express proteins with a desired characteristic, are selected or screened. If a selection method is used, clones expressing proteins with desired characteristics will survive, as those proteins will facilitate or ensure the survival of the host cells (e.g, enzymes, which allow the use of particular substrates or growth at particular temperatures).
- Clones expressing a protein with a desired characteristic are identified using suitable assays, which easily can be devised by those skilled in the art.
- host cells When searching, e.g., for proteins with particular binding characteristics, host cells can be screened for, which attach to a surface coated with a substrate for the desired binding capability. Host cells expressing such a protein can attach to the substrate via the expressed protein, while host cells expressin non- functional proteins are unable to do so.
- host cells may be cultivated in substrate-containing medium or on substate-containing agar plates.
- hydantoinase or dihydropyrimidinases may be screened by media containing dihydrouracils with substitutions of interest.
- automated systems e.g. pipetting robots for microtiter plates, screening robots, image processing systems for identifying colonies on agar plates
- automated systems e.g. pipetting robots for microtiter plates, screening robots, image processing systems for identifying colonies on agar plates
- the respective genes of host cells which express functional equivalents having characteristics, which largely or at least partially, corespond to the desired characteristics, are subjected to one or more rounds of mutation.
- the steps of mutating and selecting or screening may be repeated in an interative process until the functional equivalents have the desired characteristic to a satisfactory degree.
- a gene library with mutations is created based on the nucleotide sequence of a reference protein, such as a wildtype protein (e.g. a particular hydantoinase or
- the chosen mutation rate on nucleotide level will cause a relatively low number of amino acids to be mutated in the the corresponding translated peptides or proteins, e.g. 1 to 3 amino acids.
- the resulting peptides or proteins are subsequently screened for the desired feature (e.g. a higher catalytic activity for one or more substrates, an expanded or altered substrate range, increased stability at increased or changed temperatures or pH values, or in the presence of particular solvents). Based on the sequences of proteins or peptides with such desired characteristics (which may only be evident to a low degree), a second gene libarary is created, and again a low rate of mutations is introduced.
- the translated proteins are screened for the desired characteristic.
- the cycle of creating a mutated gene library and screening the peptides or proteins expressed on the basis of the library can be repeated as often as deemed necessary. Choosing a low mutation rate per cycle will prevent a situation, where virtually all proteins are non-functional because of the accumulation of too many mutations.
- the low mutation rate (and concomitantly the low or slow manifestation of desired characteristics) can be compensated by iteratively repeating mutation (possibly leading to functional equivalents) and selection (of desirable funtional equivalents), thereby leading to an accumulation of useful mutations, and ultimately providing with a high rate of success proteins with desired, improved characteristics.
- sequence information can be obtained which identify sequence positions or sequence areas within a peptide or protein, which are important for a desired characteristic.
- sequence information can be obtained which identify sequence positions or sequence areas within a peptide or protein, which are important for a desired characteristic. Examples for the creation of proteins with desired characteristic, from which also further methods for introducing mutations will become obvious, are described in Zhao und Arnold, Protein Engineering 12:47-53 (1999) or May et al., Nature Biotechnology 18:317-320 (2000).
- nucleic acid sequences derived form the nucleic acid sequences underlying the proteins described above may also be obtained by nucleic acid sequences derived form the nucleic acid sequences underlying the proteins described above.
- a nucleic acid sequence derived from an original nucleic acid denotes a nucleic acid sequence having an identity compared to the original nucleic acid of at least 80% or at least 90%, in particular about 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
- 100% identity denotes the identity of nucleotides of two nucleic acid sequences over the whole nucleic acid length, in particular an identity determined by comparison of both nucleic acid sequences using the Vector NTI Suite 7.1 software of Infomax (USA) and the Clustal method.
- Derived nucleic acids may be chemically synthesized from nucleotide building blocks by methods known in the art, e.g. by condensation of nucleotide building blocks or oligomers. For example, chemical synthesis may occur via the phosphoamidite method (Voet, Voet, 2. Ed., Wiley Press, New York, p. 896-897). The annealing of synthetic oligonucleotides and the filling of gaps using the Klenow fragment of DNA polymerase, ligation reactions as well as general cloning methods are known in the art and are described, e.g. in Sambrook et al., Molecular Cloning: A laboratory manual, Cold Spring Harbor Laboratory Press, 1989.
- Derived nucleic acids may be identified in databases or isolated from gene banks or organisms.
- derived nucleic acids may be isolated by using the nucleic acids corresponding to the peptide sequences according to SEQ ID NO:1 -5 or 7 as probes for hybridisation or as primers for polymerase chain reaction (PCR).
- the probes or primers usually comprise a nucleotide sequence region, which under stringent conditions hybridises to at least 12, preferentially at least 25, such as about 40, about 40 or about 75 consecutive nucleotides of the sense strand or antisense strand of a potential derived nucleic acid sequence.
- the potential derived nucleic acid sequence may be present in gene banks, in cellular material of a target organism, e.g.
- the cellular material may be separated on agarose gels and be transferred to membranes for performing Northern Blot or Southern Blot hybridisation under standard conditions in order to detect the presence of nucleic acid fragments binding to the probes used, or may alternatively serve as template for primers in PCR reactions, wherein the probes or primers may be derived from nucleic acids sequences underlying any of the peptide sequences according to SEQ ID NO:1 -5 or 7.
- Hybridising nucleic acid bands on blot membranes or gels, or hybridising template nucleic acids in PCR reactions can be isolated and cloned in to suitable vectors according to methods generally known in the art (e.g. Sambrook et al., 1989), and subsequently be sequenced or used as hybridisation probes under even more stringent conditions in order to isolate nucleic acid fragments containing longer or preferentially full-length genes from gene banks or cellular material.
- Standard conditions for hybridisation vary depending on the respective nucleic acid and generally comprise temperatures from 42°C to 58°C in an aqueous buffer solution of 0.1 x SSC to 5 x SSC (wherein 1 x SSC corresponds to 0.15 M NaCI, 14 mM sodium citrate, pH 7.2), or additionally in presence of 50% formamide, such as 42°C in 5 x SSC containing 50% formamide.
- the hybridisation conditions for DNA:DNA hybrids preferentially comprise 0.1 x SSC and temperatures from about 20°C to about 45°C, in particular 30°C to 45°C.
