WO2011020045A1 - Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels - Google Patents
Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels Download PDFInfo
- Publication number
- WO2011020045A1 WO2011020045A1 PCT/US2010/045509 US2010045509W WO2011020045A1 WO 2011020045 A1 WO2011020045 A1 WO 2011020045A1 US 2010045509 W US2010045509 W US 2010045509W WO 2011020045 A1 WO2011020045 A1 WO 2011020045A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- actriib
- gdf trap
- polypeptide
- seq
- red blood
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/179—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1816—Erythropoietin [EPO]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/15—Depsipeptides; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/11—Protein-serine/threonine kinases (2.7.11)
- C12Y207/1103—Receptor protein serine/threonine kinase (2.7.11.30)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- Red blood cell or erythrocyte
- the mature red blood cell, or erythrocyte is responsible for oxygen transport in the circulatory systems of vertebrates.
- Red blood cells contain high concentrations of hemoglobin, a protein that binds oxygen in the lungs at relatively high partial pressure of oxygen (PO 2 ) and delivers oxygen to areas of the body with a relatively low p ⁇ 2 .
- hemoglobin a protein that binds oxygen in the lungs at relatively high partial pressure of oxygen (PO 2 ) and delivers oxygen to areas of the body with a relatively low p ⁇ 2 .
- Mature red blood cells are produced from pluripotent hematopoietic stem cells in a process termed erythropoiesis. Postnatal erythropoiesis occurs primarily in the bone marrow and in the red pulp of the spleen. The coordinated action of various signaling pathways control the balance of cell proliferation, differentiation, survival and death. Under normal conditions, red blood cells are produced at a rate that maintains a constant red cell mass in the body, and production may increase or decrease in response to various stimuli, including increased or decreased oxygen tension or tissue demand. The process of erythropoiesis begins with the formation of lineage committed precursor cells and proceeds through a series of distinct precursor cell types.
- erythropoiesis occur as reticulocytes are released into the bloodstream and lose their mitochondria and ribosomes while assuming the morphology of mature red blood cell.
- An elevated level of reticulocytes, or an elevated reticulocyte: erythrocyte ratio, in the blood is indicative of increased red blood cell production rates.
- Erythropoietin is widely recognized as the most significant positive regulator of postnatal erythropoiesis in vertebrates. EPO regulates the compensatory erythropoietic response to reduced tissue oxygen tension (hypoxia) and low red blood cell levels or low hemoglobin levels. In humans, elevated EPO levels promote red blood cell formation by stimulating the generation of erythroid progenitors in the bone marrow and spleen. In the mouse, EPO enhances erythropoiesis primarily in the spleen.
- EPO Effects of EPO are mediated by a cell-surface receptor belonging to the cytokine receptor superfamily.
- the human EPO receptor gene encodes a 483 amino-acid
- EPO receptor transmembrane protein
- the active EPO receptor is thought to exist as a multimeric complex even in the absence of ligand (See U.S. Pat. No. 6,319,499).
- the cloned full-length EPO receptor expressed in mammalian cells binds EPO with an affinity similar to that of the native receptor on erythroid progenitor cells.
- Binding of EPO to its receptor causes a conformational change resulting in receptor activation and biological effects including increased proliferation of immature erythroblasts, increased differentiation of immature erythroblasts, and decreased apoptosis in erythroid progenitor cells (Liboi et al, 1993, Proc Natl Acad Sci USA 90:11351-11355; Koury et aL, 1990, Science 248:378-381).
- Anemia is a broadly-defined condition characterized by lower than normal levels of hemoglobin or red blood cells in the blood.
- anemia is caused by a primary disorder in the production or survival of red blood cells. More commonly, anemia is secondary to diseases of other systems (Weatherall & Provan (2000) Lancet 355, 1169-1175).
- Anemia may result from a reduced rate of production or increased rate of destruction of red blood cells or by loss of red blood cells due to bleeding.
- Anemia may result from a variety of disorders that include, for example, chronic renal failure, chemotherapy treatment, myelodysplastic syndrome, rheumatoid arthritis, and bone marrow transplantation.
- EPO Errorless blood cell
- Treatment with EPO typically causes a rise in hemoglobins by about 1-3 g/dL in healthy humans over a period of weeks. When administered to anemic individuals, this treatment regimen often provides substantial increases in hemoglobin and red blood cell levels and leads to improvements in quality of life and prolonged survival. EPO is not uniformly effective, and many individuals are refractory to even high doses (Horl et al.
- EPO-based therapeutic compounds erythropoietin-stimulating agents, ESAs
- ESAs erythropoietin-stimulating agents
- GDF Traps may be used in combination (e.g., administered at the same time or different times, but generally in such a manner as to achieve overlapping pharmacological effects) with EPO receptor activators to increase red blood cell levels (erythropoiesis) or treat anemia in patients in need thereof.
- a GDF Trap can be administered in combination with an EPO receptor activator to synergistically increase formation of red blood cells in a patient.
- the effect of this combined treatment can be significantly greater than the sum of the effects of the GDF Trap and the EPO receptor activator when administered separately at their respective doses.
- this synergism may be advantageous since it enables target levels of red blood cells to be attained with lower doses of an EPO receptor activator, thereby avoiding potential adverse effects or other problems associated with higher levels of EPO receptor activation.
- EPO receptor activator may stimulate erythropoiesis by directly contacting and activating EPO receptor.
- the EPO receptor activator is one of a class of compounds based on the 165 amino-acid sequence of native EPO and generally known as erythropoiesis-stimulating agents (ESAs), examples of which are epoetin alfa, epoetin beta, epoetin delta, and epoetin omega.
- ESAs erythropoiesis-stimulating agents
- ESAs include synthetic EPO proteins (SEPs) and EPO derivatives with nonpeptidic modifications conferring desirable pharmacokinetic properties (lengthened circulating half-life), examples of which are darbepoetin alfa and methoxy-polyethylene-glycol epoetin beta.
- an EPO receptor activator may be an EPO receptor agonist that does not incorporate the EPO polypeptide backbone or is not generally classified as an ESA.
- EPO receptor agonists may include, but are not limited to, peptidic and nonpeptidic mimetics of EPO, agonistic antibodies targeting EPO receptor, fusion proteins comprising an EPO mimetic domain, and erythropoietin receptor extended-duration limited agonists (EREDLA).
- EREDLA erythropoietin receptor extended-duration limited agonists
- an EPO receptor activator may stimulate erythropoiesis indirectly, without contacting EPO receptor itself, by enhancing production of endogenous EPO.
- hypoxia-inducible transcription factors HIFs
- HIFs hypoxia-inducible transcription factors
- the disclosure provides increased erythropoiesis in a patient by combined treatment with a GDF Trap and an indirect EPO receptor activator with HIF stabilizing properties, such as a prolyl hydroxylase inhibitor.
- GDF Traps e.g., activin A and/or activin B
- ActRIIB variants described herein are GDF Traps unless otherwise stated.
- the disclosure demonstrates that a GDF Trap which is a soluble form of ActRIIB polypeptide having an acidic residue at position 79 of SEQ ID NO: 1, when administered in vivo, increases red blood cell levels in the blood. Therefore, in certain embodiments, the disclosure provides methods for using GDF Traps to increase red blood cell and hemoglobin levels in patients and to treat disorders associated with low red blood cell or hemoglobin levels in patients in need thereof.
- GDF Traps can be used to increase muscle mass and decrease fat mass.
- the present disclosure provides GDF Traps that are variant ActRIIB polypeptides, including ActRIIB polypeptides having amino- and carboxy-terminal truncations and sequence alterations.
- GDF Traps of the invention may be designed to preferentially antagonize one or more ligands of ActRIIB receptors, such as GDF8 (also called myostatin), GDFl 1, Nodal, and BMP7 (also called OP-I).
- GDF Traps include a set of variants derived from ActRIIB that have greatly diminished affinity for activin. These variants exhibit desirable effects on red blood cells while reducing effects on other tissues.
- the GDF Trap polypeptide comprises an amino acid sequence that comprises, consists of, or consists essentially of, the amino acid sequence of SEQ ID NO: 7, 26, 28, 29, 32, 37 or 38, and polypeptides that are at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to any of the foregoing.
- the disclosure provides pharmaceutical preparations comprising a GDF Trap that binds to an ActRIIB ligand such as GDF8, GDFl 1, activin (e.g., activin B), BMP7 or nodal, and a pharmaceutically acceptable carrier.
- an ActRIIB ligand such as GDF8, GDFl 1, activin (e.g., activin B), BMP7 or nodal
- the GDF Trap binds to an ActRIIB ligand with a Kd less than 10 micromolar, less than 1 micromolar, less than 100 nanomolar, less than 10 nanomolar, or less than 1 nanomolar.
- the GDF Trap inhibits ActRIIB signaling, such as intracellular signal transduction events triggered by an ActRIIB ligand.
- a GDF Trap for use in such a preparation may be any of those disclosed herein, including, for example, GDF Traps having an amino acid sequence selected from SEQ ID NOs: 2, 3, 7, 11, 26, 28, 29, 32, 37, 38 or 40, or GDF Traps having an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97% or 99% identical to an amino acid sequence selected from SEQ ID NOs: 2, 3, 7, 11, 26, 28, 29, 32, 37, 38 or 40, or GDF Traps having an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97% or 99% identical to an amino acid sequence selected from SEQ ID NOs: 2, 3, 7, 11, 26, 28, 29, 32, 37, 38 or 40 wherein the position corresponding to L79 in SEQ ID NO: 1 is an acidic amino acid.
- a preferred GDF Trap for use in such a preparation consists of, or consists essentially of, the amino acid sequence of SEQ ID NO: 26.
- a GDF Trap may include a functional fragment of a natural ActRIIB polypeptide, such as one comprising at least 10, 20 or 30 amino acids of a sequence selected from SEQ ID NOs: 2, 3, 7, 11, 26, 28, 29, 32, 37, 38 or 40 or a sequence of SEQ ID NO: 2, lacking the C-terminal 1, 2, 3, 4, 5 or 10 to 15 amino acids and lacking 1, 2, 3, 4 or 5 amino acids at the N-terminus.
- a preferred polypeptide will comprise a truncation relative to SEQ ID NO: 2 or 40 of between 2 and 5 amino acids at the N-terminus and no more than 3 amino acids at the C-terminus.
- a GDF Trap may include one or more alterations in the amino acid sequence of an ActRIIB polypeptide (e.g., in the ligand-binding domain) relative to a naturally occurring ActRIIB polypeptide.
- the alteration in the amino acid sequence may, for example, alter glycosylation of the polypeptide when produced in a mammalian, insect or other eukaryotic cell or alter proteolytic cleavage of the polypeptide relative to the naturally occurring ActRIIB polypeptide.
- a GDF Trap may be a fusion protein that has, as one domain, an ActRIIB polypeptide
- a domain of a fusion protein may enhance one or more of in vivo stability, in vivo half life, uptake/administration, tissue localization or distribution, formation of protein complexes, multimerization of the fusion protein, and/or purification.
- GDF Trap fusion proteins may include an immunoglobulin Fc domain (wild-type or mutant) or a serum albumin.
- a GDF Trap fusion comprises a relatively unstructured linker positioned between the Fc domain and the extracellular ActRIIB domain.
- This unstructured linker may correspond to the roughly 15 amino acid unstructured region at the C-terminal end of the extracellular domain of ActRIIB (the "tail"), or it may be an artificial sequence of between 3 and 5, 15, 20, 30, 50 or more amino acids that are relatively free of secondary structure.
- a linker may be rich in glycine and proline residues and may, for example, contain repeating sequences of threonine/serine and glycines (e.g., TG 4 (SEQ ID NO: 13) or SG 4 (SEQ ID NO: 14) singlets or repeats) or a series of three glycines.
- a fusion protein may include a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
- a GDF Trap fusion comprises a leader sequence.
- the leader sequence may be a native ActRIIB leader sequence or a heterologous leader sequence.
- the leader sequence is a Tissue Plasminogen Activator (TPA) leader sequence.
- TPA Tissue Plasminogen Activator
- a GDF Trap fusion protein comprises an amino acid sequence as set forth in the formula A-B-C.
- the B portion is an N- and C-terminally truncated ActRIIB polypeptide consisting of the amino acid sequence corresponding to amino acids 25-131 of SEQ ID NO: 2 or 40.
- the A and C portions may be independently zero, one or more than one amino acids, and both A and C portions are heterologous to B.
- the A and/or C portions may be attached to the B portion via a linker sequence.
- a GDF Trap includes a variant ActRIIB polypeptide having one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, and an amino acid conjugated to an organic derivatizing agent.
- a pharmaceutical preparation may also include one or more additional compounds such as a compound that is used to treat an ActRIIB-associated disorder.
- a pharmaceutical preparation is substantially pyrogen free.
- a GDF Trap be expressed in a mammalian cell line that mediates suitably natural glycosylation of the GDF Trap so as to diminish the likelihood of an unfavorable immune response in a patient.
- Human and CHO cell lines have been used successfully, and it is expected that other common mammalian expression vectors will be useful.
- the disclosure provides packaged pharmaceuticals comprising a pharmaceutical preparation described herein and labeled for use in increasing red blood cell levels in a human.
- the disclosure provides GDF Traps which are soluble ActRIIB polypeptides comprising an altered ligand-binding (e.g., GDF8-binding) domain.
- GDF Traps with altered ligand-binding domains may comprise, for example, one or more mutations at amino acid residues such as E37, E39, R40, K55, R56, Y60, A64, K74, W78, L79, D80, F82 and FlOl of human ActRIIB (numbering is relative to SEQ ID NO: 1).
- the altered ligand-binding domain can have increased selectivity for a ligand such as
- GDF8/GDF11 relative to a wild-type ligand-binding domain of an ActRIIB receptor.
- these mutations are demonstrated herein to increase the selectivity of the altered ligand-binding domain for GDFl 1 (and therefore, presumably, GDF8) over activin: K74Y, K74F, K74I, L79D, L79E, and D80I .
- the following mutations have the reverse effect, increasing the ratio of activin binding over GDFl 1 : D54A, K55A, L79A and F82A.
- the overall (GDFl 1 and activin) binding activity can be increased by inclusion of the "tail" region or, presumably, an unstructured linker region, and also by use of a K74A mutation.
- a GDF Trap is an ActRIIB polypeptide comprising an L79D or L79E mutation, optionally in combination with additional amino acid substitutions, additions or deletions.
- a GDF Trap comprising an altered ligand-binding domain has a ratio of K d for activin binding to K d for GDF8 binding that is at least 2, 5, 10, or even 100 fold greater relative to the ratio for the wild-type ligand-binding domain.
- the GDF Trap comprising an altered ligand-binding domain has a ratio of IC50 for inhibiting activin to IC 50 for inhibiting GDF8/GDF11 that is at least 2, 5, 10, or even 100 fold greater relative to the wild-type ActRIIB ligand-binding domain.
- the GDF Trap comprising an altered ligand-binding domain inhibits GDF8/GDF11 with an IC 50 at least 2, 5, 10, or even 100 times less than the IC50 for inhibiting activin.
- These GDF Traps can be fusion proteins that include an immunoglobulin Fc domain (either wild-type or mutant).
- the subject soluble GDF Traps are antagonists (inhibitors) of GDF8 and/or GDFl 1.
- a GDF Trap fusion protein comprising a portion derived from the ActRIIB sequence of SEQ ID NO: 1 or 39 and a second polypeptide portion, wherein the portion derived from ActRIIB corresponds to a sequence beginning at any of amino acids 21-29 of SEQ ID NO: 1 or 39 (optionally beginning at 22-25 of SEQ ID NO: 1 or 39) and ending at any of amino acids 109-134 of SEQ ID NO: 1 or 39, and wherein the GDF Trap fusion protein inhibits signaling by activin, myostatin and/or GDFl 1 in a cell-based assay.
- the GDF Trap fusion protein above wherein the portion derived from ActRIIB corresponds to a sequence beginning at any of amino acids 20-29 of SEQ ID NO: 1 and ending at any of amino acids 128-133 of SEQ ID NO: 1 or 39.
- constructs beginning at 22-25 of SEQ ID NO: 1 or 39 have activity levels greater than proteins having the full extracellular domain of human ActRIIB.
- the GDF Trap fusion protein comprises, consists essentially of, or consists of, an amino acid sequence beginning at amino acid position 25 of SEQ ID NO: 1 or 39 and ending at amino acid position 131 of SEQ ID NO: 1 or 39.
- the GDF Trap polypeptide consists of, or consists essentially of, the amino acid sequence of SEQ ID NO: 7, 26, 28, 29, 32, 37 or 38.
- Any of the above GDF Trap fusion proteins may be produced as a homodimer.
- Any of the above GDF Trap fusion proteins may have a heterologous portion that comprises a constant region from an IgG heavy chain, such as an Fc domain.
- Any of the above GDF Trap fusion proteins may comprise an acidic amino acid at the position corresponding to position 79 of SEQ ID NO: 1, optionally in combination with one or more additional amino acid substitutions, deletions or insertions relative to SEQ ID NO: 1.
- GDF Trap proteins are contemplated, such as the following.
- a GDF Trap protein comprising an amino acid sequence that is at least 80% identical to the sequence of amino acids 29-109 of SEQ ID NO: 1 or 39, wherein the position corresponding to 64 of SEQ ID NO: 1 is an R or K, and wherein the GDF Trap protein inhibits signaling by activin, myostatin and/or GDFl 1 in a cell-based assay.
- the GDF Trap protein above, wherein at least one alteration with respect to the sequence of SEQ ID NO: 1 or 39 is positioned outside of the ligand binding pocket.
- the GDF Trap protein above wherein at least one alteration with respect to the sequence of SEQ ID NO: 1 or 39 is a conservative alteration positioned within the ligand binding pocket.