- the hybridisation conditions for DNA:RNA hybrids preferentially comprise 0.1 x SSC and temperatures from about 30°C to about 55°C, in particular 45°C to 55°C. The aforementioned temperatures are exemplary
- Isolated nucleic acid molecules are to be understood as nucleic acid molecules essentially separated from other nucleic acid molecules comprising deviating sequences. Isolated nucleic acids molecules preferentially are essentially devoid of non-nucleic acid cell material or culture medium, or are essentially devoid of chemical precursors or other chemicals when produced by chemical synthesis.
- Derived nucleic acids may be introduced into expression constructs, optionally after cleavage by restriction enzymes or ligations with linker molecules.
- the derived nucleic acids are operatively linked with regulating elements controlling the expression of the corresponding polyeptide or protein sequence from the nucleic acid sequence, said nucleic acid sequence being a coding sequence for a useful hydantoinase or dehydropyrimidinase.
- the expression constructs preferentially comprise a promoter upstream of the derived nucleic acid and a terminator sequence downstream thereof, as well as optionally further regulatory elements.
- Operative linkage is to be understood as the sequential arrangement of promoter, coding sequence, terminator and, optionally, further regulatory elements in a way which allows the proper function of each of the aforementioned regulatory elements with respect to the expression of the coding sequence.
- elements to be operatively linked comprise targeting sequences, enhancers, polyadenylation signals, and the like.
- Further useful elements comprise selectable markers, amplification signals, replication origins and the like.
- Useful regulatory elements are known in the art and are described e.g. in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990).
- dihydropyrimidinase may be present.
- the natural regulation may be switched off or modified for lower or higher expression by genetic modification.
- the gene construct may also have a more simplified construction by just preserving the natural regulatory elements without inserting artificial ones.
- the natural regulatory elements may be mutated in such way that no regulation occurs and gene expression is lower or - preferentially - increased.
- dihydropyrimidinases may be present as single or multiple copies, optionally mixed copies, i.e. hydantoinases and dihydropyrimidinase simultaneously present, in a gene construct.
- promoters examples include cos-, tac-, trp-, tet-, trp-tet-, Ipp-, lac-, Ipp-lac-, laclq-, T7-, T5-, T3-, gal-, trc-, ara-, SP6-, lambda-PR- or lambda-PL-promoters, which preferentially are used in gram negative bacteria; as well as the promoter amy and SP02, or the yeast promoters ADC1 , MFalpha , AC, P-60, CYC1 , GAPDH.
- Inducible promoters may optionally be used, such as promoters inducible by temperature or chemical compounds (e.g. the metallothioenin promoter), allowing the induction of hydantoinase or dihydropyrimidinase expression after cell proliferation and
- the recombinant expression construct is preferentially inserted into a suitable vector, e.g. a plasmid, which in turn is introduced into a suitable host cell.
- a suitable vector e.g. a plasmid
- Vectors are known in the art and are described e.g. in Pouwels et al. (eds.), Cloning Vectors, Elsevier, Amsterdam-New York-Oxford, 1985).
- vectors may be all further vectors known in the art, such as phages, viruses, e.g. SV40, CMV, baculovirus and adenovirus, transposons, IS elements, phasmids, cosmids, and linear or circular DNA.
- the vectors may be autonomously replicated in the host, or may be chromosomally replicated after integration in the chromosome.
- Examples for non- fusion protein expression vectors are pTrc (Amann et al., (1988) Gene 69:301 -315) and pET 1 1 d (Studier et al. Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Kalifornien (1990) 60-89).
- yeast expression vectors e.g. for expression in Saccharomyces cerevisiae are pYepSed (Baldari et al., (1987) Embo J.
- bacalovirus vectors for expression of proteins in insect cells comprise the pAc series (Smith et al., (1983) Mol. Cell Biol.. 3:2156-2165) and the pVL series (Lucklow und Summers (1989)
- examples for mammalian cell vectors comprise pCDM8 (Seed, B. (1987) Nature 329:840) and pMT2PC (Kaufman et al. (1987) EMBO J. 6:187-195). Further expression systems for prokaryotic and eukarytic cells are described in chapters 16 and 17 of Sambrook, Fritsch, and Maniatis, Molecular cloning: A
- recombinant organisms can be produced which are transformed with at least one of those vectors and express a hydantoinase or dihydropyrimidinase useful for the methods according to the invention.
- the recombinant constructs can be expressed after introduction into a suitable host system.
- introduction methods known in the art can be used, such as co-precipitation, protoplast fusion, electroporation, chemical transformation, retroviral transformation, and the like. Suitable methods are e.g. described in Current Protocols in Molecular Biology, F. Ausubel et al., ed., Wiley Interscience, New York 1997, oder Sambrook et al. Molecular Cloning: A Laboratory Manual. 2. Aufl., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989.
- Suitable host organisms or host cells are those which allow the expression of the nucleic acids coding for hydantoinases or dihydropyrmindinase, or nucleic acids derived thereof.
- Host cells comprise bacteria, fungi, yeasts, plant or animal cells.
- bacteria examples include those of the genera Escherichia, wie z. B. Escherichia coli, Streptomyces, Bacillus, Pseudomonas oder Burkholderia, examples for eukaryotic microorganismes are Saccharomyces cerevisiae, Aspergillus, higher eukaryotic cells from animals or plants, e.g. Sf9-, CHO- or HEK293 cells, wherein single cells or aggregated
- microorganisms examples for bacteria are those of the genera Escherichia, wie z. B. Escherichia coli, Streptomyces, Bacillus, Pseudomonas oder Burkholderia
- examples for eukaryotic microorganismes are Saccharomyces cerevisiae, Aspergillus, higher eukaryotic cells from animals or plants, e.g. Sf9-, CHO- or HEK293 cells, wherein single cells or aggregated
- the selection of successfully transformed cells may be based on marker genes contained in the respective vector or expression cassette.
- marker genes comprise genes for antibiotic resistance or for enzymes catalysing a colour forming reaction, which causes the staining or the fluorescence of the transformed cell.
- Said cells can be selected by automatic cell sorting.
- Successfully transformed cells carrying a antibiotic resistance gene, e.g. for G418 or hygromycin, can be selected by antibiotic containing media or agar plates. Marker proteins expressed on the cell surface can be used for selection via affinity chromatography.