- the GDF Trap protein above, wherein at least one alteration with respect to the sequence of SEQ ID NO: 1 or 39 is an alteration at one or more positions selected from the group consisting of K74, R40, Q53, K55, F82 and L79.
- the GDF Trap protein above, wherein the protein comprises at least one N-X-S/T sequence at a position other than an endogenous N-X-S/T sequence of ActRIIB, and at a position outside of the ligand binding pocket.
- GDF Trap protein comprising an amino acid sequence that is at least 80% identical to the sequence of amino acids 29-109 of SEQ ID NO: 1 or 39, and wherein the protein comprises at least one N-X-S/T sequence at a position other than an endogenous N-X-S/T sequence of ActRIIB, and at a position outside of the ligand binding pocket.
- the GDF Trap above wherein the GDF Trap protein comprises an N at the position corresponding to position 24 of SEQ ID NO: 1 or 39 and an S or T at the position corresponding to position 26 of SEQ ID NO: 1 or 39, and wherein the GDF Trap inhibits signaling by activin, myostatin and/or GDFl 1 in a cell-based assay.
- the GDF Trap above wherein the ActRIIB protein comprises a D or E at the position corresponding to position 79 of SEQ ID NO: 1 or 39 and wherein the GDF Trap inhibits signaling by activin, myostatin and/or GDFl 1 in a cell-based assay.
- the GDF Trap above, wherein at least one alteration with respect to the sequence of SEQ ID NO: 1 or 39 is a conservative alteration positioned within the ligand binding pocket.
- the GDF Trap above, wherein at least one alteration with respect to the sequence of SEQ ID NO: 1 or 39 is an alteration at one or more positions selected from the group consisting of K74, R40, Q53, K55, F82 and L79.
- the GDF Trap above wherein the protein is a fusion protein further comprising a heterologous portion.
- Any of the above GDF Trap fusion proteins may be produced as a homodimer.
- Any of the above GDF Trap fusion proteins may have a heterologous portion that comprises a constant region from an IgG heavy chain, such as an Fc domain.
- an isolated polynucleotide may comprise a coding sequence for a soluble GDF Trap polypeptide, such as described above.
- an isolated nucleic acid may include a sequence coding for a GDF Trap comprising an extracellular domain (e.g., ligand- binding domain) of an ActRIIB polypeptide having one or more sequence variations and a sequence that would code for part or all of the transmembrane domain and/or the cytoplasmic domain of an ActRIIB polypeptide, but for a stop codon positioned within the transmembrane domain or the cytoplasmic domain, or positioned between the extracellular domain and the transmembrane domain or cytoplasmic domain.
- an isolated polynucleotide coding for a GDF Trap may comprise a full-length ActRIIB polynucleotide sequence such as SEQ ID NO: 4 having one or more variations, or a partially truncated version, said isolated polynucleotide further comprising a transcription termination codon at least six hundred nucleotides before the 3 '-terminus or otherwise positioned such that translation of the polynucleotide gives rise to an extracellular domain optionally fused to a truncated portion of a full-length ActRIIB.
- Nucleic acids disclosed herein may be operably linked to a promoter for expression, and the disclosure provides cells transformed with such recombinant polynucleotides.
- the cell is a mammalian cell such as a CHO cell.
- the disclosure provides methods for making a GDF Trap polypeptide.
- a method may include expressing any of the nucleic acids (e.g., SEQ ID NO: 5, 25, 27, 30 or 31) disclosed herein in a suitable cell, such as a Chinese hamster ovary (CHO) cell.
- a suitable cell such as a Chinese hamster ovary (CHO) cell.
- Such a method may comprise: a) culturing a cell under conditions suitable for expression of the GDF Trap polypeptide, wherein said cell is transformed with a GDF Trap expression construct; and b) recovering the GDF Trap polypeptide so expressed.
- GDF Trap polypeptides may be recovered as crude, partially purified or highly purified fractions using any of the well known techniques for obtaining protein from cell cultures.
- a GDF Trap polypeptide disclosed herein may be used in a method for promoting red blood cell production or increasing red blood cell levels in a subject.
- the disclosure provides methods for treating a disorder associated with low red blood cell counts or low hemoglobin levels (e.g., an anemia), or to promote red blood cell production, in patients in need thereof.
- a method may comprise administering to a subject in need thereof an effective amount of a GDF Trap polypeptide.
- the disclosure provides uses of GDF Trap polypeptides for making a medicament for the treatment of a disorder or condition as described herein.
- the disclosure provides methods for administering a GDF Trap polypeptide to a patient.
- GDF Trap polypeptides can be used to increase red blood cell and hemoglobin levels.
- GDF Trap polypeptides may also be used for treating or preventing other therapeutic uses such as promoting muscle growth.
- it may be desirable to monitor the effects on red blood cells during administration of the GDF Trap polypeptide, or to determine or adjust the dosing of the GDF Trap polypeptide, in order to reduce undesired effects on red blood cells. For example, increases in red blood cell levels, hemoglobin levels, or hematocrit levels may cause increases in blood pressure.
- Figure 1 shows an alignment of the extracellular domains of human ActRIIA (SEQ ID NO: 15) and human ActRIIB (SEQ ID NO: 2) with the residues that are deduced herein, based on composite analysis of multiple ActRIIB and ActRIIA crystal structures to directly contact ligand (the ligand binding pocket) indicated with boxes.
- Figure 2 shows a multiple sequence alignment of various vertebrate ActRIIB proteins and human ActRIIA (SEQ ID NOs: 16-23).
- Figure 3 shows the full amino acid sequence for the GDF Trap ActRIIB(L79D 20- 134)-hFc (SEQ ID NO : 11 ), including the TPA leader sequence (double underlined), ActRIIB extracellular domain (residues 20-134 in SEQ ID NO: 1; underlined), and hFc domain.
- the aspartate substituted at position 79 in the native sequence is double underlined and highlighted, as is the glycine revealed by sequencing to be the N-terminal residue in the mature fusion protein.
- Figure 4 shows a nucleotide sequence encoding ActRIIB(L79D 20-134)-hFc. SEQ ID NO: 1
- TPA leader (nucleotides 1-66) is double underlined, and the ActRIIB
- Figure 5 shows the full amino acid sequence for the truncated GDF Trap
- ActRIIB(L79D 25-13 l)-hFc SEQ ID NO: 26
- TPA leader double underlined
- truncated ActRIIB extracellular domain residues 25-131 in SEQ ID NO: 1; underlined
- hFc domain truncated ActRIIB extracellular domain.
- the aspartate substituted at position 79 in the native sequence is double underlined and highlighted, as is the glutamate revealed by sequencing to be the N- terminal residue in the mature fusion protein.
- Figure 6 shows a nucleotide sequence encoding ActRIIB(L79D 25-13 l)-hFc.
- SEQ ID NO: 27 corresponds to the sense strand
- SEQ ID NO: 34 corresponds to the antisense strand.
- the TPA leader (nucleotides 1-66) is double underlined, and the truncated ActRIIB extracellular domain (nucleotides 76-396) is underlined.
- the amino acid sequence for the ActRIIB extracellular domain (residues 25-131 in SEQ ID NO: 1) is also shown.
- Figure 7 shows the amino acid sequence for the truncated GDF Trap ActRIIB(L79D 25-13 l)-hFc without a leader (SEQ ID NO: 28).
- the truncated ActRIIB extracellular domain (residues 25-131 in SEQ ID NO: 1) is underlined.
- the aspartate substituted at position 79 in the native sequence is double underlined and highlighted, as is the glutamate revealed by sequencing to be the N-terminal residue in the mature fusion protein.
- Figure 8 shows the amino acid sequence for the truncated GDF Trap ActRIIB(L79D 25-131) without the leader, hFc domain, and linker (SEQ ID NO: 29).
- the aspartate substituted at position 79 in the native sequence is underlined and highlighted, as is the glutamate revealed by sequencing to be the N-terminal residue in the mature fusion protein.
- Figure 9 shows an alternative nucleotide sequence encoding ActRIIB(L79D 25-131)- hFc.
- SEQ ID NO: 30 corresponds to the sense strand
- SEQ ID NO: 35 corresponds to the antisense strand.
- the TPA leader (nucleotides 1-66) is double underlined
- the truncated ActRIIB extracellular domain (nucleotides 76-396) is underlined
- substitutions in the wildtype nucleotide sequence of the extracellular domain are double underlined and highlighted (compare with SEQ ID NO: 27, Figure 6).
- the amino acid sequence for the ActRIIB extracellular domain is also shown.
- FIG 10 shows nucleotides 76-396 (SEQ ID NO: 31) of the alternative nucleotide sequence shown in Figure 9 (SEQ ID NO: 30). The same nucleotide substitutions indicated in Figure 9 are also underlined and highlighted here.
- SEQ ID NO: 31 encodes only the truncated ActRIIB extracellular domain (corresponding to residues 25-131 in SEQ ID NO: 1) with a L79D substitution, e.g., ActRIIB(L79D 25-131).
- Figure 11 shows the effect of ActRIIB(L79D 25-13 l)-hFc on hemoglobin
- Figure 13 shows the effect of ActRIIB(L79D 25-13 l)-hFc on red blood cell (RBC), hemoglobin (HGB), and hematocrit (HCT) levels in a unilaterally nephrectomized (NEPHX) mouse model of chronic kidney disease. Data are mean changes from baseline over 4 weeks ( ⁇ SEM). *, P ⁇ 0.05; **, P ⁇ 0.01; ***, P ⁇ 0.001 vs. NEPHX controls. This GDF Trap prevented the nephrectomy-associated decline in these erythrocytic parameters, increasing each by a magnitude similar to that in kidney-intact (sham) mice .
- Figure 14 shows the effect of ActRIIB(L79D 25-13 l)-hFc on red blood cell (RBC) levels in a rat model of anemia induced by acute blood loss. Blood removal occurred on Day -1, with dosing on Days 0 and 3. Data are means ⁇ SEM. **, P ⁇ 0.01; ***, P ⁇ 0.001 vs. vehicle at same time point. This GDF Trap improved the rate and extent of recovery from blood- loss-induced anemia.
- Figure 15 shows the effect of treatment with ActRIIB(L79D 20-134)-hFc (gray) or ActRIIB(L79D 25-13 l)-hFc (black) on the absolute change in red blood cell concentration from baseline in cynomolgus monkey.
- VEH vehicle.
- Data are means + SEM.
- n 4-8 per group.
- Figure 16 shows the effect of treatment with ActRIIB(L79D 20- 134)-hFc (gray) or
- VEH vehicle.
- Data are means + SEM.
- n 4-8 per group.
- Figure 17 shows the effect of treatment with ActRIIB(L79D 20-134)-hFc (gray) or ActRIIB(L79D 25-13 l)-hFc (black) on the absolute change in hemoglobin concentration from baseline in cynomolgus monkey.
- VEH vehicle.
- Data are means + SEM.
- n 4-8 per group.
- Figure 18 shows the effect of treatment with ActRIIB(L79D 20-134)-hFc (gray) or ActRIIB(L79D 25-13 l)-hFc (black) on the absolute change in circulating reticulocyte concentration from baseline in cynomolgus monkey.
- VEH vehicle.
- Data are means + SEM.
- n 4-8 per group.
- Figure 19 shows the effect of combined treatment with erythropoietin (EPO) and ActRIIB(L79D 25-13 l)-hFc for 72 hours on hematocrit in mice.
- Combined treatment increased hematocrit by 23% compared to vehicle, a synergistic increase greater than the sum of the separate effects of EPO and ActRIIB(L79D 25-131)-hFc.
- Figure 20 shows the effect of combined treatment with EPO and ActRIIB(L79D 25- 13 l)-hFc for 72 hours on hemoglobin concentrations in mice.
- Combined treatment increased hemoglobin concentrations by 23% compared to vehicle, which was also a synergistic effect.
- Figure 21 shows the effect of combined treatment with EPO and ActRIIB(L79D 25- 13 l)-hFc for 72 hours on red blood cell concentrations in mice.
- Combined treatment increased red blood cell concentrations by 20% compared to vehicle, which was also a synergistic effect.
- EPO alone increased the number of basophilic erythroblasts (BasoE) dramatically at the expense of late-stage precursor maturation
- BasoE basophilic erythroblasts
- EPO is a glycoprotein hormone involved in the growth and maturation of erythroid progenitor cells into erythrocytes. EPO is produced by the liver during fetal life and by the kidney in adults. Decreased production of EPO, which commonly occurs in adults as a consequence of renal failure, leads to anemia. EPO has been produced by genetic
- EPO e.g., Eschbach et al. (1987, N Engl J Med 316:73) describe the use of EPO to correct anemia caused by chronic renal failure.
- EPO Effects of EPO are mediated through its binding to, and activation of, a cell surface receptor belonging to the cytokine receptor superfamily and designated the EPO receptor.
- the human and murine EPO receptors have been cloned and expressed (D'Andrea et al., 1989, Cell 57:277; Jones et al., 1990, Blood 76:31; Winkelman et al., 1990, Blood 76:24; WO 90/08822/U.S. Pat. No. 5,278,065).
- the human EPO receptor gene encodes a 483 amino acid transmembrane protein comprising an extracellular domain of approximately 224 amino acids and exhibits approximately 82% amino acid sequence identity with the murine EPO receptor (See U.S. Pat. No.
- this form is thought to contain the main EPO binding determinant and is referred to as the EPO receptor.
- the EPO receptor By analogy with other closely related cytokine receptors, the EPO receptor is thought to dimerize upon agonist binding. Nevertheless, the detailed structure of the EPO receptor, which may be a multimeric complex, and its specific mechanism of activation are not completely understood (U.S. Pat. No. 6,319,499).
- EPO receptor Activation of the EPO receptor results in several biological effects. These include increased proliferation of immature erythroblasts, increased differentiation of immature erythroblasts, and decreased apoptosis in erythroid progenitor cells (Liboi et al., 1993, Proc Natl Acad Sci USA 90:11351-11355; Koury et al., 1990, Science 248:378-381).
- the EPO receptor signal transduction pathways mediating proliferation and differentiation appear to be distinct (Noguchi et al., 1988, MoI Cell Biol 8:2604; Patel et al., 1992, J Biol Chem 1992, 267:21300; Liboi et al., ibid).
- EPO receptor activators include small-molecule erythropoiesis-stimulating agents (ESAs) as well as EPO-based compounds.
- ESAs small-molecule erythropoiesis-stimulating agents
- An example of the former is a dimeric peptide- based agonist covalently linked to polyethylene glycol (proprietary name Hematide), which has shown erythropoiesis-stimulating properties in healthy volunteers and in patients with both chronic kidney disease and endogenous anti-EPO antibodies (Stead et al., 2006, Blood 108:1830-1834; Macdougall et al., 2009, N Engl J Med 361 :1848-1855).
- Other examples include nonpeptide-based ESAs (Qureshi et al., 1999, Proc Natl Acad Sci USA 96: 12156- 12161).
- EPO receptor activators also include compounds that stimulate erythropoiesis indirectly, without contacting EPO receptor itself, by enhancing production of endogenous EPO.
- hypoxia-inducible transcription factors HIFs
- HIFs hypoxia-inducible transcription factors
- EPO receptor indirect activators of EPO receptor include inhibitors of GAT A-2 transcription factor (Nakano et al., 2004, Blood 104:4300-4307), which tonically inhibits EPO gene expression, and inhibitors of hemopoietic cell phosphatase (HCP or SHP-I), which functions as a negative regulator of EPO receptor signal transduction (Klingmuller et al., 1995, Cell 80:729- 738).
- GAT A-2 transcription factor Nakano et al., 2004, Blood 104:4300-4307
- HCP or SHP-I hemopoietic cell phosphatase
- TGF-beta The transforming growth factor-beta (TGF-beta) superfamily contains a variety of growth factors that share common sequence elements and structural motifs. These proteins are known to exert biological effects on a large variety of cell types in both vertebrates and invertebrates. Members of the superfamily perform important functions during embryonic development in pattern formation and tissue specification and can influence a variety of differentiation processes, including adipogenesis, myogenesis, chondrogenesis,
- the family is divided into two general branches: the BMP/GDF and the TGF-beta/Activin/BMP 10 branches, whose members have diverse, often complementary effects.
- the BMP/GDF and the TGF-beta/Activin/BMP 10 branches, whose members have diverse, often complementary effects.
- the Piedmontese and Belgian Blue cattle breeds carry a loss-of-function mutation in the GDF8 (also called myostatin) gene that causes a marked increase in muscle mass. Grobet et al., Nat Genet. 1997, 17(l):71-4.
- TGF- ⁇ signals are mediated by heteromeric complexes of type I and type II serine/threonine kinase receptors, which phosphorylate and activate downstream Smad proteins upon ligand stimulation (Massague, 2000, Nat. Rev. MoI. Cell Biol. 1 :169-178).
- type I and type II receptors are transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity.
- Type I receptors are essential for signaling.
- Type II receptors are required for binding ligands and for expression of Type I receptors.
- Type I and II activin receptors form a stable complex after ligand binding, resulting in phosphorylation of Type I receptors by Type II receptors.
- ActRII Two related Type II receptors (ActRII), ActRIIA and ActRIIB, have been identified as the Type II receptors for activins (Mathews and Vale, 1991, Cell 65:973-982; Attisano et al, 1992, Cell 68: 97-108).
- ActRIIA and ActRIIB can biochemically interact with several other TGF- ⁇ family proteins, including BMP7, Nodal, GDF8, and GDFl 1 (Yamashita et al., 1995, J. Cell Biol. 130:217-226; Lee and McPherron, 2001, Proc. Natl. Acad. Sci. 98:9306-9311; Yeo and Whitman, 2001, MoI. Cell 7: 949-957; Oh et al.,
- ALK4 is the primary type I receptor for activins, particularly for activin A, and ALK-7 may serve as a receptor for activins as well, particularly for activin B.