- the cells are cultivated as described in Chapter C above, and may excrete the hydantoinase or dihydropyrimidinase into the medium (thus allowing cells growth or survival and simultaneous biocatalytic production of a ⁇ -amino acid precursor from the at least one substrate of the general formula (1 ).
- the cells may be permeabilised after growth and/or induction of hydantoinase or dihydropyrimidinase expression in order to initiate the biocatalytic production of a ⁇ -amino acid precursor.
- the cells may be harvested after growth and induction of hydantoinase or
- dihydropyrimidinase expression for partial or complete purification of the hydantoinase or dihydropyrimidinase, whereupon the purified hydantoinase or dihydropyrimidinase can be used for the biocatalytic production of a ⁇ -amino acid precursor.
- one or more additional enzymes can optionally be present during the reaction.
- These enzymes catalyse the conversion between the D- and L-enantiomers of dihydrouracil substrates according to the general formula (I).
- suitable enzymes comprise dihydrouracil dehydrogenase (e.g. from mammalian sources), dihydrouracil oxidase (Rhodotorula glutinis) and enoate reductase (Old yellow enzyme).
- the ⁇ -amino precursor according to the general formula (II) ( ⁇ -amino acid carbamoyl derivative), which is produced by the method of the present invention, can be cleaved into the corresponding ⁇ -amino acid and the N-carbamoyl moiety while remaining in the reaction mixture.
- the ⁇ -amino acid precursor can be separated from the reaction mixture containing the substrate of the general formula (I) and the at least one hydantoinase and/or dihydropyrimidinase, and be cleaved to yield the ⁇ -amino acid.
- the cleavage can be performed chemically or enzymatically.
- Chemical cleavage can be achieved by adding an equimolar amount NaN0 2 to the ⁇ - amino acid precursor according to the general formula (II) at an acidic pH, e.g. 1 .0 (e.g. as described by Fan and Lee, Biochemical Engineering Journal 8: 157-164, 2001 ).
- the acidic pH can be achieved by, e.g. sulphuric acid.
- the cleavage reaction can be performed at low temperatures, e.g. on ice. If the cleavage of the ⁇ -amino acid precursor of the general formula (II) is to be achieved chemically, it is preferred to perform this reaction separate from the enzymatic reaction leading from the substrate according to the general formula (I) to the ⁇ -amino acid precursor.
- the cleavage can be performed after the enzymatic conversion has been competed or come to an equilibrium (temporal separation), or in a different reaction vessel after removing of the reaction medium containing the ⁇ -amino acid precursor (spatial separation).
- a continuous production can be achieved by contacting reaction medium containing the substrate molecule according to the general formula (I) with immobilized enzymes (hydantoinase and/or dihydropyrimidinase), which thereby are retained in the reactor vessel, whereas substrate-depleted reaction medium can be separated for cleavage of the ⁇ -amino acid precursor and simultaneously be replaced by fresh reaction medium.
- Enzymatic cleavage can be performed by enzymes such as carbamoylases (e.g. E.C.3.5.1 .77 or E.C.3.5.1 .87) or ⁇ -ureidopropionases (e.g.
- the method according to the invention for converting a substrate according to the general formula (1 ) into a ⁇ -amino acid precursor according to the general formula (2) is preferentially performed at a pH from about 7.0 to about 1 1 .0, preferentially at a pH from about 7.5 to 10.0.
- the pH is in the range from 7.5 to 8.5, more particular in the range from about 7.5 to 8.0.
- Particularly preferred pH values are about 7.5, 7.6, 7.7, 7.8, 7.9 and 8.0.
- any buffer suitable for the aforementioned pH values or pH ranges can be used, e.g. phosphate buffer, borate buffer and Tris buffers. In a pH range from 7.5 to 9.0 Tris buffers are preferred, while phosphate buffers are useful in a pH range from 6.0 to 8.0. Especially preferred are reaction solutions buffered by Tris.
- the concentration of the buffer can be determined depending on the concentration of substrate used, and preferentially is in the range from 1 mM to 200 mM, e.g. 1 mM to 100 mM, 1 mM to 50 mM. In particular the buffer concentration may be from 2 mM to 25 mM or 3 mM to 10 mM, such as 5 mM. G. Temperature and duration of the reaction
- the process for biocatalytic conversion of a substrate of the general formula (I) can be performed at any temperature which is tolerable for the hydantoinase and/or dihydropyrimidinase used.
- the temperatures usually correlate with the optimal growth temperatures of the organisms or microorganism harbouring the enzyme(s) or used as source for their extraction, but can easily determined by those skilled in the art.
- the process can be performed at temperatures from 30°C to 60°C, in particular from 40° to 50°C. Examples for reaction temperatures are about 30°C, about 35°C, about 37°C, about 40°C, about 45°C, about 50°C, about 55°C and about 60°C.
- the process may proceed until an equilibrium between the substrate of the general formula (I) and the ⁇ -amino acid precursor of the general formula (2) is achieved, but may be stopped earlier.
- Usual process times are in the range from 1 minute to 25 hours, in particular 10 min to 6 hours.
- Preferred reaction times are in the range from 1 hour to 4 hours, in particular 1 .5 hours to 3.5 hours.
- Additional components in the reaction medium are in the range from 1 minute to 25 hours, in particular 10 min to 6 hours.
- Preferred reaction times are in the range from 1 hour to 4 hours, in particular 1 .5 hours to 3.5 hours.
- one or more organic co-solvent(s) can be included in the reaction medium.
- the reaction can be performed in biphasic systems comprising aqueous and non-aqeuous phases.
- suitable solvents for the non- aqueous phase are aliphatic hydrocarbons, preferentially comprising 5 to 8 carbon atoms, such as pentane, cycopentane, hexane, cylcohexane, heptane, octane or cyclooctane, halogenated aliphatic hydrocarbons, preferentially comprising one or two carbon atoms, such as dichloromethane, chloroform, tetrachloromethane,
- dichloroethane aromatic hydrocarbons, such as benzene, toluene, xylenes, chlorobenzene or dichlorobenzene, aliphatic acyclic or cyclic ethers, preferentially comprising 4 to 8 carbon atoms, such as diethyl ether, methyl-tert-butylether, ethyl-tert- butylether, dipropyl ether, diisopropyl ether, tetrahydrofurane, or esters, such as ethylacetate or n-butyl acetate, or ketones, such as methyl-isobutylketone or dioxane, or mixtures thereof.