- the present invention relates to antagonizing a ligand of ActRIIB receptors (also referred to as an ActRIIB ligand) with a subject GDF Trap polypeptide.
- exemplary ligands of ActRIIB receptors include some TGF- ⁇ family members, such as activin, Nodal, GDF8, GDFl 1, and BMP7.
- Activins are dimeric polypeptide growth factors that belong to the TGF -beta superfamily. There are three principal activin forms (A, B, and AB) that are
- activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos (DePaolo et al., 1991, Proc Soc Ep Biol Med. 198:500-512; Dyson et al., 1997, Curr Biol.
- erythroid differentiation factor isolated from the stimulated human monocytic leukemic cells was found to be identical to activin A (Murata et al., 1988, PNAS, 85:2434). It has been suggested that activin A promotes erythropoiesis in the bone marrow. In several tissues, activin signaling is antagonized by its related heterodimer, inhibin. For example, during the release of follicle-stimulating hormone (FSH) from the pituitary, activin promotes FSH secretion and synthesis, while inhibin prevents FSH secretion and synthesis.
- FSH follicle-stimulating hormone
- Other proteins that may regulate activin bioactivity and/or bind to activin include follistatin (FS), follistatin-related protein (FSRP) and ⁇ 2-macroglobulin.
- Nodal proteins have functions in mesoderm and endoderm induction and formation, as well as subsequent organization of axial structures such as heart and stomach in early embryogenesis. It has been demonstrated that dorsal tissue in a developing vertebrate embryo contributes predominantly to the axial structures of the notochord and pre-chordal plate while it recruits surrounding cells to form non-axial embryonic structures. Nodal appears to signal through both type I and type II receptors and intracellular effectors known as Smad proteins. Recent studies support the idea that ActRIIA and ActRIIB serve as type II receptors for Nodal (Sakuma et al., Genes Cells. 2002, 7:401-12).
- Nodal ligands interact with their co-factors (e.g., cripto) to activate activin type I and type II receptors, which phosphorylate Smad2.
- Nodal proteins are implicated in many events critical to the early vertebrate embryo, including mesoderm formation, anterior patterning, and left- right axis specification. Experimental evidence has demonstrated that Nodal signaling activates pAR3-Lux, a luciferase reporter previously shown to respond specifically to activin and TGF-beta. However, Nodal is unable to induce pTlx2-Lux, a reporter specifically responsive to bone morphogenetic proteins.
- GDF8 Growth and Differentiation Factor-8
- GDF8 is a negative regulator of skeletal muscle mass. GDF8 is highly expressed in the developing and adult skeletal muscle. The GDF8 null mutation in transgenic mice is characterized by a marked hypertrophy and hyperplasia of the skeletal muscle (McPherron et al., Nature, 1997, 387:83-90). Similar increases in skeletal muscle mass are evident in naturally occurring mutations of GDF8 in cattle (Ashmore et al., 1974, Growth, 38:501-507; Swatland and Kieffer, J. Anim. ScL, 1994, 38:752-757; McPherron and Lee, Proc. Natl. Acad. Sci.
- GDF8 can modulate the production of muscle-specific enzymes (e.g., creatine kinase) and modulate myoblast cell proliferation (WO 00/43781).
- the GDF8 propeptide can be modulate the production of muscle-specific enzymes (e.g., creatine kinase) and modulate myoblast cell proliferation (WO 00/43781).
- the GDF8 propeptide can be modulate the production of muscle-specific enzymes (e.g., creatine kinase) and modulate myoblast cell proliferation (WO 00/43781).
- GDFl 1 Growth and Differentiation Factor- 11 (GDFl 1), also known as BMPl 1, is a secreted protein (McPherron et al., 1999, Nat. Genet. 22: 260-264). GDFl 1 is expressed in the tail bud, limb bud, maxillary and mandibular arches, and dorsal root ganglia during mouse development (Nakashima et al., 1999, Mech. Dev. 80: 185-189). GDFl 1 plays a unique role in patterning both mesodermal and neural tissues (Gamer et al., 1999, Dev Biol., 208:222- 32).
- GDFl 1 was shown to be a negative regulator of chondrogenesis and myogenesis in developing chick limb (Gamer et al., 2001, Dev Biol. 229:407-20). The expression of GDFl 1 in muscle also suggests its role in regulating muscle growth in a similar way to
- GDF8 the expression of GDFl 1 in brain suggests that GDFl 1 may also possess activities that relate to the function of the nervous system.
- GDFl 1 was found to inhibit neurogenesis in the olfactory epithelium (Wu et al., 2003, Neuron. 37:197-207).
- GDFl 1 may have in vitro and in vivo applications in the treatment of diseases such as muscle diseases and neurodegenerative diseases (e.g., amyotrophic lateral sclerosis).
- Bone morphogenetic protein also called osteogenic protein- 1 (OP-I)
- BMP7 also called osteogenic protein- 1 (OP-I)
- BMP7 regulates a wide array of physiological processes.
- BMP7 may be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. It is also found that BMP7 plays a role in calcium regulation and bone homeostasis.
- BMP7 binds to Type II receptors, ActRIIA and ActRIIB.
- BMP7 and activin recruit distinct Type I receptors into heteromeric receptor complexes.
- the major BMP7 Type I receptor observed was ALK2, while activin bound exclusively to ALK4 (ActRIIB).
- BMP7 and activin elicited distinct biological responses and activated different Smad pathways (Macias-Silva et al., 1998, J Biol Chem. 273:25628-36).
- a GDF Trap polypeptide which is a variant ActRIIB polypeptide (ActRIIB) is more effective at increasing red blood cell levels in vivo as compared to a wild-type soluble ActRIIB polypeptide and has beneficial effects in a variety of models for anemias. Additionally, it is shown that the use of a GDF Trap polypeptide in combination with an EPO receptor activator causes a substantial increase in red blood cell formation. It should be noted that hematopoiesis is a complex process, regulated by a variety of factors, including erythropoietin, G-CSF and iron homeostasis. The terms "increase red blood cell levels” and "promote red blood cell formation” refer to clinically observable metrics, such as hematocrit, red blood cell counts and hemoglobin measurements, and are intended to be neutral as to the mechanism by which such changes occur.
- GDF Trap polypeptides are useful for a variety of therapeutic applications, including, for example, promoting muscle growth (see PCT Publication Nos. WO 2006/012627 and WO 2008/097541, which are hereby
- GDF Trap polypeptide when administering a GDF Trap polypeptide for the purpose of increasing muscle, it may be desirable to reduce or minimize effects on red blood cells.
- a GDF Trap polypeptide when administering a GDF Trap polypeptide for the purpose of increasing muscle, it may be desirable to reduce or minimize effects on red blood cells.
- appropriate dosing including amounts and frequency of administration
- appropriate dosing may be determined based on an individual patient's needs, baseline hematologic parameters, and purpose for treatment. Furthermore, therapeutic progress and effects on one or more hematologic parameters over time may be useful in managing patients being dosed with a GDF Trap polypeptide by facilitating patient care, determining appropriate maintenance dosing (both amounts and frequency), etc.
- “approximately” may mean values that are within an order of magnitude, preferably within 5- fold and more preferably within 2-fold of a given value. Numerical quantities given herein are approximate unless stated otherwise, meaning that the term “about” or “approximately” can be inferred when not expressly stated.
- the methods of the invention may include steps of comparing sequences to each other, including wild-type sequence to one or more mutants (sequence variants).
- Such comparisons typically comprise alignments of polymer sequences, e.g., using sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
- the invention relates to GDF Trap polypeptides, e.g., soluble variant ActRIIB polypeptides, including, for example, fragments, functional variants, and modified forms of ActRIIB polypeptides.
- GDF Trap polypeptides e.g., soluble variant ActRIIB polypeptides, including, for example, fragments, functional variants, and modified forms of ActRIIB polypeptides.
- the GDF Trap polypeptides e.g., soluble variant ActRIIB polypeptides, including, for example, fragments, functional variants, and modified forms of ActRIIB polypeptides.
- the GDF Trap e.g., soluble variant ActRIIB polypeptides, including, for example, fragments, functional variants, and modified forms of ActRIIB polypeptides.
- polypeptides have at least one similar or same biological activity as a corresponding wild- type ActRIIB polypeptide.
- a GDF Trap polypeptide of the invention may bind to and inhibit the function of an ActRIIB ligand (e.g., activin A, activin AB, activin B, Nodal, GDF8, GDFl 1 or BMP7).
- an ActRIIB ligand e.g., activin A, activin AB, activin B, Nodal, GDF8, GDFl 1 or BMP7.
- a GDF Trap polypeptide increases red blood cell levels.
- GDF Trap polypeptides examples include human ActRIIB precursor polypeptides (SEQ ID NO: 1 or 39) having one or more sequence variations, and soluble human ActRIIB polypeptides (e.g., SEQ ID NOs: 2, 3, 7, 11, 26, 28, 29, 32, 37, 38, 40 and 41) having one or more sequence variations.
- a GDF Trap refers to an ActRIIB polypeptide having a decreased affinity for activin relative to other ActRIIB ligands, including for example GDFl 1 and/or myostatin.
- ActRIIB refers to a family of activin receptor type lib
- ActRIIB proteins from any species and variants derived from such ActRIIB proteins by mutagenesis or other modification.
- Reference to ActRIIB herein is understood to be a reference to any one of the currently identified forms.
- Members of the ActRIIB family are generally transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
- Amino acid sequences of human ActRIIA soluble extracellular domain (provided for comparison) and ActRIIB soluble extracellular domain are illustrated in Figure 1.
- ActRIIB polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRIIB family member as well as any variants thereof
- ActRIIB polypeptides include polypeptides derived from the sequence of any known ActRIIB having a sequence at least about 80% identical to the sequence of an ActRIIB polypeptide, and optionally at least 85%, 90%, 95%, 97%, 99% or greater identity.
- an ActRIIB polypeptide may bind to and inhibit the function of an ActRIIB protein and/or activin.
- An ActRIIB polypeptide which is a GDF Trap may be selected for activity in promoting red blood cell formation in vivo.
- ActRIIB polypeptides examples include human ActRIIB precursor polypeptide (SEQ ID NO: 1 and 39) and soluble human ActRIIB polypeptides (e.g., SEQ ID NO: 2, 3, 7, 11, 26, 28, 29, 32, 37, 38, 40 and 41). Numbering of amino acids for all ActRIIB-related polypeptides described herein is based on the numbering for SEQ ID NO:1, unless specifically designated otherwise.
- the human ActRIIB precursor protein sequence is as follows:
- the signal peptide is single underlined; the extracellular domain is in bold and the potential N-linked glycosylation sites are in boxes.
- DCLVSLVTSVTNVDLPPKESSI (SEQIDNO: 39)
- the human ActRIIB soluble (extracellular), processed polypeptide sequence is as follows:
- the protein may be produced with an "SGR" sequence at the N- terminus.
- the C-terminal "tail” of the extracellular domain is underlined.
- the sequence with the "tail” deleted is as follows:
- the protein may be produced with an "SGR" sequence at the N- terminus.
- the nucleic acid sequence encoding a human ActRIIB precursor protein is as follows: (nucleotides 5-1543 of Genbank entry NM OOl 106)(the sequence as shown provides an alanine at position 64, and may be modified to provide an arginine instead)
- the invention relates to GDF Trap polypeptides which are variant forms of soluble ActRIIB polypeptides.
- soluble ActRIIB polypeptides As described herein, the term "soluble
- ActRIIB polypeptide generally refers to polypeptides comprising an extracellular domain of an ActRIIB protein.
- soluble ActRIIB polypeptide includes any naturally occurring extracellular domain of an ActRIIB protein as well as any variants thereof (including mutants, fragments and peptidomimetic forms) that retain a useful activity.
- the extracellular domain of an ActRIIB protein binds to a ligand and is generally soluble.
- Examples of soluble ActRIIB polypeptides include ActRIIB soluble polypeptides (e.g., SEQ ID NOs: 22, 3, 7, 11, 26, 28, 29, 32, 37, 38, 40 and 41).
- soluble ActRIIB polypeptides comprise a signal sequence in addition to the extracellular domain of an ActRIIB protein, see Example 1.
- the signal sequence can be a native signal sequence of an ActRIIB, or a signal sequence from another protein, such as a tissue plasminogen activator (TPA) signal sequence or a honey bee melittin (HBM) signal sequence.
- TPA tissue plasminogen activator
- HBM honey bee melittin
- the disclosure identifies functionally active portions and variants of ActRIIB.
- an Fc fusion protein having the sequence disclosed by Hilden et al. (Blood. 1994 Apr 15;83(8):2163-70), which has an Alanine at the position corresponding to amino acid 64 of SEQ ID NO: 1 (A64), has a relatively low affinity for activin and GDF-11.
- the same Fc fusion protein with an Arginine at position 64 (R64) has an affinity for activin and GDF-11 in the low nanomolar to high picomolar range. Therefore, a sequence with an R64 is used as the wild-type reference sequence for human ActRIIB in this disclosure.
- Attisano et al. (Cell. 1992 Jan 10;68(l):97-108) showed that a deletion of the proline knot at the C-terminus of the extracellular domain of ActRIIB reduced the affinity of the receptor for activin.
- an ActRIIB(20-129)-Fc protein retains similar but somewhat reduced activity relative to the wild type, even though the proline knot region is disrupted.
- ActRIIB extracellular domains that stop at amino acid 134, 133, 132, 131, 130 and 129 are all expected to be active, but constructs stopping at 134 or 133 may be most active.
- mutations at any of residues 129-134 are not expected to alter ligand binding affinity by large margins. In support of this, mutations of P129 and P130 do not substantially decrease ligand binding. Therefore, a GDF Trap polypeptide which is an
- ActRIIB-Fc fusion protein may end as early as amino acid 109 (the final cysteine), however, forms ending at or between 109 and 119 are expected to have reduced ligand binding. Amino acid 119 is poorly conserved and so is readily altered or truncated. Forms ending at 128 or later retain ligand binding activity. Forms ending at or between 119 and 127 will have an intermediate binding ability. Any of these forms may be desirable to use, depending on the clinical or experimental setting.
- constructs beginning at position 20, 21, 22, 23 and 24 will retain activity, and constructs beginning at positions 25, 26, 27, 28 and 29 are also expected to retain activity.
- Data shown in the Examples demonstrates that, surprisingly, a construct beginning at 22, 23, 24 or 25 will have the most activity.
- an active portion of ActRIIB comprises amino acids 29-109 of SEQ ID NO: 1
- GDF Trap constructs may, for example, comprise a portion of ActRIIB beginning at a residue corresponding to amino acids 20-29 of SEQ ID NO: 1 or 39 and ending at a position corresponding to amino acids 109-134 of SEQ ID NO: 1 or 39.
- Other examples include constructs that begin at a position from 20-29 or 21-29 and end at a position from 119-134, 119-133, 129-134, or 129-133 of SEQ ID NO: 1 or 39.
- constructs that begin at a position from 20-24 (or 21-24, or 22-25) and end at a position from 109-134 (or 109-133), 119-134 (or 119-133) or 129-134 (or 129-133) of SEQ ID NO: 1 or 39. Variants within these ranges are also contemplated, particularly those having at least 80%, 85%, 90%, 95% or 99% identity to the corresponding portion of SEQ ID NO: 1 or 39.
- the GDF Trap polypeptide comprises, consists essentially of, or consists of, a polypeptide having an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to amino acid residues 25- 131 of SEQ ID NO: 1 or 39.
- the GDF Trap polypeptide comprises, consists essentially of, or consists of, a polypeptide having an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to SEQ ID NOs: 7, 26, 28, 29, 32, 37 or 38.
- the GDF Trap polypeptide consists of, or consists essentially of, the amino acid sequence of SEQ ID NO: 7, 26, 28, 29, 32, 37 or 38.
- the disclosure includes the results of an analysis of composite ActRIIB structures, shown in Figure 1 , demonstrating that the ligand binding pocket is defined by residues Y31 , N33, N35, L38 through T41, E47, E50, Q53 through K55, L57, H58, Y60, S62, K74, W78 through N83, Y85, R87, A92, and E94 through FlOl .
- the ligand binding pocket is defined by residues Y31 , N33, N35, L38 through T41, E47, E50, Q53 through K55, L57, H58, Y60, S62, K74, W78 through N83, Y85, R87, A92, and E94 through FlOl .
- R40A, K55A, F82A and mutations at position L79 are conservative mutations at position L79.
- R40 is a K in Xenopus, indicating that basic amino acids at this position will be tolerated.
- a general formula for a GDF Trap protein is one that comprises amino acids 29-109 of SEQ ID NO: 1 or 39, but optionally beginning at a position ranging from 20- 24 or 22-25 and ending at a position ranging from 129-134, and comprising no more than 1, 2, 5, 10 or 15 conservative amino acid changes in the ligand binding pocket, and zero, one or more non-conservative alterations at positions 40, 53, 55, 74, 79 and/or 82 in the ligand binding pocket.
- Such a protein may retain greater than 80%, 90%, 95% or 99% sequence identity to the sequence of amino acids 29-109 of SEQ ID NO: 1 or 39.
- Sites outside the binding pocket, at which variability may be particularly well tolerated include the amino and carboxy termini of the extracellular domain (as noted above), and positions 42-46 and 65-73.
- An asparagine to alanine alteration at position 65 (N65 A) actually improves ligand binding in the A64 background, and is thus expected to have no detrimental effect on ligand binding in the R64 background. This change probably eliminates glycosylation at N65 in the A64 background, thus demonstrating that a significant change in this region is likely to be tolerated. While an R64A change is poorly tolerated, R64K is well-tolerated, and thus another basic residue, such as H may be tolerated at position 64.