- aromatic hydrocarbons such as benzene, toluene, xylenes, chlorobenzene or dichlorobenzene
- aliphatic acyclic or cyclic ethers preferentially comprising 4 to 8 carbon atoms, such as dieth
- reaction medium is an aqueous reaction medium containing organic co-solvents, especially as a monophasic system.
- organic co-solvents are butane-2-ol, methyl-tert-butyl ether (MTBE) and
- DMSO dimethylsulfoxide
- a concentration below the saturation in aqueous medium (approximately 12 vol.-%) is preferred, e.g. about 6%, about 5%, about 4%, about 3%, about 2%, about 1 % or less than 1 %.
- MTBE can be used up to the saturation concentration in aqueous media (about 6 vol.-%), while DSMO can be used up to concentrations of about 2 vol.-% for increasing the solubility of the substrate without essentially interfering with the process yield.
- Ion exchange chromatography in particular anion exchange chromatography is a preferred method.
- Suitable ion exchange matrices comprise strong anion exchangers (e.g. Q Sepharose, based on quaternary ammonium) and weak anion exchangers (e.g DEAE Sepharose, based diethylaminoethyl). Examples for preferred methods are anion exchange chromatography using DEAE columns, or extraction with an organic solvent, using ethyl acetate to extract substrate, followed by 2-butanol to extract product from biotransformation.
- TLC TLC was performed using plastic backed plates coated with 0.2 mm thick silica gel 60F254 (Mackerey-Nagel). Plates were visualised using U.V. light (254nm) or permanganate dip. Chemicals were purchased from Sigma-Aldrich, Acros or Fluka unless otherwise stated. All reagents were standard laboratory grade and solvents anhydrous, and used as supplied unless otherwise stated. 1 H-NMR and 13C-NMR were recorded on a Bruker AC300 or AC400 spectrometer.
- ⁇ chemical shift
- bs broad singlet
- d doublet
- dd doublet of doublets
- J coupling constant
- m multiplet
- q quartet
- qui quintet
- s singlet
- sep septet
- DMSO-d6 Residual protic solvent, DMSO-d6 ( ⁇ H 2.50, qui ) was used as the internal standard in 1 H NMR spectra, and 13C NMR shifts were referenced using DMSO-d6 ( ⁇ C 39.5, sep) with broad band decoupling.
- Biotransformations were carried out using ⁇ Unit/reaction', in which 1 Unit is defined as the amount that will catalyse the formation of 1 ⁇ of N-carbamoyl- glycine per minute, from hydantoin.
- Example 1 Assays for hydrolysis of 5-substituted hydantoin or 6- phenyldihydrouracil
- D-hydantoinase (10.5 mg) was added to 5-phenylhydantoin (1 .32mg) dissolved in borate buffer (1 .5 ml_, 0.1 M, pH 9.0).
- borate buffer (1 .5 ml_, 0.1 M, pH 9.0.
- the biotransformation was incubated in an Eppendorf "Themomixer comfort", (40 °C, 1400 rpm).
- the assay setup can be used to determine the hydantoinase activity of an enzyme suspected of having such activity by replacing D-hydantoinase by said enzyme.
- Example 2 Isolation of a hydantoinase from Viqna annularis
- a protein with hydantoinase activity was isolated from Vigna angularis as follows:
- Adzuki beans obtained from a health food store were ground in two aliquots together with dry ice, using a conventional mixer.
- 4 L extraction buffer (20 mM Tris, 10 mM ascorbic acid, 10 mM lysine, pH 7.5) was added, the suspension was stirred overnight at 4°C filtered through gaze and centrifuged. 2500 mL crude extract with a protein content von 9.5. mg/ml were obtained and stored at -20°C until subsequent chromatography steps (using chromatography colums from Amersham Pharmacia or GE Healthare) were performed.
- a Q-Sepharose FF-chromatography column (diameter: 5 cm; length: 21 cm) was washed with 200 mM Tris/HCI (pH 7.5), equilibrated with running buffer A (20 mM Tris/HCI, 1 mM ascorbic acid, 1 mM L-lysine * HCI, pH 7.5), and loaded with crude extract (5 g total protein).
- running buffer A (20 mM Tris/HCI, 1 mM ascorbic acid, 1 mM L-lysine * HCI, pH 7.5
- a linear gradient from running buffer A to running buffer B (20 mM Tris/HCI, 750 mM NaCI, 1 mM ascorbic acid, 1 mM L-lysine * HCI, pH 7.5) was applied and active fractions were collected.
- 50 mL protein sample were incubated with 50 ⁇ _ 5-hydantoin (100 mM in 100 mM borate buffer, pH 9) at room temperature for 10-60 min (depending on the enzyme content). Proteins present in the sample were completely precipitated by addition of 150 ⁇ _ 12% trichloroacetic acid (TCA) and removed by centrifugation. 50 ⁇ _ 4- (dimethylamino)-benzaldehyde (10% in 6 M HCI) were added to 200 ⁇ _ supernate and measured photometrically at 450 nm.
- a phenyl sepharose column with a diameter of 5 cm and a length of 21 cm was used.
- the pooled active fractions of ion exchange chromatography (280 ml) were diluted to 500 ml by adding water, 67 g (NH 4 ) 2 S0 4 were added to give a saturation of 25%, and the resulting mix was applied to the column.
- Running buffer A (20 mM Tris, 25% saturation with (NH4)2S04, 1 mM lysine, 1 mM ascorbic acid, pH 7.5; also used as wash buffer) was applied at a flow rate of 15 mL/min.
- a Superdex 200 column (diameter: 2.6 cm, length: 60 cm) was operated at a flow rate of 4 ml/min.
- the resulting pellet was dissolved in 10 mL isocratic running buffer (20 mM Tris/HCI, pH 7.5) and applied to the column.
- the Blue HiTrap 5 mL Affinity Chromatography column was equilibrated with buffer A (20 mM Tris/HCI, pH 7.5). After loading the pooled active fractions from molecular sieve chromatography as determined by a hydantoinase assay using the Ehrlich reagent [please confirm] the column was isocratically operated with 5 column volumes of buffer B (20 mM Tris/HCI, 500 mM NaCI, pH 7.5) and subsequently with 2 column volumes of buffer C (20 mM Tris/HCI, pH 7.5, 500 mM NaCI, 1 mM NAD, 1 mM NADP). This affinity chromatography step was used to remove glucose dehydrogenase (not showing activity with regard to glucose and NAD/NADP) by binding to the column.
- the pooled active fractions from the preceding anion exchange chromatography were concentrated to a volume of 1 ml (using a centriprep device with a molecular weight cutoff of 10 kD) and loaded onto a Superose column at a flow rate of 1 mL/min.
- the second protein of approximately 35 kD is glucose dehydrogenase.
- the obtained partial sequences have a high homology to a sequence from Glycine max with the Genbank accession number ACU20291 (SEQ ID NO:6), which referred to a D-hydantoinase, thus confirming the hydantoinase nature of the isolated protein.
- SEQ ID NO:6 is shown below, the regions of homology are underlined: mqfsitsqflhifsltifiiitsslsqssqfcdagteipsskllikggtvvnaqhhqia dvyvedgiivavnpnimvgddvtvidatgkyvmpggidphthldmdvgftatvddffsgqaaal aggttmhidfviplngsltagfedyekkakkscmdygfhmvitk detvsremelmvkekgins fkffmaykgilmindelllegfkkckslgavamvhaengdavyegqrkmielgitgpeghalsr pavlegeatarairladfvntplyvvhvmsidameeiakarkagqrvigepiasglaldes l hpdfeiaakyvms
- Example 3 Activity comparison between commercially available hyandantoinase and isolated hydantoinase
- Table 1 is showing the specific activities from the sigma enzyme and the enzyme isolated in Example 2. Both enzymes show the highest activity towards 5-phenylhydantoin followed by hydantoin.
- the required 6-substituted dihydrouracil substrates 4a-i were prepared by one of two alternative routes (Fig. 2).
- method A (Cabaleiro, M. C, Journal of Chemical Research 7:318-320, 2000)
- urea was heated with the appropriate cinnamic acid derivative 7 at 190°C for 2-4h, followed by recrystallisation of the product, to yield 4a-i in -45% yield.
- Method B involved treatment of the corresponding racemic ⁇ -amino acid with potassium cyanate followed by heating to effect cyclisation to give 4a-i in high yield.
- Method B which is known to proceed without racemisation, was also used to prepare enantiomerically pure (S)-4a and (S)-5a, by using enantiomerically pure (S)-6a as the starting material.
- Example 5 Synthesis of racemic 6-substituted dihydrouracils or precursor molecules (individual syntheses) a) Synthesis of ( ⁇ )-6-phenyldihydrouracil according to the following formula
- Example 8 Separation of enzyme, substrate and product by DEAE chromatography
- a column was prepared from an inverted syringe, blocked with glass wool and filled with DEAE (4mL) that had been washed with 10 column volumes of dH 2 0.
- DEAE deoxysilyl
- a synthetic mixture of NCBPA (2.5mM), 6PDHU (2.5mM) and enzyme (7mg/mL) in H 2 0 was applied to the column and the flow through was analysed by rpHPLC (6PDHU/NCBPA detection) and Bradford assay (enzyme detection). After all 6PDHU had been washed from the column, NCBPA was eluted from the column using 200mM ammoium acetate (pH 8.17). The results are shown in Fig.
- FIG. 6 shows the conversion of (+/-)-, (S)- and (R)-NCBPA with and without enzyme, wherein closed or open diamonds connected by solid lines represent +/-NCBPA (without enzyme) or +/-NCBPA (with enzyme), respectively, closed or open squares connected by solid lines represent (S)-NCBPA (without enzyme) or (S)-NCBPA
- 6-PDHU was incubated at 50°C for 24 hours in Tris buffer at different pH values. Appreciable background hydrolysis of 6-PDHU occurred with a strong pH and buffer dependency. In Tris buffer at pH 7, a background hydrolysis of 0.5% was observed. At pH 9, the background hydrolysis amounted to ca. 20% (Fig. 7).
- Example 11 pH dependency of hydantoinase activity
- 6-PDHU was incubated in phosphate buffer (0.1 M, potassium dihydrogen phosphate and dipotassium hydrogen phosphate, volumes adjusted to the appropriate pH) or Tris buffer at various pH values for (up to 8h, using 7g/L D-hydantoinase from Sigma). The highest rate of conversion was observed in the range from about pH 7.5 and about pH 9.0 (Fig. 8, wherein squares represent phosphate buffer and diamonds represent Tris buffer). In an additional experiment conversion rates were determined for phosphate or
- E value (ln(l-[product]*(l+ee)))/(ln(l-[product]*(l-ee)))
- Example 13 Influence of organic co-solvents of hvdantoinase-catalvsed conversion
- Biotransformations of 5 mM 6-PDHU were carried out in a 5 mL-scale in buffer with 2% DMSO and buffer that had been saturated with either MTBE (approximately 5 vol.-%) or butan-2-ol (approximately 15 vol.-%).
- the results are shown in Fig. 1 1 , wherin diamonds represent buffer, squares represent buffer containing 2% DMSO, triangles represent buffer containing MTBE, and crosses represent buffer containing butane-2-ol.
- DMSO nor MTBE considerably affected the conversion while butane-2-ol reduced the amount of NCBPA at the concentration used.