- an active, human ActRIIB variant polypeptide useful as a GDF Trap may include one or more amino acids at corresponding positions from the sequence of another vertebrate ActRIIB, or may include a residue that is similar to that in the human or other vertebrate sequence. The following examples illustrate this approach to defining an active ActRIIB variant.
- L46 is a valine in Xenopus ActRIIB, and so this position may be altered, and optionally may be altered to another hydrophobic residue, such as V, I or F, or a non-polar residue such as A.
- E52 is a K in Xenopus, indicating that this site may be tolerant of a wide variety of changes, including polar residues, such as E, D, K, R, H, S, T, P, G, Y and probably A.
- T93 is a K in Xenopus, indicating that a wide structural variation is tolerated at this position, with polar residues favored, such as S, K, R, E, D, H, G, P, G and Y.
- F 108 is a Y in Xenopus, and therefore Y or other hydrophobic group, such as I, V or L should be tolerated.
- El I l is K in Xenopus, indicating that charged residues will be tolerated at this position, including D, R, K and H, as well as Q and N.
- Rl 12 is K in Xenopus, indicating that basic residues are tolerated at this position, including R and H.
- a at position 119 is relatively poorly conserved, and appears as P in rodents and V in Xenopus, thus essentially any amino acid should be tolerated at this position.
- N-X-S/T N-linked glycosylation site
- NXT sequence By introducing an asparagine at position 24 (A24N construct), an NXT sequence is created that confers a longer half- life.
- Other NX(T/S) sequences are found at 42-44 (NQS) and 65-67 (NSS), although the latter may not be efficiently glycosylated with the R at position 64.
- N-X-S/T sequences may be generally introduced at positions outside the ligand binding pocket defined in Figure 1. Particularly suitable sites for the introduction of non-endogenous N-X-S/T sequences include amino acids 20-29, 20-24, 22-25, 109-134, 120- 134 or 129-134.
- N-X-S/T sequences may also be introduced into the linker between the ActRIIB sequence and the Fc or other fusion component.
- Such a site may be introduced with minimal effort by introducing an N in the correct position with respect to a pre-existing S or T, or by introducing an S or T at a position corresponding to a pre-existing N.
- desirable alterations that would create an N-linked glycosylation site are: A24N, R64N, S67N (possibly combined with an N65A alteration), E106N, Rl 12N, G120N, E123N, P129N,
- a GDF Trap may be an ActRIIB variant having one or more additional, non-endogenous N-linked glycosylation consensus sequences.
- Position L79 of ActRIIB may be altered to confer altered activin - myostatin (GDF- 11) binding properties.
- L79A or L79P reduces GDF-11 binding to a greater extent than activin binding.
- L79E or L79D retains GDF-11 binding.
- the L79E and L79D variants have greatly reduced activin binding.
- In vivo experiments indicate that these non- activin receptors retain significant ability to increase red blood cells but show decreased effects on other tissues.
- the methods described herein utilize a GDF Trap polypeptide which is a variant ActRIIB polypeptide comprising an acidic amino acid (e.g., D or E) at the position corresponding to position 79 of SEQ ID NO: 1 or 39, optionally in combination with one or more additional amino acid substitutions, additions, or deletions.
- an acidic amino acid e.g., D or E
- the results of the mutagenesis program described herein indicate that there are amino acid positions in ActRIIB that are often beneficial to conserve. These include position 64 (basic amino acid), position 80 (acidic or hydrophobic amino acid), position 78 (hydrophobic, and particularly tryptophan), position 37 (acidic, and particularly aspartic or glutamic acid), position 56 (basic amino acid), position 60 (hydrophobic amino acid, particularly phenylalanine or tyrosine).
- the disclosure provides a framework of amino acids that may be conserved.
- Other positions that may be desirable to conserve are as follows: position 52 (acidic amino acid), position 55 (basic amino acid), position 81 (acidic), 98 (polar or charged, particularly E, D, R or K).
- isolated fragments of ActRIIB polypeptides can be obtained by screening polypeptides recombinantly produced from the corresponding fragment of the nucleic acid encoding an ActRIIB polypeptide (e.g., SEQ ID NOs: 4 and 5).
- fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry. The fragments can be produced (recombinantly or by chemical synthesis) and tested to identify those peptidyl fragments that can function, for example, as antagonists (inhibitors) or agonists (activators) of an ActRIIB protein or an ActRIIB ligand.
- GDF Trap polypeptide is a variant ActRIIB polypeptide having an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NOs: 2, 3, 7, 11, 26, 28, 29, 32, 37, 38, 40 or 41.
- the GDF Trap has an amino acid sequence at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 2, 3, 7, 11, 26, 28, 29, 32, 37, 38, 40 or 41.
- the GDF Trap comprises, consists essentially of, or consists of, an amino acid sequence at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 2, 3, 7, 11, 26, 28, 29, 32, 37, 38, 40 or 41, wherein the position corresponding to L79 of SEQ ID NO: 1 is an acidic amino acid (e.g., a D or E amino acid residue).
- the present invention contemplates making functional variants by modifying the structure of a GDF Trap polypeptide for such purposes as enhancing therapeutic efficacy, or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo).
- GDF Trap polypeptides can also be produced by amino acid substitution, deletion, or addition. For instance, it is reasonable to expect that an isolated replacement of a leucine with an isoleucine or valine, an aspartate with a glutamate, a threonine with a serine, or a similar replacement of an amino acid with a structurally related amino acid (e.g., conservative mutations) will not have a major effect on the biological activity of the resulting molecule.
- Conservative replacements are those that take place within a family of amino acids that are related in their side chains. Whether a change in the amino acid sequence of a GDF Trap polypeptide results in a functional variant can be readily determined by assessing the ability of the GDF Trap polypeptide to produce a response in cells relative to the unmodified GDF Trap polypeptide or a wild-type ActRIIB polypeptide, or to bind to one or more ligands, such as activin, GDF-11 or myostatin as compared to the unmodified GDF Trap polypeptide or a wild-type ActRIIB polypeptide.
- ligands such as activin, GDF-11 or myostatin
- the present invention contemplates making mutations in the extracellular domain (also referred to as ligand-binding domain) of an ActRIIB polypeptide such that the ActRIIB polypeptide has altered ligand-binding activities (e.g., binding affinity or binding specificity).
- ligand-binding activities e.g., binding affinity or binding specificity.
- GDF Trap polypeptides have altered (elevated or reduced) binding affinity for a specific ligand.
- the GDF Trap polypeptides have altered binding specificity for ActRIIB ligands.
- the disclosure provides GDF Trap polypeptides that preferentially bind to GDF8/GDF11 relative to activins.
- the disclosure further establishes the desirability of such polypeptides for reducing off-target effects, although such selective variants may be less desirable for the treatment of severe diseases where very large gains in red blood cell levels may be needed for therapeutic effect and where some level of off-target effect is acceptable.
- amino acid residues of the ActRIIB protein such as E39, K55, Y60, K74, W78, D80, and FlOl, are in the ligand-binding pocket and mediate binding to its ligands such as activin and GDF8.
- the present invention provides a GDF Trap comprising an altered ligand-binding domain (e.g., GDF8-binding domain) of an ActRIIB receptor, which comprises one or more mutations at those amino acid residues.
- the altered ligand-binding domain can have increased selectivity for a ligand such as GDF8 relative to a wild-type ligand-binding domain of an ActRIIB receptor.
- these mutations increase the selectivity of the altered ligand-binding domain for GDF8 over activin.
- the altered ligand-binding domain has a ratio of Kj for activin binding to IQ for GDF8 binding that is at least 2, 5, 10, or even 100 fold greater relative to the ratio for the wild-type ligand-binding domain.
- the altered ligand-binding domain has a ratio of IC50 for inhibiting activin to IC50 for inhibiting GDF8 that is at least 2, 5, 10, or even 100 fold greater relative to the wild-type ligand-binding domain.
- the altered ligand- binding domain inhibits GDF8 with an IC 50 at least 2, 5, 10, or even 100 times less than the IC50 for inhibiting activin.
- the positively-charged amino acid residue Asp (D80) of the ligand-binding domain of ActRIIB can be mutated to a different amino acid residue to produce a GDF Trap polypeptide that preferentially binds to GDF8, but not activin.
- the D80 residue is changed to an amino acid residue selected from the group consisting of: an uncharged amino acid residue, a negative amino acid residue, and a hydrophobic amino acid residue.
- the hydrophobic residue, L79 can be altered to the acidic amino acids aspartic acid or glutamic acid to greatly reduce activin binding while retaining GDFl 1 binding.
- most of the described mutations, variants or modifications may be made at the nucleic acid level or, in some cases, by post translational modification or chemical synthesis. Such techniques are well known in the art.
- the present invention contemplates GDF Trap polypeptides having specific mutations in ActRIIB so as to alter the glycosylation of the ActRIIB polypeptide.
- Exemplary glycosylation sites in GDF Trap polypeptides are illustrated in Figure 1 (e.g., the underlined NX(S/T) sites).
- Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N-linked glycosylation sites.
- Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the wild-type ActRIIB polypeptide (for O-linked glycosylation sites).
- a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
- Another means of increasing the number of carbohydrate moieties on a GDF Trap polypeptide is by chemical or enzymatic coupling of glycosides to the GDF Trap polypeptide.
- the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine.
- arginine and histidine free carboxyl groups
- free sulfhydryl groups such as those of cysteine
- free hydroxyl groups such as those of serine, threonine, or hydroxyproline
- aromatic residues such as those of phenylalanine, tyrosine, or tryptophan
- the amide group of glutamine are described in WO 87/05330 and in Aplin and Wriston (1981) CRC Crit. Rev. Biochem., pp. 259-306, incorporated by reference
- Enzymatic cleavage of carbohydrate moieties on GDF Trap polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al. (1987) Meth. Enzymol. 138:350.
- GDF Trap polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
- GDF Trap polypeptides for use in humans will be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines are expected to be useful as well.
- This disclosure further contemplates a method of generating variants, particularly sets of combinatorial variants of a GDF Trap polypeptide, including, optionally, truncation variants; pools of combinatorial mutants are especially useful for identifying GDF Trap sequences.
- the purpose of screening such combinatorial libraries may be to generate, for example, GDF Trap polypeptide variants which have altered properties, such as altered pharmacokinetics, or altered ligand binding.
- a variety of screening assays are provided below, and such assays may be used to evaluate variants.
- a GDF Trap polypeptide variant may be screened for the ability to bind to an ActRIIB polypeptide, to prevent binding of an ActRIIB ligand to an ActRIIB polypeptide or to interfere with signaling caused by an ActRIIB ligand.
- the activity of a GDF Trap polypeptide or its variants may also be tested in a cell- based or in vivo assay.
- the effect of a GDF Trap polypeptide variant on the expression of genes involved in hematopoiesis may be assessed. This may, as needed, be performed in the presence of one or more recombinant ActRIIB ligand proteins (e.g., activin), and cells may be transfected so as to produce a GDF Trap polypeptide and/or variants thereof, and optionally, an ActRIIB ligand.
- ActRIIB ligand proteins e.g., activin
- a GDF Trap polypeptide may be administered to a mouse or other animal, and one or more blood measurements, such as an RBC count, hemoglobin levels, hematocrit levels, iron stores, or reticulocyte count may be assessed using art recognized methods.
- Combinatorially-derived variants can be generated which have a selective potency relative to a reference GDF Trap polypeptide.
- Such variant proteins when expressed from recombinant DNA constructs, can be used in gene therapy protocols.
- mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding unmodified GDF Trap polypeptide.
- the altered protein can be rendered either more stable or less stable to proteolytic degradation or other processes which result in destruction of, or otherwise inactivation of an unmodified GDF Trap polypeptide.
- Such variants, and the genes which encode them can be utilized to alter GDF Trap polypeptide levels by modulating the half- life of the GDF Trap polypeptides.
- a short half- life can give rise to more transient biological effects and, when part of an inducible expression system, can allow tighter control of recombinant GDF Trap polypeptide levels within the cell.
- mutations may be made in the linker (if any) and/or the Fc portion to alter the half- life of the protein.
- the GDF Trap polypeptides of the invention may further comprise post-translational modifications in addition to any that are naturally present in the ActRIIB polypeptides. Such modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
- GDF Trap polypeptides may contain non-amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharide, and phosphates. Effects of such non-amino acid elements on the functionality of a GDF Trap polypeptide may be tested as described herein for other GDF Trap polypeptide variants.
- GDF Trap polypeptide When a GDF Trap polypeptide is produced in cells by cleaving a nascent form of the GDF Trap polypeptide, post-translational processing may also be important for correct folding and/or function of the protein.
- Different cells such as CHO, HeLa, MDCK, 293, WI38, NIH-3T3 or HEK293 have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the GDF Trap polypeptides.
- GDF Trap polypeptides include fusion proteins having at least a portion of an ActRIIB polypeptide and one or more fusion domains.
- fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy chain constant region (e.g., an Fc), maltose binding protein (MBP), or human serum albumin.
- a fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity
- fusion domain may be selected so as to facilitate detection of the GDF Trap polypeptides.
- detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
- the fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent
- a GDF Trap polypeptide is fused with a domain that stabilizes the GDF Trap polypeptide in vivo (a "stabilizer” domain).
- stabilizing is meant anything that increases serum half life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other
- Fusions with the Fc portion of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins.
- fusions to human serum albumin can confer desirable properties.
- Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function, such as further increasing red blood cell levels).
- the present invention provides GDF Trap that is an ActRIIB- Fc fusion protein which comprises an extracellular (e.g., ligand-binding) domain of ActRIIB polypeptide fused to an Fc domain.
- GDF Trap that is an ActRIIB- Fc fusion protein which comprises an extracellular (e.g., ligand-binding) domain of ActRIIB polypeptide fused to an Fc domain.
- the sequence of an exemplary Fc domain is shown below (SEQ ID NO: 6).
- the Fc domain has one or more mutations at residues such as Asp-265, lysine 322, and Asn-434.
- the mutant Fc domain having one or more of these mutations e.g., Asp-265 mutation
- the mutant Fc domain having one or more of these mutations has increased ability of binding to the MHC class I- related Fc-receptor (FcRN) relative to a wildtype Fc domain.
- a GDF Trap polypeptide may be placed C-terminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to a GDF Trap polypeptide.
- the GDF Trap polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
- a GDF Trap fusion protein comprises an amino acid sequence as set forth in the formula A-B-C.
- the B portion is an N- and C-terminally truncated ActRIIB polypeptide consisting of the amino acid sequence corresponding to amino acids 26-132 of SEQ ID NO: 26.
- the A and C portions may be independently zero, one or more than one amino acids, and both the A and C portions when present are heterologous to B.
- the A and/or C portions may be attached to the B portion via a linker sequence.
- a GDF Trap fusion protein comprises an amino acid sequence as set forth in the formula A-B-C, wherein A is a leader sequence, B consists of amino acids 26-132 of SEQ ID NO: 26, and C is a polypeptide portion that enhances one or more of in vivo stability, in vivo half life, uptake/administration, tissue localization or distribution, formation of protein complexes, and/or purification.
- a GDF Trap fusion protein comprises an amino acid sequence as set forth in the formula A-B- C, wherein A is a TPA leader sequence, B consists of amino acids 26-132 of SEQ ID NO: 26, and C is an immunoglobulin Fc domain.
- a preferred GDF Trap fusion protein comprises the amino acid sequence set forth in SEQ ID NO: 26.
- the GDF Trap polypeptides of the present invention contain one or more modifications that are capable of stabilizing the GDF Trap polypeptides.
- modifications enhance the in vitro half life of the GDF Trap polypeptides, enhance circulatory half life of the GDF Trap polypeptides or reducing proteolytic degradation of the GDF Trap polypeptides.
- Such stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an GDF Trap polypeptide and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a glycosylation site to a GDF Trap polypeptide), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from a GDF Trap polypeptide).
- fusion proteins including, for example, fusion proteins comprising an GDF Trap polypeptide and a stabilizer domain
- modifications of a glycosylation site including, for example, addition of a glycosylation site to a GDF Trap polypeptide
- modifications of carbohydrate moiety including, for example, removal of carbohydrate moieties from a GDF Trap polypeptide.
- a GDF Trap polypeptide is fused to a stabilizer domain such as an IgG molecule (e.g., an Fc domain).
- stabilizer domain not only refers to a fusion domain (e.g., Fc) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous polymer, such as polyethylene glycol.
- the present invention makes available isolated and/or purified forms of the GDF Trap polypeptides, which are isolated from, or otherwise substantially free of, other proteins.
- GDF Trap polypeptides (unmodified or modified) of the invention can be produced by a variety of art-known techniques.
- GDF Trap polypeptides can be synthesized using standard protein chemistry techniques such as those described in Bodansky, M. Principles of Peptide Synthesis, Springer Verlag, Berlin (1993) and Grant G. A. (ed.), Synthetic Peptides: A User's Guide, W. H. Freeman and Company, New York (1992).
- automated peptide synthesizers are commercially available (e.g., Advanced ChemTech Model 396; Milligen/Bio search 9600).
- the GDF Trap polypeptides, fragments or variants thereof may be recombinantly produced using various expression systems (e.g., E. coli, Chinese Hamster Ovary (CHO) cells, COS cells, baculovirus) as is well known in the art.
- the modified or unmodified GDF Trap polypeptides may be produced by digestion of recombinantly produced full-length GDF Trap polypeptides by using, for example, a protease, e.g., trypsin, thermolysin, chymotrypsin, pepsin, or paired basic amino acid converting enzyme (PACE).
- PACE paired basic amino acid converting enzyme
- Computer analysis using a commercially available software, e.g., MacVector, Omega, PCGene, Molecular Simulation, Inc. can be used to identify proteolytic cleavage sites.
- GDF Trap polypeptides may be produced from recombinantly produced full-length GDF Trap polypeptides such as standard techniques known in the art, such as by chemical cleavage (e.g., cyanogen bromide, hydroxylamine).
- the invention provides isolated and/or recombinant nucleic acids encoding any of the GDF Trap polypeptides disclosed herein.
- SEQ ID NO: 4 encodes a naturally occurring ActRIIB precursor polypeptide
- SEQ ID NO: 5 encodes a soluble ActRIIB polypeptide
- SEQ ID NOs: 25, 27, 30 and 31 encode soluble GDF Traps.
- the subject nucleic acids may be single-stranded or double stranded.
- Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making GDF Trap polypeptides or as direct therapeutic agents (e.g., in a gene therapy approach).
- the subject nucleic acids encoding GDF Trap polypeptides are further understood to include nucleic acids that are variants of SEQ ID NOs: 5, 25, 27, 30 and 31.
- Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions or deletions, such as allelic variants; and will, therefore, include coding sequences that differ from the nucleotide sequence of the coding sequence designated in SEQ ID NOs: 5, 25, 27, 30 and 31.
- the invention provides isolated or recombinant nucleic acid sequences that are at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 5, 25, 27, 30 or 31.
- nucleic acid sequences complementary to SEQ ID NO: 5, 25, 27, 30 or 31, and variants of SEQ ID NO: 5, 25, 27, 30 or 31, are also within the scope of this invention.
- the nucleic acid sequences of the invention can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
- nucleic acids of the invention also include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NO: 5, 25, 27, 30 or 31, complement sequence of SEQ ID NO: 5, 25, 27, 30 or 31, or fragments thereof.
- appropriate stringency conditions which promote DNA hybridization can be varied. For example, one could perform the hybridization at 6.0 x sodium
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 0 C to a high stringency of about 0.2 x SSC at 50 0 C.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 0 C, to high stringency conditions at about 65 0 C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
- the invention provides nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature.
- Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NO: 5, 25, 27, 30 or 31 due to degeneracy in the genetic code are also within the scope of the invention.
- a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
- the GDF Trap polypeptide will be encoded by an alternative nucleotide sequence.
- nucleotide sequences are degenerate with respect to the native GDF Trap nucleic acid sequence but still encode for the same fusion protein.
- the GDF Trap having SEQ ID NO: 26 is encoded by an alternative nucleic acid sequence comprising SEQ ID NO: 30.
- DNA sequence polymorphisms that do lead to changes in the amino acid sequences of the subject proteins will exist among mammalian cells.
- these variations in one or more nucleotides (up to about 3-5% of the nucleotides) of the nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this invention.
- the recombinant nucleic acids of the invention may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
- Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression. Numerous types of appropriate expression vectors and suitable regulatory sequences are known in the art for a variety of host cells.
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the invention.
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
- the subject nucleic acid is provided in an expression vector comprising a nucleotide sequence encoding a GDF Trap polypeptide and operably linked to at least one regulatory sequence. Regulatory sequences are art-recognized and are selected to direct expression of the GDF Trap polypeptide.
- regulatory sequence includes promoters, enhancers, and other expression control elements.
- Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, CA (1990).
- any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding a GDF Trap polypeptide.
- Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda, the control regions for fd coat protein, the promoter for 3- phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast ⁇ -mating factors, the polyhedron promoter of the
- the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
- a recombinant nucleic acid of the invention can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
- Expression vehicles for production of a recombinant GDF Trap polypeptide include plasmids and other vectors.
- suitable vectors include plasmids of the types: pBR322-derived plasmids, pEMBL- derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
- Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
- the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for trans fection of eukaryotic cells.
- vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
- derivatives of viruses such as the bovine papilloma virus (BPV-I), or Epstein- Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
- BBV-I bovine papilloma virus
- pHEBo Epstein- Barr virus
- examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
- the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art. For other suitable expression systems for both prokaryotic and eukaryotic cells, as well as general recombinant procedures, see Molecular Cloning A
- baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the ⁇ -gal containing pBlueBac III).
- pVL-derived vectors such as pVL1392, pVL1393 and pVL941
- pAcUW-derived vectors such as pAcUWl
- pBlueBac-derived vectors such as the ⁇ -gal containing pBlueBac III.
- a vector will be designed for production of the subject GDF Trap polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- a vector will be designed for production of the subject GDF Trap polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- the subject gene constructs can be used to cause expression of the subject GDF Trap polypeptides in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
- This invention also pertains to a host cell transfected with a recombinant gene including a coding sequence (e.g., SEQ ID NO: 4, 5, 25, 27, 30 or 31) for one or more of the subject GDF Trap polypeptides.
- the host cell may be any prokaryotic or eukaryotic cell.
- a GDF Trap polypeptide of the invention may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art.
- the present invention further pertains to methods of producing the subject GDF Trap polypeptides.
- a host cell transfected with an expression vector encoding a GDF Trap polypeptide can be cultured under appropriate conditions to allow expression of the GDF Trap polypeptide to occur.
- the GDF Trap polypeptide may be secreted and isolated from a mixture of cells and medium containing the GDF Trap polypeptide.
- the GDF Trap polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
- a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
- the subject GDF Trap polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, and immunoaffinity purification with antibodies specific for particular epitopes of the GDF Trap polypeptides.
- the GDF Trap polypeptide is a fusion protein containing a domain which facilitates its purification.
- a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant GDF Trap polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni 2+ metal resin.
- the purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified GDF Trap polypeptide (e.g., see Hochuli et al., (1987) J. Chromatography 411 : 177; and Janknecht et al., PNAS USA 88:8972).
- fusion genes are well known. Essentially, the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992). 4. Screening Assays
- the present invention relates to the use of the subject GDF Trap polypeptides (e.g., soluble variant ActRIIB polypeptides) to identify compounds (agents) which are agonist or antagonists of ActRIIB polypeptides.
- Compounds identified through this screening can be tested to assess their ability to modulate red blood cell, hemoglobin and/or reticulocyte levels in vivo or in vitro. These compounds can be tested, for example, in animal models.
- the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an
- ActRIIB polypeptide to its binding partner such as an ActRIIB ligand (e.g., activin, Nodal, GDF8, GDFl 1 or BMP7).
- the assay can be used to identify compounds that enhance binding of an ActRIIB polypeptide to its binding partner such as an ActRIIB ligand.
- the compounds can be identified by their ability to interact with an ActRIIB polypeptide.
- test compounds (agents) of the invention may be created by any combinatorial chemical method.
- the subject compounds may be naturally occurring biomolecules synthesized in vivo or in vitro.
- Compounds (agents) to be tested for their ability to act as modulators of tissue growth can be produced, for example, by bacteria, yeast, plants or other organisms (e.g., natural products), produced chemically (e.g., small molecules, including peptidomimetics), or produced recombinantly.
- Test compounds contemplated by the present invention include non-peptidyl organic molecules, peptides, polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
- the test agent is a small organic molecule having a molecular weight of less than about 2,000 Daltons.
- test compounds of the invention can be provided as single, discrete entities, or provided in libraries of greater complexity, such as made by combinatorial chemistry.
- libraries can comprise, for example, alcohols, alkyl halides, amines, amides, esters, aldehydes, ethers and other classes of organic compounds.
- Presentation of test compounds to the test system can be in either an isolated form or as mixtures of compounds, especially in initial screening steps.
- the compounds may be optionally derivatized with other compounds and have derivatizing groups that facilitate isolation of the compounds.
- Non- limiting examples of derivatizing groups include biotin, fluorescein, digoxygenin, green fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S transferase (GST), photoactivatible crosslinkers or any combinations thereof.
- the effects of cellular toxicity or bioavailability of the test compound can be generally ignored in the in vitro system, the assay instead being focused primarily on the effect of the drug on the molecular target as may be manifest in an alteration of binding affinity between an ActRIIB polypeptide and its binding partner (e.g., an ActRIIB ligand).
- an ActRIIB polypeptide and its binding partner e.g., an ActRIIB ligand
- the compound of interest is contacted with an isolated and purified ActRIIB polypeptide which is ordinarily capable of binding to an ActRIIB ligand, as appropriate for the intention of the assay.
- an isolated and purified ActRIIB polypeptide which is ordinarily capable of binding to an ActRIIB ligand, as appropriate for the intention of the assay.
- To the mixture of the compound and ActRIIB polypeptide is then added to a composition containing an ActRIIB ligand. Detection and quantification of
- ActRIIB/ ActRIIB ligand complexes provides a means for determining the compound's efficacy at inhibiting (or potentiating) complex formation between the ActRIIB polypeptide and its binding protein.
- the efficacy of the compound can be assessed by generating dose response curves from data obtained using various concentrations of the test compound.
- a control assay can also be performed to provide a baseline for comparison.
- isolated and purified ActRIIB ligand is added to a composition containing the ActRIIB polypeptide, and the formation of ActRIIB/ ActRIIB ligand complex is quantitated in the absence of the test compound.
- the order in which the reactants may be admixed can be varied, and can be admixed simultaneously.
- cellular extracts and lysates may be used to render a suitable cell-free assay system.
- Complex formation between the ActRIIB polypeptide and its binding protein may be detected by a variety of techniques. For instance, modulation of the formation of complexes can be quantitated using, for example, detectably labeled proteins such as radiolabeled (e.g., 32 P, 35 S, 14 C or 3 H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIB polypeptide or its binding protein, by immunoassay, or by chromatographic detection.
- detectably labeled proteins such as radiolabeled (e.g., 32 P, 35 S, 14 C or 3 H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIB polypeptide or its binding protein, by immunoassay, or by chromatographic detection.
- the present invention contemplates the use of fluorescence polarization assays and fluorescence resonance energy transfer (FRET) assays in measuring, either directly or indirectly, the degree of interaction between an ActRIIB polypeptide and its binding protein.
- FRET fluorescence resonance energy transfer
- other modes of detection such as those based on optical waveguides (PCT Publication WO 96/26432 and U.S. Pat. No. 5,677,196), surface plasmon resonance (SPR), surface charge sensors, and surface force sensors, are compatible with many embodiments of the invention.
- an interaction trap assay also known as the "two hybrid assay," for identifying agents that disrupt or potentiate interaction between an ActRIIB polypeptide and its binding partner. See for example, U.S. Pat. No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J Biol Chem
- the present invention contemplates the use of reverse two hybrid systems to identify compounds (e.g., small molecules or peptides) that dissociate interactions between an ActRIIB polypeptide and its binding protein. See for example, Vidal and Legrain, (1999) Nucleic Acids Res 27:919-29; Vidal and Legrain, (1999) Trends Biotechnol 17:374-81; and U.S. Pat. Nos. 5,525,490; 5,955,280; and 5,965,368.
- the subject compounds are identified by their ability to interact with an ActRIIB polypeptide.
- the interaction between the compound and the ActRIIB polypeptide may be covalent or non-covalent.
- such interaction can be identified at the protein level using in vitro biochemical methods, including photo- crosslinking, radiolabeled ligand binding, and affinity chromatography (Jakoby WB et al., 1974, Methods in Enzymology 46: 1).
- the compounds may be screened in a mechanism based assay, such as an assay to detect compounds which bind to an ActRIIB polypeptide. This may include a solid phase or fluid phase binding event.
- the gene encoding an ActRIIB polypeptide can be transfected with a reporter system (e.g., ⁇ - galactosidase, luciferase, or green fluorescent protein) into a cell and screened against the library preferably by a high throughput screening or with individual members of the library.
- a reporter system e.g., ⁇ - galactosidase, luciferase, or green fluorescent protein
- Other mechanism based binding assays may be used, for example, binding assays which detect changes in free energy. Binding assays can be performed with the target fixed to a well, bead or chip or captured by an immobilized antibody or resolved by capillary electrophoresis. The bound compounds may be detected usually using colorimetric or fluorescence or surface plasmon resonance.
- the GDF Trap polypeptides of the present invention can be used to increase red blood cell levels in mammals such as rodents and primates, and particularly human patients. Additionally, as shown herein, GDF Trap polypeptides may be used in combination with EPO receptor activators to achieve an increase in red blood cells at lower dose ranges. This may be beneficial in reducing the known off-target effects and risks associated with high doses of EPO receptor activators.
- the present invention provides methods of treating or preventing anemia in an individual in need thereof by administering to the individual a therapeutically effective amount of a GDF Trap polypeptide or a combination (or concomitant therapy) of a GDF Trap polypeptide and a EPO receptor activator. These methods may be used for therapeutic and prophylactic treatments of mammals, and particularly humans.
- the GDF Trap polypeptides may be used in combination with EPO receptor activators to reduce the required dose of these activators in patients that are susceptible to adverse effects of EPO.
- the primary adverse effects of EPO are an excessive increase in the hematocrit or hemoglobin levels and polycythemia. Elevated hematocrit levels can lead to hypertension (more particularly aggravation of hypertension) and vascular thrombosis.
- Other adverse effects of EPO which have been reported, some of which related to hypertension, are headaches, influenza-like syndrome, obstruction of shunts, myocardial infarctions and cerebral convulsions due to thrombosis, hypertensive encephalopathy, and red cell blood cell applasia (Singibarti, (1994) J.
- a GDF Trap polypeptide may be beneficial for a patient in which administration of a normal to increased (>300 IU/kg/week) dose of EPO does not result in the increase of hemoglobin level up to the target level.
- Patients with an inadequate EPO response are found for all types of anemia, but higher numbers of non- responders have been observed particularly frequently in patients with cancers and patients with end-stage renal disease.
- An inadequate response to EPO can be either constitutive (i.e. observed upon the first treatment with EPO) or acquired (e.g. observed upon repeated treatment with EPO).
- a therapeutic that "prevents" a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.
- treating includes prophylaxis of the named condition or amelioration or elimination of the condition once it has been established. In either case, prevention or treatment may be discerned in the diagnosis provided by a physician or other health care provider and the intended result of administration of the therapeutic agent.
- GDF Trap polypeptides may be used to increase red blood cell, hemoglobin or reticulocyte levels in healthy individuals, and such GDF Trap polypeptides may be used in selected patient populations.
- appropriate patient populations include those with undesirably low red blood cell or hemoglobin levels, such as patients having an anemia, and those that are at risk for developing undesirably low red blood cell or hemoglobin levels, such as those patients that are about to undergo major surgery or other procedures that may result in substantial blood loss.
- a patient with adequate red blood cell levels is treated with a GDF Trap polypeptide to increase red blood cell levels, and then blood is drawn and stored for later use in transfusions.
- GDF Trap polypeptides may be used to increase red blood cell levels in patients having an anemia.
- a level of less than normal for the appropriate age and gender category may be indicative of anemia, although individual variations are taken into account.
- a hemoglobin level of 12 g/dl is generally considered the lower limit of normal in the general adult population.
- Potential causes include blood-loss, nutritional deficits, medication reaction, various problems with the bone marrow and many diseases. More particularly, anemia has been associated with a variety of disorders that include, for example, chronic renal failure, myelodysplastic syndrome, rheumatoid arthritis, bone marrow transplantation.
- Anemia may also be associated with the following conditions: solid tumors (e.g. breast cancer, lung cancer, colon cancer); tumors of the lymphatic system (e.g. chronic lymphocyte leukemia, non-Hodgkins and Hodgkins lymphomas); tumors of the hematopoietic system (e.g. leukemia, myelodysplastic syndrome, multiple myeloma);
- solid tumors e.g. breast cancer, lung cancer, colon cancer
- tumors of the lymphatic system e.g. chronic lymphocyte leukemia, non-Hodgkins and Hodgkins lymphomas
- tumors of the hematopoietic system e.g. leukemia, myelodysplastic syndrome, multiple myeloma
- chemotherapy e.g. platinum containing regimens
- inflammatory and autoimmune diseases including, but not limited to, rheumatoid arthritis, other inflammatory arthritides, systemic lupus erythematosis (SLE), acute or chronic skin diseases (e.g.
- psoriasis inflammatory bowel disease
- Crohn's disease and ulcerative colitis acute or chronic renal disease or failure including idiopathic or congenital conditions; acute or chronic liver disease; acute or chronic bleeding; situations where transfusion of red blood cells is not possible due to patient allo- or auto-antibodies and/or for religious reasons (e.g. some
- infections e.g. malaria, osteomyelitis
- hemoglobinopathies including, for example, sickle cell disease, thalassemias
- drug use or abuse e.g. alcohol misuse
- GDF Trap polypeptides would be appropriate for treating anemias of hypoproliferative bone marrrow, which are typically associated with little change in red blood cell (RBC) morphology.
- Hypoproliferative anemias include: 1) anemia of chronic disease, 2) anemia of kidney disease, and 3) anemia associated with hypometabolic states. In each of these types, endogenous erythropoietin levels are inappropriately low for the degree of anemia observed.
- Other hypoproliferative anemias include: 4) early-stage iron-deficient anemia, and 5) anemia caused by damage to the bone marrow. In these types, endogenous erythropoietin levels are appropriately elevated for the degree of anemia observed.
- the most common type is anemia of chronic disease, which encompasses
- inflammation, infection, tissue injury, and conditions such as cancer and is distinguished by both low erythropoietin levels and an inadequate response to erythropoietin in the bone marrow (Adamson, 2008, Harrison's Principles of Internal Medicine, 17th ed.; McGraw Hill, New York, pp 628-634).
- Many factors can contribute to cancer-related anemia. Some are associated with the disease process itself and the generation of inflamatory cytokines such as interleukin-1, interferon-gamma, and tumor necrosis factor (Bron et al., 2001, Semin Oncol 28(Suppl 8):l-6).