- Example 14 Influence of enzyme amount on conversion and enantiomeric excess
- N-carbamoyl-3-phenylalanine (NCBPA) and the enantiomeric excess of the S-enantiomer were determined at various time points. The results are shown in Fig.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- General Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Diabetes (AREA)
- Hematology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Enzymes And Modification Thereof (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2012528394A JP5919192B2 (ja) | 2009-09-15 | 2010-09-15 | βアミノ酸の調製 |
| EP10752833.3A EP2478098B1 (en) | 2009-09-15 | 2010-09-15 | Preparation of beta-amino acids |
| CN2010800513638A CN102782128A (zh) | 2009-09-15 | 2010-09-15 | β-氨基酸的制备 |
| ES10752833.3T ES2628225T3 (es) | 2009-09-15 | 2010-09-15 | Preparación de beta-aminoácidos |
| US13/496,086 US9096841B2 (en) | 2009-09-15 | 2010-09-15 | Preparation of beta-amino acids |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP09170364 | 2009-09-15 | ||
| EP09170364.5 | 2009-09-15 | ||
| US24530309P | 2009-09-24 | 2009-09-24 | |
| US61/245,303 | 2009-09-24 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2011032990A1 true WO2011032990A1 (en) | 2011-03-24 |
Family
ID=43259766
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2010/063558 Ceased WO2011032990A1 (en) | 2009-09-15 | 2010-09-15 | Preparation of beta-amino acids |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US9096841B2 (https=) |
| EP (1) | EP2478098B1 (https=) |
| JP (1) | JP5919192B2 (https=) |
| CN (1) | CN102782128A (https=) |
| ES (1) | ES2628225T3 (https=) |
| WO (1) | WO2011032990A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8709767B2 (en) | 2009-06-04 | 2014-04-29 | Basf Se | Process for the enzymatic reduction of enoates |
| US9758500B2 (en) | 2012-04-16 | 2017-09-12 | Basf Se | Process for the preparation of (3E, 7E)-homofarnesol |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN106191147B (zh) * | 2016-07-08 | 2020-03-27 | 凯莱英医药集团(天津)股份有限公司 | 手性β-氨基酸的制备方法 |
| CN106831606B (zh) * | 2017-01-20 | 2019-02-22 | 湖南有色郴州氟化学有限公司 | 一种5-三氟甲基-5,6-二氢尿嘧啶的制备方法 |
| CN109896980B (zh) * | 2017-12-07 | 2022-04-08 | 浙江九洲药业股份有限公司 | 一种西格列汀中间体的生物合成方法 |
| CN119955872B (zh) * | 2025-04-11 | 2025-08-12 | 中国科学院微生物研究所 | R-(-)-3-(氨甲酰甲基)-5-甲基己酸合成蛋白及其突变体与应用 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPH06261787A (ja) | 1993-03-10 | 1994-09-20 | Kanegafuchi Chem Ind Co Ltd | 光学活性β−アミノ酸の製造法 |
| EP1069183A2 (de) | 1999-07-09 | 2001-01-17 | Basf Aktiengesellschaft | Immobilisierte Lipase |
| DE10019377A1 (de) | 2000-04-19 | 2001-10-25 | Basf Ag | Verfahren zur Immobilisierung von biologisch aktiven Stoffen auf Trägermaterialien und Verwendung der mit biologisch aktiven Stoffen geträgerten Materialien für chirale Synthesen |
| EP1149849A1 (de) | 2000-04-19 | 2001-10-31 | Basf Aktiengesellschaft | Verfahren zur Herstellung von kovalent gebundenen biologisch aktiven Stoffen an Polyurethanschaumstoffen sowie Verwendung der geträgerten Polyurethanschaumstoffe für chirale Synthesen |
Family Cites Families (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1260347C (zh) * | 2002-05-13 | 2006-06-21 | 中国人民解放军军事医学科学院生物工程研究所 | 一株产乙内酰脲酶系的节杆菌 |
| CN1908159B (zh) * | 2005-02-07 | 2011-04-20 | 中国科学院上海生命科学研究院 | D-氨基酸生产菌株及其构建方法 |
| EP2065470A1 (en) | 2007-11-28 | 2009-06-03 | Basf Se | New malonate decarboxylases for industrial applications |
| EP2229449A2 (de) | 2007-12-10 | 2010-09-22 | Basf Se | Verfahren zur enzymatischen reduktion von alpha- und beta-dehydroaminosäuren |
| KR20100098447A (ko) | 2007-12-20 | 2010-09-06 | 바스프 에스이 | (s)-1-메톡시-2-프로필아민으로부터의 (s)-2-아미노-1-프로판올 (l-알라닌올)의 제조 방법 |
| EP2145904A1 (de) | 2008-07-18 | 2010-01-20 | Basf Se | Verfahren zur enzymkatalysierten Hydrolyse von Polyacrylsäureestern sowie dafür zu verwendende Esterasen |
| JP2012511922A (ja) | 2008-12-17 | 2012-05-31 | ビーエーエスエフ ソシエタス・ヨーロピア | デュロキセチンアルコールを製造するための改良型生体触媒 |
| EP2387556B1 (de) | 2009-01-16 | 2014-07-30 | Basf Se | Trennung eines enantiomerengemischs von (r)- und (s)-3-amino-1-butanol |
| DE102009003035A1 (de) | 2009-05-12 | 2010-11-18 | Basf Se | Verfahren zur Herstellung von urethangruppenhaltigen (Meth)acrylsäureestern |
| US20120070867A1 (en) | 2009-06-04 | 2012-03-22 | Basf Se | process for the enzymatic reduction of enoates |
| EP3404108A1 (de) | 2009-06-05 | 2018-11-21 | Basf Se | Biokatalytische herstellung von ambroxan |
| WO2011012632A2 (en) | 2009-07-30 | 2011-02-03 | Basf Se | Biocatalyst for catalytic hydroamination |
-
2010
- 2010-09-15 JP JP2012528394A patent/JP5919192B2/ja not_active Expired - Fee Related
- 2010-09-15 WO PCT/EP2010/063558 patent/WO2011032990A1/en not_active Ceased
- 2010-09-15 ES ES10752833.3T patent/ES2628225T3/es active Active
- 2010-09-15 CN CN2010800513638A patent/CN102782128A/zh active Pending
- 2010-09-15 EP EP10752833.3A patent/EP2478098B1/en not_active Not-in-force
- 2010-09-15 US US13/496,086 patent/US9096841B2/en not_active Expired - Fee Related