- inflammation induces the key iron-regulatory peptide hepcidin, thereby inhibiting iron export from macrophages and generally limiting iron availability for erythropoiesis (Ganz, 2007, J Am Soc Nephrol 18:394-400).
- Blood loss through various routes can also contribute to cancer-related anemia.
- the prevalence of anemia due to cancer progression varies with cancer type, ranging from 5% in prostate cancer up to 90% in multiple myeloma. Cancer-related anemia has profound consequences for patients, including fatigue and reduced quality of life, reduced treatment efficacy, and increased mortality.
- Chronic kidney disease is associated with hypoproliferative anemia that varies in severity with the degree of renal impairment. Such anemia is primarily due to inadequate production of erythropoietin and reduced survival of red blood cells.
- Chronic kidney disease usually proceeds gradually over a period of years or decades to end-stage (Stage-5) disease, at which point dialysis or kidney transplantation is required for patient survival. Anemia often develops early in this process and worsens as disease progresses.
- kidney disease The clinical consequences of anemia of kidney disease are well-documented and include development of left ventricular hypertrophy, impaired cognitive function, reduced quality of life, and altered immune function (Levin et al., 1999, Am J Kidney Dis 27:347-354; Nissenson, 1992, Am J Kidney Dis 20(Suppl l):21-24; Revicki et al., 1995, Am J Kidney Dis 25:548-554; Gafter et al., 1994, Kidney Int 45:224-231).
- a GDF Trap polypeptide optionally combined with an EPO receptor activator, can be used to treat anemia of kidney disease.
- hypometabolic rate can produce a mild-to-moderate hypoproliferative anemia.
- endocrine deficiency states For example, anemia can occur in Addison's disease, hypothyroidism, hyperparathyroidism, or males who are castrated or treated with estrogen. Mild-to-moderate anemia can also occur with reduced dietary intake of protein, a condition particularly prevalent in the elderly.
- Acute blood loss initially causes hypovolemia without anemia since there is proportional depletion of RBCs along with other blood constituents.
- hypovolemia will rapidly trigger physiologic mechanisms that shift fluid from the extravascular to the vascular compartment, which results in hemodilution and anemia. If chronic, blood loss gradually depletes body iron stores and eventually leads to iron deficiency.
- a GDF Trap polypeptide optionally combined with an EPO receptor activator, can be used to speed recovery from anemia of acute blood loss.
- Iron-deficiency anemia is the final stage in a graded progression of increasing iron deficiency which includes negative iron balance and iron-deficient erythropoiesis as intermediate stages. Iron deficiency can result from increased iron demand, decreased iron intake, or increased iron loss, as exemplified in conditions such as pregnancy, inadequate diet, intestinal malabsorption, acute or chronic inflammation, and acute or chronic blood loss.
- a GDF Trap polypeptide could be used to treat chronic iron-deficiency anemias alone or in combination with conventional therapeutic approaches, particularly to treat anemias of multifactorial origin.
- Hypoproliferative anemias can result from primary dysfunction or failure of the bone marrow, instead of dysfunction secondary to inflammation, infection, or cancer progression. Prominent examples would be myelosuppression caused by cancer chemotherapeutic drugs or cancer radiation therapy.
- a broad review of clinical trials found that mild anemia can occur in 100% of patients after chemotherapy, while more severe anemia can occur in up to 80% of such patients (Groopman et al., 1999, J Natl Cancer Inst 91 : 1616-1634).
- Myelosuppressive drugs include: 1) alkylating agents such as nitrogen mustards (e.g., melphalan) and nitrosoureas (e.g., streptozocin); 2) antimetabolites such as folic acid antagonists (e.g., methotrexate), purine analogs (e.g., thioguanine), and pyrimidine analogs (e.g., gemcitabine); 3) cytotoxic antibotics such as anthracyclines (e.g., doxorubicin); 4) kinase inhibitors (e.g., gefitinib); 5) mitotic inhibitors such as taxanes (e.g., paclitaxel) and vinca alkaloids (e.g., vinorelbine); 6) monoclonal antibodies (e.g., rituximab); and 7) topoisomerase inhibitors (e.g., topotecan and etoposide).
- GDF Trap polypeptides optionally combined with an EPO receptor activator, would also be appropriate for treating anemias of disordered RBC maturation, which are
- Patients may be treated with a dosing regimen intended to restore the patient to a target hemoglobin level, usually between about 10 g/dl and about 12.5 g/dl, and typically about 11.0 g/dl (see also Jacobs et al. (2000) Nephrol Dial Transplant 15, 15-19), although lower target levels may cause fewer cardiovascular side effects.
- hematocrit levels (percentage of the volume of a blood sample occupied by the cells) can be used as a measure for the condition of red blood cells. Hematocrit levels for healthy individuals range from 41 to 51% for adult males and from 35 to 45% for adult females. Target hematocrit levels are usually around 30-33%.
- hemoglobin/hematocrit levels vary from person to person. Thus, optimally, the target hemoglobin/hematocrit level can be
- the present invention provides methods for managing a patient that has been treated with, or is a candidate to be treated with, a GDF Trap polypeptide by measuring one or more hematologic parameters in the patient.
- the hematologic parameters may be used to evaluate appropriate dosing for a patient who is a candidate to be treated with a GDF Trap polypeptide, to monitor the hematologic parameters during treatment with a GDF Trap polypeptide, to evaluate whether to adjust the dosage during treatment with a GDF Trap polypeptide, and/or to evaluate an appropriate
- GDF Trap polypeptide a GDF Trap polypeptide that is administered to a human patient. If one or more of the hematologic parameters are outside the normal level, dosing with a GDF Trap polypeptide may be reduced, delayed or terminated.
- Hematologic parameters that may be measured in accordance with the methods provided herein include, for example, red blood cell levels, blood pressure, iron stores, and other agents found in bodily fluids that correlate with increased red blood cell levels, using art recognized methods. Such parameters may be determined using a blood sample from a patient. Increases in red blood cell levels, hemoglobin levels, and/or hematocrit levels may cause increases in blood pressure.
- hematologic parameters are outside the normal range, or on the high side of normal, in a patient who is a candidate to be treated with a GDF Trap polypeptide then onset of administration of the GDF Trap polypeptide may be delayed until the hematologic parameters have returned to a normal or acceptable level either naturally or via therapeutic intervention.
- a candidate patient is hypertensive or prehypertensive, then the patient may be treated with a blood pressure lowering agent in order to reduce the patient's blood pressure.
- Any blood pressure lowering agent appropriate for the individual patient's condition may be used including, for example, diuretics, adrenergic inhibitors (including alpha blockers and beta blockers), vasodilators, calcium channel blockers, angiotensin-converting enzyme (ACE) inhibitors, or angiotensin II receptor blockers. Blood pressure may alternatively be treated using a diet and exercise regimen.
- adrenergic inhibitors including alpha blockers and beta blockers
- vasodilators including calcium channel blockers, angiotensin-converting enzyme (ACE) inhibitors, or angiotensin II receptor blockers.
- ACE angiotensin-converting enzyme
- a candidate patient may be treated with an appropriate regimen of diet and/or iron supplements until the patient's iron stores have returned to a normal or acceptable level.
- administration of the GDF Trap polypeptide may be delayed until the levels have returned to a normal or acceptable level.
- one or more hematologic parameters are outside the normal range, or on the high side of normal, in a patient who is a candidate to be treated with a GDF Trap polypeptide then the onset of administration may be not be delayed.
- the dosage amount or frequency of dosing of the GDF Trap polypeptide may be set at an amount that would reduce the risk of an unacceptable increase in the hematologic parameters arising upon administration of the GDF Trap polypeptide.
- a therapeutic regimen may be developed for the patient that combines a GDF Trap polypeptide with a therapeutic agent that addresses the undesirable level of the hematologic parameter. For example, if the patient has elevated blood pressure, then a therapeutic regimen involving administration of a GDF Trap polypeptide and a blood pressure lowering agent may be designed. For a patient having lower than desired iron stores, a therapeutic regimen of a GDF Trap polypeptide and iron supplementation may be developed.
- baseline parameter(s) for one or more hematologic parameters may be established for a patient who is a candidate to be treated with a GDF Trap
- polypeptide and an appropriate dosing regimen establish for that patient based on the baseline value(s).
- established baseline parameters based on a patient's medical history could be used to inform an appropriate GDF Trap polypeptide dosing regimen for a patient.
- a patient's baseline values for one or more hematologic parameters prior to treatment with a GDF Trap polypeptide may also be used as the relevant comparative values for monitoring any changes to the hematologic parameters during treatment with the GDF Trap polypeptide.
- one or more hematologic parameters are measured in patients who are being treated with a GDF Trap polypeptide.
- the hematologic parameters may be used to monitor the patient during treatment and permit adjustment or termination of the dosing with the GDF Trap polypeptide or additional dosing with another therapeutic agent. For example, if administration of a GDF Trap polypeptide results in an increase in blood pressure, red blood cell level, or hemoglobin level, or a reduction in iron stores, then the dose of the GDF Trap polypeptide may be reduced in amount or frequency in order to decrease the effects of the GDF Trap polypeptide on the one or more hematologic parameters.
- the dosing of the GDF Trap polypeptide may be terminated either temporarily, until the hematologic parameter(s) return to an acceptable level, or permanently. Similarly, if one or more hematologic parameters are not brought within an acceptable range after reducing the dose or frequency of administration of the GDF Trap polypeptide then the dosing may be terminated.
- the patient may be dosed with an additional therapeutic agent that addresses the undesirable level in the hematologic parameter(s), such as, for example, a blood pressure lowering agent or an iron supplement.
- an additional therapeutic agent that addresses the undesirable level in the hematologic parameter(s), such as, for example, a blood pressure lowering agent or an iron supplement.
- dosing with the GDF Trap polypeptide may continue at the same level and a blood pressure lowering agent is added to the treatment regimen, dosing with the GDF Trap polypeptide may be reduce (e.g., in amount and/or frequency) and a blood pressure lowering agent is added to the treatment regimen, or dosing with the GDF Trap polypeptide may be terminated and the patient may be treated with a blood pressure lowering agent.
- patients being treated with a GDF Trap polypeptide, or candidate patients to be treated with a GDF Trap polypeptide are patients in need of muscle growth, such as patients suffering from, or at risk of developing, a neuromuscular disorder or musculogenerative disorder.
- patients or candidate patients may be suffering from, or at risk for developing, Lou Gehrig's disease (ALS), cancer anorexia-cachexia syndrome, muscular dystrophy, muscle atrophy, congestive obstructive pulmonary disease (and muscle wasting associated with COPD), muscle wasting syndrome, sarcopenia, or cachexia.
- ALS Lou Gehrig's disease
- cancer anorexia-cachexia syndrome a group of degenerative muscle diseases
- GDF Trap polypeptides include: Duchenne Muscular
- DMD Becker Muscular Dystrophy
- BMD Becker Muscular Dystrophy
- EDMD Limb-Girdle Muscular Dystrophy
- LGMD Limb-Girdle Muscular Dystrophy
- FSH or FSHD Facioscapulohumeral Muscular Dystrophy
- MMD MMD
- Steinert's Disease Oculopharyngeal Muscular Dystrophy
- OPMD Oculopharyngeal Muscular Dystrophy
- DD Distal Muscular Dystrophy
- CMD Congenital Muscular Dystrophy
- compounds (e.g., GDF Trap polypeptides) of the present invention are formulated with a pharmaceutically acceptable carrier.
- a GDF Trap polypeptide can be administered alone or as a component of a pharmaceutical formulation (therapeutic composition).
- the subject compounds may be formulated for administration in any convenient way for use in human or veterinary medicine.
- the therapeutic method of the invention includes
- compositions systemically, or locally as an implant or device.
- therapeutic composition for use in this invention is, of course, in a pyrogen- free, physiologically acceptable form.
- Therapeutically useful agents other than the GDF Trap polypeptides which may also optionally be included in the composition as described above, may be administered simultaneously or sequentially with the subject compounds (e.g., GDF Trap polypeptides) in the methods of the invention.
- compositions suitable for parenteral administration may comprise one or more GDF Trap polypeptides in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- compositions of the present invention may include a matrix capable of delivering one or more therapeutic compounds
- GDF Trap polypeptides e.g., GDF Trap polypeptides
- a target tissue site e.g., bone marrow
- the matrix may provide slow release of the GDF Trap polypeptides.
- Such matrices may be formed of materials presently in use for other implanted medical applications.
- matrix material is based on biocompatibility, biodegradability, mechanical properties, cosmetic appearance and interface properties.
- the particular application of the subject compositions will define the appropriate formulation.
- Potential matrices for the compositions may be biodegradable and chemically defined calcium sulfate, tricalciumphosphate, hydroxyapatite, polylactic acid and polyanhydrides.
- Other potential materials are biodegradable and biologically well defined, such as bone or dermal collagen.
- Further matrices are comprised of pure proteins or extracellular matrix components.
- Other potential matrices are non-biodegradable and chemically defined, such as sintered
- Matrices may be comprised of combinations of any of the above mentioned types of material, such as polylactic acid and hydroxyapatite or collagen and tricalciumphosphate.
- the bioceramics may be altered in composition, such as in calcium-aluminate -phosphate and processing to alter pore size, particle size, particle shape, and biodegradability.
- methods of the invention can be administered for orally, e.g., in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in- water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of an agent as an active ingredient.
- An agent may also be administered as a bolus, electuary or paste.
- one or more therapeutic compounds of the present invention may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as quaternary ammonium compounds; (7) wetting agents, such as
- compositions may also comprise buffering agents.
- Solid compositions of a similar type may also be employed as fillers in soft and hard- filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
- Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
- the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
- the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents,
- Suspensions in addition to the active compounds, may contain suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- compositions of the invention may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption, such as aluminum monostearate and gelatin.
- the dosage regimen will be determined by the attending physician considering various factors which modify the action of the subject compounds of the invention (e.g., GDF Trap polypeptides).
- the various factors include, but are not limited to, the patient's red blood cell count, hemoglobin level or other diagnostic assessments, the desired target red blood cell count, the patient's age, sex, and diet, the severity of any disease that may be contributing to a depressed red blood cell level, time of administration, and other clinical factors.
- the addition of other known growth factors to the final composition may also affect the dosage. Progress can be monitored by periodic assessment of red blood cell and hemoglobin levels, as well as assessments of reticulocyte levels and other indicators of the hematopoietic process.
- the present invention also provides gene therapy for the in vzVo production of GDF Trap polypeptides.
- Such therapy would achieve its therapeutic effect by introduction of the GDF Trap polynucleotide sequences into cells or tissues having the disorders as listed above.
- Delivery of GDF Trap polynucleotide sequences can be achieved using a recombinant expression vector such as a chimeric virus or a colloidal dispersion system.
- Preferred for therapeutic delivery of GDF Trap polynucleotide sequences is the use of targeted liposomes.
- RNA virus such as a retrovirus
- the retroviral vector may be a derivative of a murine or avian retrovirus.
- retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), and Rous Sarcoma Virus (RSV).
- MoMuLV Moloney murine leukemia virus
- HaMuSV Harvey murine sarcoma virus
- MuMTV murine mammary tumor virus
- RSV Rous Sarcoma Virus
- a number of additional retroviral vectors can incorporate multiple genes. All of these vectors can transfer or incorporate a gene for a selectable marker so that transduced cells can be identified and generated.
- Retroviral vectors can be made target-specific by attaching, for example, a sugar, a glycolipid, or a protein. Preferred targeting is accomplished by using an antibody. Those of skill in the art will recognize that specific polynucleotide sequences can be inserted into the retroviral genome or attached to a viral envelope to allow target specific delivery of the retroviral vector containing the GDF Trap polynucleotide.
- tissue culture cells can be directly transfected with plasmids encoding the retroviral structural genes gag, pol and env, by conventional calcium phosphate transfection. These cells are then transfected with the vector plasmid containing the genes of interest. The resulting cells release the retroviral vector into the culture medium.
- Another targeted delivery system for GDF Trap polynucleotides is a colloidal dispersion system. Colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. The preferred colloidal system of this invention is a liposome.
- Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (see e.g., Fraley, et al., Trends Biochem. ScL, 6:77, 1981). Methods for efficient gene transfer using a liposome vehicle, are known in the art, see e.g., Mannino, et al., Biotechniques, 6:682, 1988.
- the composition of the liposome is usually a combination of phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used.
- the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations.
- lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine,
- phosphatidylethanolamine sphingolipids
- cerebrosides sphingolipids
- gangliosides phosphatidylethanolamine
- Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine, and distearoylphosphatidylcholine.
- the targeting of liposomes is also possible based on, for example, organ-specificity, cell-specificity, and organelle-specificity and is known in the art.
- a polypeptide having a modified extracellular domain of ActRIIB with greatly reduced activin A binding relative to GDFl 1 and/or myostatin (as a consequence of a leucine-to-aspartate substitution at position 79 in SEQ ID NO: 1) was fused to a human or mouse Fc domain with a minimal linker (three glycine amino acids) in between.
- the constructs are referred to as ActRIIB(L79D 20-134)- hFc and ActRIIB(L79D 20-134)-mFc, respectively.
- Alternative forms with a glutamate rather than an aspartate at position 79 performed similarly (L79E).
- the GDF Trap ActRIIB(L79D 20-134)-hFc is shown below as purified from CHO cell lines (SEQ ID NO: 7).
- the ActRIIB-derived portion of the GDF Trap has an amino acid sequence set forth below (SEQ ID NO: 32), and that portion could be used as a monomer or as a non-Fc fusion protein as a monomer, dimer or greater order complex.
- the GDF Trap protein was expressed in CHO cell lines. Three different leader sequences were considered:
- Tissue Plasminogen Activator TPA: MDAMKRGLCCVLLLCGAVFVSP (SEQ ID NO: 9)
- the selected form employs the TPA leader and has the following unprocessed amino acid sequence: MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYNANWELERTNQSGLERCE GEQDKRLHCYASWRNSSGTIELVKKGCWDDDFNCYDRQECVATEENPQVYFCCCE GNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSPGK (SEQ ID NO: 11)
- This polypeptide is encoded by the following nucleic acid sequence (SEQ ID NO: 12):
- ACTGGGAGCT GGAGCGCACC AACCAGAGCG GCCTGGAGCG CTGCGAAGGC GAGCAGGACA AGCGGCTGCA CTGCTACGCC TCCTGGCGCA ACAGCTCTGG CACCATCGAG CTCGTGAAGA AGGGCTGCTG GGACGATGAC TTCAACTGCT ACGATAGGCA GGAGTGTGTGTG GCCACTGAGG AGAACCCCCA GGTGTACTTC TGCTGCTGTG AAGGCAACTT CTGCAACGAG CGCTTCACTC ATTTGCCAGA GGCTGGGGGC CCGGAAGTCA CGTACGAGCC ACCCCCGACA GCCCCCACCG
- Purification could be achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenylsepharose chromatography, size exclusion
- the cell culture medium is passed over a protein A column, washed in 150 mM Tris/NaCl (pH 8.0), then washed in 50 mM Tris/NaCl (pH 8.0) and eluted with 0.1 M glycine, pH 3.0.
- the low pH eluate is kept at room temperature for 30 minutes as a viral clearance step.
- the eluate is then neutralized and passed over a Q sepharose ion exchange column and washed in 50 mM Tris pH 8.0, 50 mM NaCl, and eluted in 50 mM Tris pH 8.0, with an NaCl concentration between 150 mM and 300 mM.
- the eluate is then changed into 50 mM Tris pH 8.0, 1.1 M ammonium sulfate and passed over a phenyl sepharose column, washed, and eluted in 50 mM Tris pH 8.0 with ammonium sulfate between 150 and 300 mM.
- the eluate is dialyzed and filtered for use.
- Rhabdomyosarcoma (derived from muscle). Reporter vector: pGL3(CAGA)12 (Described in Dennler et al, 1998, EMBO 17: 3091-3100).
- the CAGA12 motif is present in TGF-Beta responsive genes ( PAI-I gene) , so this vector is of general use for factors signaling through Smad2 and 3.
- Day 1 Split A-204 cells into 48-well plate.
- Activin A showed 10 fold stimulation of reporter gene expression and an ED50 ⁇ 2 ng/ml.
- GDF-11 16 fold stimulation, ED50: ⁇ 1.5 ng/ml.
- ActRIIB(20-134) is a potent inhibitor of activin, GDF-8 and GDF-11 activity in this assay. Variants were tested in this assay as well.
- truncations of three (ending with ...PPT), six (ending with ...YEP) or more amino acids at the C-terminus causes a threefold or greater decrease in the activity of the molecule.
- the truncation of the final 15 amino acids of the ActRIIB portion causes a greater loss of activity (see WO2006/012627).
- Amino terminal truncations were made in the background of an ActRIIB(20-13 l)-hFc protein. The activities are shown below (as measured in conditioned media):
- ActRIIB(20-134)-Fc has a serum half-life of approximately 70 hours.
- ActRIIB(A24N 20-134)-Fc has a serum half-life of approximately 100-150 hours.
- the A24N variant has activity in the cell-based assay (above) and in vivo assays (below) that are equivalent to the wild-type molecule. Coupled with the longer half-life, this means that over time an A24N variant will give greater effect per unit of protein than the wild-type molecule.
- the A24N variant, and any of the other variants tested above, may be combined with the GDF Trap molecules, such as the L79D or L79E variants.
- Example 5 GDF-Il and Activin A Binding.
- the ActRIIB-Fc variants or wild-type protein were captured onto the system using an anti-hFc antibody. Ligands were injected and flowed over the captured receptor proteins. Results are summarized in the tables, below.
- ActRIIB(20-134)-hFc (IgGl) was administered once a week for 1 month to male and female cynomolgus monkeys by subcutaneous injection. Forty-eight cynomolgus monkeys (24/sex) were assigned to one of four treatment groups (6 animals/sex/group) and were administered subcutaneous injections of either vehicle or ActRIIB-hFc at 3, 10, or 30 mg/kg once weekly for 4 weeks (total of 5 doses). Parameters evaluated included general clinical pathology (hematology, clinical chemistry, coagulation, and urinalysis). ActRIIB-hFc caused statistically significant elevated mean absolute reticulocyte values by day 15 in treated animals.
- ActRIIB-hFc caused several hematological changes, including elevated mean absolute reticulocyte and red blood cell distribution width values and lower mean corpuscular hemoglobin concentration. All treated groups and both sexes were affected. These effects are consistent with a positive effect of ActRIIB-hFc on the release of immature reticulocytes from the bone marrow. This effect was reversed after drug was washed out of the treated animals (by study day 56). Accordingly, we conclude that ActRIIB-hFc stimulates erythropoiesis.
- CFU-E mature erythroid progenitor
- mice Sixteen C57BL/6 female mice 6-8 weeks of age were used in the study. Eight mice were injected subcutaneously with test compound ActRIIB-mFc at days 1 and 3 at a dose of 10 mg/kg and eight mice were injected subcutaneously with vehicle control, phosphate buffered saline (PBS), at a volume of 100 ⁇ L per mouse. All mice were sacrificed 8 days after first injection in accordance with the relevant Animal Care Guidelines. Peripheral blood (PB) samples from individual animals were collected by cardiac puncture and used for complete blood counts and differential (CBC/Diff). Femurs and spleens were harvested from each mouse.
- PB Peripheral blood
- PB from each mouse was collected via cardiac puncture and placed into the appropriate microtainer tubes. Samples were sent to CLV for analysis on a CellDyn 3500 counter.
- Clonogenic progenitors of the myeloid, erythroid and lymphoid lineages were assessed using the in vitro methylcellulose-based media systems described below.
- Clonogenic progenitors of the mature erythroid (CFU-E) lineages were cultured in MethoCultTM 3334, a methylcellulose-based medium containing recombinant human (rh) Erythropoietin (3 U/mL). Lymphoid Progenitors:
- Clonogenic progenitors of the lymphoid (CFU-pre-B) lineage were cultured in MethoCult® 3630, a methylcellulose-based medium containing rh Interleukin 7 (10 ng/mL).
- Clonogenic progenitors of the granulocyte-monocyte (CFU-GM), erythroid (BFU-E) and multipotential (CFU-GEMM) lineages were cultured in MethoCultTM 3434, a methylcellulose-based medium containing recombinant murine (rm) Stem Cell Factor (50 ng/mL), rh Interleukin 6 (10 ng/mL), rm Interleukin 3 (10 ng/mL) and rh Erythropoietin (3 U/mL).
- MethoCultTM 3434 a methylcellulose-based medium containing recombinant murine (rm) Stem Cell Factor (50 ng/mL), rh Interleukin 6 (10 ng/mL), rm Interleukin 3 (10 ng/mL) and rh Erythropoietin (3 U/mL).
- Mouse femurs and spleens were processed by standard protocols. Briefly, bone marrow was obtained by flushing the femoral cavity with Iscove's Modified Dulbecco's Media containing 2% fetal bovine serum (IMDM 2% FBS) using a 21 gauge needle and 1 cc syringe. Spleen cells were obtained by crushing spleens through a 70 ⁇ M filter and rinsing the filter with IMDM 2% FBS. Nucleated cell counts in 3% glacial acetic acid were then performed on the single cells suspensions using a Neubauer counting chamber so that the total cells per organ could be calculated.
- IMDM 2% FBS Iscove's Modified Dulbecco's Media containing 2% fetal bovine serum
- Spleen cells were obtained by crushing spleens through a 70 ⁇ M filter and rinsing the filter with IMDM 2% FBS. Nucleated cell counts in 3% glacial acetic
- total spleen cells were then diluted with 3 times the volume of ammonium chloride lysis buffer and incubated on ice 10 minutes. The cells were then washed and resuspended in IMDM 2% FBS and a second cell count were performed to determine the cell concentration of cells after lysis.
- Bone marrow cells were plated at 1x10 5 cells per dish in MethoCultTM 3334 to assess mature erythroid progenitors, 2xlO 5 cells per dish in MethoCultTM 3630 to assess lymphoid progenitors and 3x10 4 cells per dish in MethoCultTM 3434 to assess immature erythroid and myeloid progenitors.
- Spleen cells were plated at 4xlO 5 cells per dish in MethoCultTM 3334 to assess mature erythroid progenitors, 4x10 5 cells per dish in MethoCultTM 3630 to assess lymphoid progenitors and 2x10 5 cells per dish in MethoCultTM 3434 to assess immature erythroid and myeloid progenitors. Cultures plated in triplicate dishes were incubated at 4xlO 5 cells per dish in MethoCultTM 3334 to assess mature erythroid progenitors, 4x10 5 cells per dish in MethoCultTM 3630 to assess lymphoid progenitors and 2x10 5 cells per dish in MethoCultTM 3434 to assess immature erythroid and myeloid progenitors. Cultures plated in triplicate dishes were incubated at
- Mature erythroid progenitors were cultured for 2 days, lymphoid progenitors were cultured for 7 days and mature erythroid and myeloid progenitors were cultured for 12 days.
- the mean +/- 1 standard deviation was calculated for the triplicate cultures of the clonogenic assays and for the control and treatment groups for all data sets.
- CFC colony forming cells
- mice with ActRIIB(20-134)-mFc did not result in significant increases in red blood cell or hemoglobin content.
- the effect on progenitor cell content was notable.
- the compound treated group experienced a statistically significant increase in the nucleated cell number before red blood cell lysis and in the mature erythroid progenitor (CFU-E) colony number per dish, frequency and total progenitor number per spleen.
- CFU-GM myeloid
- BFU-E immature erythroid
- total progenitor number per spleen an increase was seen in the number of myeloid (CFU-GM), immature erythroid (BFU-E) and total progenitor number per spleen. Accordingly, it is expected that over a longer time course, ActRIIB(20-134)-mFc treatment may result in elevated red blood cell and hemoglobin content.
- Example 8 A GDF Trap Increases Red Blood Cell Levels in vivo
- GDF Trap ActRIIB polypeptide
- SC subcutaneous injection
- whole blood was collected by cardiac puncture into EDTA containing tubes and analyzed for cell distribution using an HM2 hematology analyzer (Abaxis, Inc).
- Example 9 A GDF Trap is Superior to ActRHB-Fc for Increasing Red Blood Cell Levels In vivo.
- mice Nineteen-week-old male C57BL/6NTac mice were randomly assigned to one of three groups. Mice were dosed with vehicle (10 mM Tris Buffered Saline, TBS), wild-type ActRIIB(20-134)-mFc, or GDF trap ActRIIB(L79D 20-134)-hFc by subcutaneous injection twice per week for three weeks. Blood was collected cheek bleed at baseline and after three weeks of dosing and analyzed for cell distribution using a hematology analyzer (HM2, Abaxis, Inc.)
- HM2 hematology analyzer
- a GDF Trap referred to as ActRIIB(L79D 20-134)-hFc was generated by N-terminal fusion of TPA leader to the ActRIIB extracellular domain (residues 20-134 in SEQ ID NO: 1) containing a leucine-to-aspartate substitution (at residue 79 in SEQ ID NO: 1) and C-terminal fusion of human Fc domain with minimal linker (three glycine residues) (Figure 3).
- Figure 4 A nucleotide sequence corresponding to this fusion protein is shown in Figure 4.
- a GDF Trap with truncated ActRIIB extracellular domain referred to as
- ActRIIB(L79D 25-13 l)-hFc was generated by N-terminal fusion of TPA leader to truncated extracellular domain (residues 25-131 in SEQ ID NO: 1) containing a leucine-to-aspartate substitution (at residue 79 in SEQ ID NO: 1) and C-terminal fusion of human Fc domain with minimal linker (three glycine residues) (Figure 5).
- Figure 6 A nucleotide sequence corresponding to this fusion protein is shown in Figure 6.
- ActRIIB(L79D 25-13 l)-hFc was evaluated to determine its effect on proliferation of erythroid progenitors.
- CFU-E colony- forming unit- erythroid
- BFU-E burst forming unit-erythroid
- Methylcellulose-based medium for BFU-E determination (MethoCult M3434, Stem Cell
- mice included recombinant murine stem cell factor, interleukin-3, and interleukin-6, which were not present in methylcellulose medium for CFU-E determination (MethoCult M3334, Stem Cell Technologies), while both media contained erythropoietin, among other constituents.
- MethodhoCult M3334, Stem Cell Technologies included recombinant murine stem cell factor, interleukin-3, and interleukin-6, which were not present in methylcellulose medium for CFU-E determination (MethoCult M3334, Stem Cell Technologies), while both media contained erythropoietin, among other constituents.
- BFU-E and CFU-E the number of colonies were determined in duplicate culture plates derived from each tissue sample, and statistical analysis of the results was based on the number of mice per treatment group.
- Spleen-derived cultures from mice treated with ActRIIB(L79D 25-13 l)-hFc had twice the number of CFU-E colonies as did corresponding cultures from control mice (P ⁇ 0.05), whereas the number of BFU-E colonies did not differ significantly with treatment in vivo. The number of CFU-E or BFU-E colonies from bone marrow cultures also did not differ significantly with treatment.
- Male Sprague-Dawley rats (approximately 300 g) received a chronic jugular catheter at the vendor (Harlan).
- 20% of total blood volume was withdrawn from each rat over a 5 -minute period via the catheter under isoflurane anesthesia.
- the volume of blood removed was based on a value for total blood volume calculated according to the following relationship derived by Lee and co-workers (J Nucl Med 25:72-76, 1985) for rats with body weight greater than 12O g:
- ActRIIB5 an alternate, soluble form of ActRIIB (designated ActRIIB5), in which exon 4, including the ActRIIB transmembrane domain, has been replaced by a different C-terminal sequence (WO2007/053775).
- An leucine-to-aspartate substitution, or other acidic substitutions, may be performed at native position 79 (underlined and highlighted in grey) as described to construct the variant ActRIIB5(L79D), which has the following sequence:
- This variant may be connected to human Fc with a TGGG linker to generate a human ActRIIB5(L79D)-hFc fusion protein with the following sequence:
- This construct may be expressed in CHO cells.
- Example 19 Effects in Mice of Combined Treatment with EPO and a GDF Trap with a Truncated ActRIIB Extracellular Domain
- EPO induces formation of red blood cells by increasing the proliferation of erythroid precursors, whereas GDF Traps could potentially affect formation of red blood cells in ways that complement or enhance EPO's effects. Therefore, Applicants investigated the effect of combined treatment with EPO and ActRIIB(L79D 25-13 l)-hFc on erythropoietic parameters. Male C57BL/6 mice (9 weeks old) were given a single i.p.
- Spleens and femurs were processed to obtain erythroid precursor cells for flow cytometric analysis. After removal, the spleen was minced in Iscove's modified Dulbecco's medium containing 5% fetal bovine serum and mechanically dissociated by pushing through a 70- ⁇ m cell strainer with the plunger from a sterile 1-mL syringe. Femurs were cleaned of any residual muscle or connective tissue and ends were trimmed to permit collection of marrow by flushing the remaining shaft with Iscove's modified Dulbecco's medium containing 5% fetal bovine serum through a 21 -gauge needle connected to a 3-mL syringe.
- Cell suspensions were centrifuged (2000 rpm for 10 min) and the cell pellets resuspended in PBS containing 5% fetal bovine serum.
- Cells (10 6 ) from each tissue were incubated with anti-mouse IgG to block nonspecific binding, then incubated with fluorescently labeled antibodies against mouse cell-surface markers CD71 (transferrin receptor) and Terl 19 (an antigen associated with cell-surface glycophorin A), washed, and analyzed by flow cytrometry. Dead cells in the samples were excluded from analysis by counterstaining with propidium iodide.
- Erythroid differentiation in spleen or bone marrow was assessed by the degree of CD71 labeling, which decreases over the course of differentiation, and Terl 19 labeling, which is increased during terminal erythroid differentiation beginning with the proerythroblast stage (Socolovsky et al, 2001, Blood 98:3261-3273; Ying et al, 2006, Blood 108: 123-133).
- flow cytometry was used to determine the number of proerythroblasts (CD71 hlgh Terl 19 low ), basophilic erythroblasts (CD71 hlgh Terl 19 hlgh ), polychromatophilic + orthochromatophilic erythroblasts (CD71 med Ter 119 hlgh ), and late orthochromatophilic erythroblasts + reticulocytes (CD71 low Terl 19 hlgh ), as described.
- a GDF Trap with a truncated ActRIIB extracellular domain can be administered in combination with EPO to synergistically increase red blood cell formation in vivo.