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPH06261787A (ja) | 1993-03-10 | 1994-09-20 | Kanegafuchi Chem Ind Co Ltd | 光学活性β−アミノ酸の製造法 |
| EP1069183A2 (de) | 1999-07-09 | 2001-01-17 | Basf Aktiengesellschaft | Immobilisierte Lipase |
| DE10019377A1 (de) | 2000-04-19 | 2001-10-25 | Basf Ag | Verfahren zur Immobilisierung von biologisch aktiven Stoffen auf Trägermaterialien und Verwendung der mit biologisch aktiven Stoffen geträgerten Materialien für chirale Synthesen |
| EP1149849A1 (de) | 2000-04-19 | 2001-10-31 | Basf Aktiengesellschaft | Verfahren zur Herstellung von kovalent gebundenen biologisch aktiven Stoffen an Polyurethanschaumstoffen sowie Verwendung der geträgerten Polyurethanschaumstoffe für chirale Synthesen |
Non-Patent Citations (56)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1985, JOHN WILEY & SONS |
| "Current Protocols in Molecular Biology", 1997, WILEY INTERSCIENCE |
| "Essential Moelcular Biolgoy: A Practical Approach", 1991, IRL PRESS AT OXFORD UNIVERSITY PRESS |
| "Nucleic Acid Hybridisation: A Practical Approach", 1985, IRL PRESS AT OXFORD UNIVERSITY PRESS |
| "vitro mutagenesis protocols", 1996, HUMANA PRESS |
| AMANN ET AL., GENE, vol. 69, 1988, pages 301 - 315 |
| ARCURI ET AL., AMINO ACIDS, vol. 19, 2000, pages 477 - 482 |
| ARCURI ET AL., J. MOLECULAR CATALYSIS B, vol. 21, 2003, pages 107 - 111 |
| ARCURI M B ET AL: "Stability of immobilized D-hydantoinase from Vigna angularis and repeated cycles of highly enantioenriched production of N-carbamoyl-D-phenylglycines", AMINO ACIDS (VIENNA), vol. 27, no. 1, August 2004 (2004-08-01), pages 69 - 74, XP002614142, ISSN: 0939-4451 * |
| BALDARI ET AL., EMBO J., vol. 6, 1987, pages 229 - 234 |
| BARETTINO D; FEIGENBUTZ M; VAICAREI R; STUNNENBERG HG, NUCLEIC ACIDS RES, vol. 22, 1994, pages 541 |
| BARIK S, MOL BIOTECHNOL, vol. 3, 1995, pages 1 |
| BRETSCHNEIDER, U., SYLDATK, C. AND RUDAT, J.: "Synthese aromatischer beta-Aminosäuren mit neuen cyclischen Amidasen", CHEMIE INGENIEUR TECHNIK, vol. 82, 17 November 2010 (2010-11-17), pages 161 - 165, XP002614143, DOI: 10.1002/cite.200900109 * |
| BRETSCHNEIDER, U., SYLDATK, C. AND RUDAT, J.: "Synthese enantiomerenreiner beta-Aminosäuren mit Hilfe neuer cyclischer Amidasen", CHEMIE INGENIEUR TECHNIK,, vol. 81, no. 8, 19 August 2009 (2009-08-19), pages 1255, XP002614137, DOI: 10.1002/cite.200950248 * |
| CABALEIRO, M. C., JOURNAL OF CHEMICAL RESEARCH, vol. 7, 2000, pages 318 - 320 |
| CRUEGER; CRUEGER: "Biotechnologie - Lehrbuch der angewandten Mikrobiologie,2. Ed.", 1984, R. OLDENBOURG VERLAG |
| DATABASE EMBL [Online] 18 April 2005 (2005-04-18), "POD_010_B04 Phaseolus vulgaris pod EST library Phaseolus vulgaris cDNA 5', mRNA sequence.", XP002614138, retrieved from EBI accession no. EMBL:CV538774 Database accession no. CV538774 * |
| DATABASE UniProt [Online] 22 September 2009 (2009-09-22), "SubName: Full=Putative uncharacterized protein;", XP002614141, retrieved from EBI accession no. UNIPROT:C6TEN9 Database accession no. C6TEN9 * |
| DATABASE UniProt [Online] 24 March 2009 (2009-03-24), "SubName: Full=Dihydropyrimidinase, putative; EC=3.5.2.2;", XP002614139, retrieved from EBI accession no. UNIPROT:B9SXX3 Database accession no. B9SXX3 * |
| DATABASE UniProt [Online] 29 May 2007 (2007-05-29), "SubName: Full=D-hydantoinase (Dihydropyrimidinase) (DHPase); EC=3.5.2.2;", XP002614140, retrieved from EBI accession no. UNIPROT:A4Z0Y7 Database accession no. A4Z0Y7 * |
| DURR R ET AL: "Distribution of hydantoinase activity in bacterial isolates from geographically distinct environmental sources", JOURNAL OF MOLECULAR CATALYSIS. B, ENZYMATIC, ELSEVIER, AMSTERDAM, NL, vol. 39, no. 1-4, 2 May 2006 (2006-05-02), pages 160 - 165, XP025156454, ISSN: 1381-1177, [retrieved on 20060502], DOI: DOI:10.1016/J.MOLCATB.2006.01.017 * |
| EADIE, G.; BERNHEIM, F.; BERNHEIM, M., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 181, 1949, pages 449 - 458 |
| ECKERT KA; KUNKEL TA, NUCLEIC ACIDS RES, vol. 18, 1990, pages 3739 |
| FAN; LEE, BIOCHEMICAL ENGINEERING J., vol. 8, 2001, pages 157 - 164 |
| FAN; LEE, BIOCHEMICAL ENGINEERING JOURNAL, vol. 8, 2001, pages 157 - 164 |
| GAEBLER, O. H.; KELTCH, A. K., ON THE METABOLISM OF HYDANTOINS AND HYDANTOIC ACID, vol. 70, 1926 |
| GOEDDEL: "Gene Expression Technology: Methods in Enzymology", vol. 185, 1990, ACADEMIC PRESS |
| GREENER A; CALLAHAN M; JERPSETH B: "vitro mutagenesis protocols", 1996, HUMANA PRESS, article "An efficient random mutagenesis technique using an E.coli mutator strain" |
| HAMAJIMA, N.; MATSUDA, K.; SAKATA, S.; TAMAKI, N.; SASAKI, M.; NONAKA, M., GENE, vol. 180, 1996, pages 157 - 163 |
| J. LALONDE; A. MARGOLIN: "Enzyme Catalysis in Organic Synthesis", vol. III, 2002, WILEY-VCH, article "Immobilization of Enzymes", pages: 991 - 1032 |
| KAUFMAN ET AL., EMBO J., vol. 6, 1987, pages 187 - 195 |
| KEGLER-EBO DM; DOCKTOR CM; DIMAIO D, NUCLEIC ACIDS RES, vol. 22, 1994, pages 1593 |
| KIM, G. J.; CHEON, Y. H.; KIM, H. S., BIOTECHNOLOGY AND BIOENGINEERING, vol. 61, 1998, pages 1 - 13 |
| KURJAN; HERSKOWITZ, CELL, vol. 30, 1982, pages 933 - 943 |
| LUCKLOW; SUMMERS, VIROLOGY, vol. 170, 1989, pages 31 - 39 |
| MAY ET AL., NATURE BIOTECHNOLOGY, vol. 18, 2000, pages 317 - 320 |
| MAY, O.; SIEMANN, M.; PIETZSCH, M.; KIESS, M.; MATTES, R.; SYLDATK, C. J., BIOTECHNOL., vol. 61, 1998, pages 1 - 13 |
| MORIN, ENZYME MICROB. TECHNOL., vol. 15, 1993, pages 208 - 214 |
| OGAWA, J.; SHIMIZU, S., JOURNAL OF MOLECULAR CATALYSIS B: ENZYMATIC, vol. 2, 1997, pages 163 - 176 |
| PEARSON; LIPMAN, PROC. NATL. ACAD, SCI. (USA), vol. 85, no. 8, 1988, pages 2444 - 2448 |
| POUWELS ET AL: "Cloning Vectors", 1985, ELSEVIER |
| REETZ MT; JAEGER K-E, TOPICS CURR CHEM, vol. 200, 1999, pages 31 |
| SAMBROOK ET AL.: "Molecular Cloning: A laboratory manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual,2. Aufl.,", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK; FRITSCH; MANIATIS: "Molecular cloning: A Laboratory Manual, 2nd Ed.,", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK; RUSSELL: "Molecular Cloning. 3. Edition,", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| SCHULTZ ET AL., GENE, vol. 54, 1987, pages 113 - 123 |
| SEED, B., NATURE, vol. 329, 1987, pages 840 |
| SMITH ET AL., MOL. CELL BIOL.., vol. 3, 1983, pages 2156 - 2165 |
| STEMMER WPC, NATURE, vol. 370, 1994, pages 389 |
| STEMMER WPC, PROC NATL ACAD SCI USA, vol. 91, 1994, pages 10747 |
| STUDIER ET AL.: "Gene Expression Technology: Methods in Enzymology", vol. 185, 1990, ACADEMIC PRESS, pages: 60 - 89 |
| SYLDATK, C.; MAY, O.; ALTENBUCHNER, J.; MATTES, R.; SIEMANN, M., APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 51, 1999, pages 293 - 309 |
| VAN DEN HONDEL, C.A.M.J.J.; PUNT, P.J. ET AL.: "Applied Molecular Genetics of Fungi", 1991, CAMBRIDGE UNIVERSITY PRESS, article "Gene transfer systems and vector development for filamentous fungi", pages: 1 - 28 |
| ZHAO H; MOORE JC; VOLKOV AA; ARNOLD FH: "Manual of industrial microbiology and biotechnology", 1999, AMERICAN SOCIETY FOR MICROBIOLOGY, article "Methods for optimizing industrial enzymes by directed evolution" |
| ZHAO; ARNOLD, PROTEIN ENGINEERING, vol. 12, 1999, pages 47 - 53 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8709767B2 (en) | 2009-06-04 | 2014-04-29 | Basf Se | Process for the enzymatic reduction of enoates |
| US9758500B2 (en) | 2012-04-16 | 2017-09-12 | Basf Se | Process for the preparation of (3E, 7E)-homofarnesol |
Also Published As
| Publication number | Publication date |
|---|---|
| US9096841B2 (en) | 2015-08-04 |
| EP2478098A1 (en) | 2012-07-25 |
| JP5919192B2 (ja) | 2016-05-18 |
| EP2478098B1 (en) | 2017-03-15 |
| US20120270280A1 (en) | 2012-10-25 |
| ES2628225T3 (es) | 2017-08-02 |
| JP2013504313A (ja) | 2013-02-07 |
| CN102782128A (zh) | 2012-11-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12252725B2 (en) | Method for producing vanillin | |
| US7393667B2 (en) | Stereoselective reduction process for the preparation of pyrrolotriazine compounds | |
| US9096841B2 (en) | Preparation of beta-amino acids | |
| US11345907B2 (en) | Method for producing albicanol compounds | |
| WO2023088077A1 (en) | Biocatalysts and methods for the synthesis of pregabalin intermediates | |
| US20110262977A1 (en) | Process for production of optically active amine derivative | |
| CN115956127A (zh) | 光学活性氨基酰胺化合物的对映选择性化学酶合成 | |
| US8008051B2 (en) | Butynol I esterase | |
| Geueke et al. | Overproduction and characterization of a recombinant D-amino acid oxidase from Arthrobacter protophormiae | |
| US12534745B2 (en) | Lipoxygenase-catalyzed production of unsaturated C10-aldehydes from polyunsatrurated fatty acids | |
| US20080241895A1 (en) | N-Acetyl-(R,S)-beta-Amino Acid Acylase Gene | |
| US7399624B2 (en) | Cephalosporin C acylases | |
| CN101641437B (zh) | 猪肝酯酶的同工型 | |
| WO2011078667A2 (en) | Method of finding a biocatalyst having ammonia lyase activity | |
| WO2004078951A1 (ja) | ラクトナーゼの製法およびその利用 | |
| CN102317450A (zh) | 用于制备度洛西汀(duloxetine)醇之改良生物催化剂 | |
| JP5619400B2 (ja) | 酸性ホスファターゼ及びそれをコードする核酸、並びにこれらを利用したリボフラビン−5’−リン酸の製造方法 | |
| Liang et al. | Biocatalytic synthesis of chiral five-membered carbasugars intermediates utilizing CV2025 ω-transaminase from Chromobacterium violaceum | |
| JP2025523627A (ja) | 1,3-ジオール置換インデンの合成のためのケトレダクターゼ酵素 | |
| JP2025523626A (ja) | ベルズチファンの合成に有用なヒドロキシル化インダノン中間体を調製するための操作された酵素 | |
| KR20250052428A (ko) | 개선된 리파제 단백질을 코딩하는 핵산 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080051363.8 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10752833 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012528394 Country of ref document: JP Ref document number: 2267/CHENP/2012 Country of ref document: IN |
|
| REEP | Request for entry into the european phase |
Ref document number: 2010752833 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010752833 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13496086 Country of ref document: US |