- a GDF trap can moderate the strong proliferative effect of an EPO receptor activator alone and still permit target levels of red blood cells to be attained with lower doses of an EPO receptor activator, thereby avoiding potential adverse effects or other problems associated with higher levels of EPO receptor activation.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Immunology (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Hematology (AREA)
- Diabetes (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- General Engineering & Computer Science (AREA)
- Marine Sciences & Fisheries (AREA)
- Obesity (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (27)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2012524910A JP5909446B2 (ja) | 2009-08-13 | 2010-08-13 | 赤血球レベルを増大させるための、gdfトラップとエリスロポエチン受容体活性化因子とを組み合わせた使用 |
| CN202110421547.9A CN113171442B (zh) | 2009-08-13 | 2010-08-13 | Gdf捕获物和促红细胞生成素受体激活剂联合应用以增加红细胞水平 |
| CA2770822A CA2770822C (en) | 2009-08-13 | 2010-08-13 | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| MX2012001916A MX2012001916A (es) | 2009-08-13 | 2010-08-13 | Uso combinado de trampas gdf y activadores de receptor de eritropoyetina para incrementar los niveles de globulos rojos. |
| EP16186033.3A EP3117829B1 (en) | 2009-08-13 | 2010-08-13 | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| KR1020227045338A KR102606494B1 (ko) | 2009-08-13 | 2010-08-13 | 적혈구 수준을 증가시키기 위한 gdf 트랩과 에리트로포이에틴 수용체 활성인자의 병용 |
| BR122020019169-4A BR122020019169B1 (pt) | 2009-08-13 | 2010-08-13 | Polipeptídeo |
| KR1020127004678A KR101882521B1 (ko) | 2009-08-13 | 2010-08-13 | 적혈구 수준을 증가시키기 위한 gdf 트랩과 에리트로포이에틴 수용체 활성인자의 병용 |
| ES10808838T ES2796121T3 (es) | 2009-08-13 | 2010-08-13 | Uso combinado de trampas de GDF y activadores del receptor de la eritropoyetina para aumentar los niveles de glóbulos rojos |
| CN201510979490.9A CN105535938B (zh) | 2009-08-13 | 2010-08-13 | Gdf捕获物和促红细胞生成素受体激活剂联合应用以增加红细胞水平 |
| BR112012003232-1A BR112012003232B1 (pt) | 2009-08-13 | 2010-08-13 | Uso de um polipeptídeo em conjunto com um ativador do receptor de eritropoetina para aumentar os níveis de célula vermelha no sangue ou tratar anemia |
| IL287990A IL287990B (en) | 2009-08-13 | 2010-08-13 | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| KR1020187020803A KR20180085825A (ko) | 2009-08-13 | 2010-08-13 | 적혈구 수준을 증가시키기 위한 gdf 트랩과 에리트로포이에틴 수용체 활성인자의 병용 |
| AU2010282361A AU2010282361B2 (en) | 2009-08-13 | 2010-08-13 | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| CN201080045618.XA CN102655872B (zh) | 2009-08-13 | 2010-08-13 | Gdf捕获物和促红细胞生成素受体激活剂联合应用以增加红细胞水平 |
| CN202110417494.3A CN113082194B (zh) | 2009-08-13 | 2010-08-13 | Gdf捕获物和促红细胞生成素受体激活剂联合应用以增加红细胞水平 |
| KR1020207030283A KR20200124322A (ko) | 2009-08-13 | 2010-08-13 | 적혈구 수준을 증가시키기 위한 gdf 트랩과 에리트로포이에틴 수용체 활성인자의 병용 |
| RU2012109393/10A RU2592670C2 (ru) | 2009-08-13 | 2010-08-13 | Комбинированное применение ловушек gdf и активаторов рецепторов эритропоэтина для повышения содержания эритроцитов |
| KR1020197027722A KR102170682B1 (ko) | 2009-08-13 | 2010-08-13 | 적혈구 수준을 증가시키기 위한 gdf 트랩과 에리트로포이에틴 수용체 활성인자의 병용 |
| EP10808838.6A EP2464369B1 (en) | 2009-08-13 | 2010-08-13 | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| NZ598348A NZ598348A (en) | 2009-08-13 | 2010-08-13 | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| EP20197940.8A EP3838919A1 (en) | 2009-08-13 | 2010-08-13 | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| IL218052A IL218052A (en) | 2009-08-13 | 2012-02-12 | Use of an erythropoietin receptor plant and protein for combination therapy to increase red blood cell levels or to treat or prevent anemia |
| IL252045A IL252045B (en) | 2009-08-13 | 2017-05-01 | Isolated nucleic acid, expression vector and cell culture comprising the nucleic acid |
| IL25204417A IL252044B (en) | 2009-08-13 | 2017-05-01 | actriib variant polypeptides |
| IL252046A IL252046B (en) | 2009-08-13 | 2017-05-01 | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| IL275851A IL275851B (en) | 2009-08-13 | 2020-07-05 | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US12/583,177 US8058229B2 (en) | 2008-08-14 | 2009-08-13 | Method of increasing red blood cell levels or treating anemia in a patient |
| USPCT/US2009/004659 | 2009-08-13 | ||
| US12/583,177 | 2009-08-13 | ||
| PCT/US2009/004659 WO2010019261A1 (en) | 2008-08-14 | 2009-08-13 | Use of gdf traps to increase red blood cell levels |
| US30590110P | 2010-02-18 | 2010-02-18 | |
| US61/305,901 | 2010-02-18 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2011020045A1 true WO2011020045A1 (en) | 2011-02-17 |
| WO2011020045A9 WO2011020045A9 (en) | 2011-06-03 |
Family
ID=43586530
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2010/045509 Ceased WO2011020045A1 (en) | 2009-08-13 | 2010-08-13 | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
Country Status (13)
| Country | Link |
|---|---|
| EP (3) | EP3838919A1 (https=) |
| JP (4) | JP5909446B2 (https=) |
| KR (5) | KR102606494B1 (https=) |
| CN (7) | CN113082194B (https=) |
| AU (1) | AU2010282361B2 (https=) |
| BR (2) | BR112012003232B1 (https=) |
| CA (1) | CA2770822C (https=) |
| ES (2) | ES2844123T3 (https=) |
| IL (6) | IL287990B (https=) |
| MX (2) | MX2012001916A (https=) |
| NZ (3) | NZ712943A (https=) |
| RU (2) | RU2592670C2 (https=) |
| WO (1) | WO2011020045A1 (https=) |
Cited By (44)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2440577A4 (en) * | 2009-06-12 | 2013-01-23 | Acceleron Pharma Inc | SHORTEN ACTRIIB FC FUSION PROTEINS |
| WO2013059347A1 (en) * | 2011-10-17 | 2013-04-25 | Acceleron Pharma, Inc. | Methods and compositions for treating ineffective erythropoiesis |
| US8703694B2 (en) | 2009-06-08 | 2014-04-22 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
| US8703927B2 (en) | 2008-08-14 | 2014-04-22 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| WO2014066486A2 (en) | 2012-10-24 | 2014-05-01 | Celgene Corporation | Biomarker for use in treating anemia |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| US9138459B2 (en) | 2004-07-23 | 2015-09-22 | Acceleron Pharma Inc. | ACTRIIB-FC polynucleotides, polypeptides, and compositions |
| WO2015143403A1 (en) | 2014-03-21 | 2015-09-24 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating ineffective erythropoiesis by inhibiting activin b and/or gdf11 |
| US9163075B2 (en) | 2005-11-23 | 2015-10-20 | Acceleron Pharma Inc. | Isolated polynucleotide that encodes an ActRIIa-Fc fusion polypeptide |
| EP2844272A4 (en) * | 2012-04-06 | 2015-11-04 | Acceleron Pharma Inc | METHOD AND COMPOSITIONS FOR INCREASING RED BLOOD BODIES |
| WO2015192111A1 (en) * | 2014-06-13 | 2015-12-17 | Acceleron Pharma, Inc. | Methods and compositions for treating ulcers |
| US9353356B2 (en) | 2007-09-18 | 2016-05-31 | Acceleron Pharma Inc. | Activin-actriia antagonists for treating a follicle-stimulating horomone-secreting pituitary tumor |
| WO2016090077A1 (en) | 2014-12-03 | 2016-06-09 | Celgene Corporation | Activin-actrii antagonists and uses for treating anemia |
| WO2016090188A1 (en) * | 2014-12-03 | 2016-06-09 | Acceleron Pharma Inc. | Methods for treating myelodysplastic syndromes and sideroblastic anemias |
| US9399669B2 (en) | 2007-02-02 | 2016-07-26 | Acceleron Pharma Inc. | Variants derived from ActRIIB |
| WO2016128523A1 (en) * | 2015-02-12 | 2016-08-18 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods for predicting the responsiveness of a patient affected with malignant hematological disease to chemotherapy treatment and methods of treatment of such disease |
| US9493556B2 (en) | 2010-11-08 | 2016-11-15 | Acceleron Pharma Inc. | Actriia binding agents and uses thereof |
| US9526759B2 (en) | 2007-02-01 | 2016-12-27 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating or preventing breast cancer |
| US9572865B2 (en) | 2005-11-23 | 2017-02-21 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating multiple myeloma |
| US9617319B2 (en) | 2009-11-17 | 2017-04-11 | Acceleron Pharma Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| WO2017079591A3 (en) * | 2015-11-04 | 2017-09-21 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels and treating ineffective erythropoiesis |
| WO2018013936A1 (en) | 2016-07-15 | 2018-01-18 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| EP3212213A4 (en) * | 2014-10-30 | 2018-05-30 | Acceleron Pharma Inc. | Methods and compositions using gdf15 polypeptides for increasing red blood cells |
| WO2018231905A1 (en) | 2017-06-14 | 2018-12-20 | Celgene Corporation | Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia |
| US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
| US10239940B2 (en) | 2005-11-23 | 2019-03-26 | Acceleron Pharma Inc. | Method of promoting bone growth by an anti-actriia antibody |
| CN109789184A (zh) * | 2016-07-27 | 2019-05-21 | 阿塞勒隆制药公司 | 用于治疗骨髓纤维化的方法和组合物 |
| US10377996B2 (en) | 2008-08-14 | 2019-08-13 | Acceleron Pharma Inc. | Methods of identifying ActRIIB variants |
| US10548976B2 (en) | 2015-05-20 | 2020-02-04 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps |
| US10550170B2 (en) | 2015-11-23 | 2020-02-04 | Acceleron Pharma Inc. | Methods for treating vascular eye disorders with actrii antagonists |
| US10913782B2 (en) | 2015-04-22 | 2021-02-09 | Biogen Ma Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| EP3873441A4 (en) * | 2018-12-10 | 2022-06-29 | Arshintseva, Elena Valentinovna | A new use of the poloxamer as a pharmacologically active substance |
| EP4026556A1 (en) | 2016-10-05 | 2022-07-13 | Acceleron Pharma Inc. | Compositions and method for treating kidney disease |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| CN115317589A (zh) * | 2022-09-05 | 2022-11-11 | 中国海洋大学 | 脯氨酰羟化酶抑制剂及其应用 |
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12186370B1 (en) | 2020-11-05 | 2025-01-07 | Celgene Corporation | ACTRIIB ligand trap compositions and uses thereof |
| US12187783B2 (en) | 2016-10-20 | 2025-01-07 | Alivegen Inc | Methods for treating muscle wasting and bone disease using novel hybrid ActRIIB ligand trap proteins |
| US12240887B2 (en) | 2016-10-05 | 2025-03-04 | Acceleron Pharma Inc. | Variant ActRIIB proteins and uses thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
| US12522646B2 (en) | 2020-03-20 | 2026-01-13 | Keros Therapeutics, Inc. | Activin receptor type II chimeras and methods of use thereof |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2010204985A1 (en) | 2009-01-13 | 2011-08-04 | Acceleron Pharma Inc. | Methods for increasing adiponectin |
| HK1214504A1 (zh) * | 2012-10-24 | 2016-07-29 | 细胞基因公司 | 用於治療貧血的方法 |
| US20170240639A1 (en) * | 2016-02-22 | 2017-08-24 | Acceleron Pharma Inc. | Actrii antagonists for use in increasing immune activity |
| CN111466337B (zh) * | 2020-05-19 | 2022-04-19 | 山东大学齐鲁医院 | 一种腹主动脉瘤动物模型及其构建方法 |
| CN119198238A (zh) * | 2024-09-18 | 2024-12-27 | 广东省安家医健健康管理有限公司 | 一种地中海贫血检测系统及试剂盒 |
Citations (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US1265208A (en) | 1915-09-07 | 1918-05-07 | Edward C Kahn | Liquid-fuel burner. |
| WO1987005330A1 (en) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Method for enhancing glycoprotein stability |
| WO1990008822A1 (en) | 1989-02-03 | 1990-08-09 | Genetics Institute, Inc. | Erythropoietin receptor |
| US5283317A (en) | 1987-08-03 | 1994-02-01 | Ddi Pharmaceuticals, Inc. | Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols |
| US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
| WO1996026432A1 (en) | 1995-02-23 | 1996-08-29 | University Of Utah Research Foundation | Composite waveguide for solid phase binding assays |
| US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
| US5955280A (en) | 1995-04-11 | 1999-09-21 | The General Hospital Corporation | Reverse two-hybrid system |
| WO2000043781A2 (en) | 1999-01-21 | 2000-07-27 | Metamorphix, Inc. | Growth differentiation factor inhibitors and uses therefor |
| US6319499B1 (en) | 1994-07-26 | 2001-11-20 | Amgen Inc. | Methods for activating an erythropoietin receptor using antibodies |
| WO2006012627A2 (en) | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| WO2007053775A1 (en) | 2005-11-01 | 2007-05-10 | Amgen Inc. | Novel activin receptor and uses thereof |
| WO2008097541A2 (en) | 2007-02-02 | 2008-08-14 | Acceleron Pharma Inc. | Variants derived from actriib and uses therefor |
| WO2009158015A2 (en) * | 2008-06-26 | 2009-12-30 | Acceleron Pharma Inc. | Antagonists of actriib and uses for increasing red blood cell levels |
| WO2010019261A1 (en) * | 2008-08-14 | 2010-02-18 | Acceleron Pharma Inc. | Use of gdf traps to increase red blood cell levels |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ME00673B (me) * | 2000-05-15 | 2011-12-20 | Hoffmann La Roche | Nova farmaceutska smjesa |
| US7087224B2 (en) * | 2000-10-31 | 2006-08-08 | Amgen Inc. | Method of treating anemia by administering IL-1ra |
| DK2298301T3 (en) * | 2001-12-06 | 2018-10-01 | Fibrogen Inc | MEDICINALS FOR TREATMENT OF ANEMIA ASSOCIATED WITH Kidney Disease |
| DE10234192B4 (de) * | 2002-07-26 | 2009-11-26 | Epoplus Gmbh Co.Kg | Verwendung von Erythropoetin |
| ATE419846T1 (de) * | 2003-02-07 | 2009-01-15 | Prometic Biosciences Inc | Fettsäuren mittlerer kettenlänge, glyceride und analoga als stimulatoren der erythropoiese |
| GB0304424D0 (en) * | 2003-02-26 | 2003-04-02 | Glaxosmithkline Biolog Sa | Novel compounds |
| WO2006063101A2 (en) * | 2004-12-09 | 2006-06-15 | University Of Pittsburgh Of The Commonwealth System Of Higher Education | Vaccines for the rapid response to pandemic avian influenza |
| EP1884235A1 (en) * | 2005-04-26 | 2008-02-06 | Ajinomoto Co., Inc. | Myeloerythroid progenitor differentiation inducer |
| CA2623531C (en) * | 2005-10-07 | 2013-12-10 | Istituto Di Ricerche Di Biologia Molecolare P Angeletti Spa | Matrix metalloproteinase 11 vaccine |
| US20100003190A1 (en) * | 2006-12-08 | 2010-01-07 | Caritas St. Elizabeth's Medical Center Of Boston, Inc. | Method for protecting renal tubular epithelial cells from radiocontrast nephropathy (RCN) |
| CN104524548A (zh) * | 2006-12-18 | 2015-04-22 | 阿塞勒隆制药公司 | 活化素-actrii拮抗剂及在提高红细胞水平中的用途 |
-
2010
- 2010-08-13 AU AU2010282361A patent/AU2010282361B2/en active Active
- 2010-08-13 ES ES16186033T patent/ES2844123T3/es active Active
- 2010-08-13 WO PCT/US2010/045509 patent/WO2011020045A1/en not_active Ceased
- 2010-08-13 KR KR1020227045338A patent/KR102606494B1/ko active Active
- 2010-08-13 EP EP20197940.8A patent/EP3838919A1/en not_active Withdrawn
- 2010-08-13 NZ NZ712943A patent/NZ712943A/en unknown
- 2010-08-13 EP EP10808838.6A patent/EP2464369B1/en active Active
- 2010-08-13 KR KR1020207030283A patent/KR20200124322A/ko not_active Ceased
- 2010-08-13 ES ES10808838T patent/ES2796121T3/es active Active
- 2010-08-13 RU RU2012109393/10A patent/RU2592670C2/ru active
- 2010-08-13 CN CN202110417494.3A patent/CN113082194B/zh active Active
- 2010-08-13 CN CN202110421547.9A patent/CN113171442B/zh active Active
- 2010-08-13 JP JP2012524910A patent/JP5909446B2/ja active Active
- 2010-08-13 BR BR112012003232-1A patent/BR112012003232B1/pt active IP Right Grant
- 2010-08-13 KR KR1020197027722A patent/KR102170682B1/ko active Active
- 2010-08-13 IL IL287990A patent/IL287990B/en unknown
- 2010-08-13 CN CN201510979350.1A patent/CN105561295B/zh active Active
- 2010-08-13 CN CN201510979490.9A patent/CN105535938B/zh active Active
- 2010-08-13 EP EP16186033.3A patent/EP3117829B1/en active Active
- 2010-08-13 KR KR1020187020803A patent/KR20180085825A/ko not_active Ceased
- 2010-08-13 CN CN201510979291.8A patent/CN105412908B/zh active Active
- 2010-08-13 NZ NZ623113A patent/NZ623113A/en unknown
- 2010-08-13 CN CN202110879546.9A patent/CN113577291A/zh active Pending
- 2010-08-13 KR KR1020127004678A patent/KR101882521B1/ko active Active
- 2010-08-13 CA CA2770822A patent/CA2770822C/en active Active
- 2010-08-13 CN CN201080045618.XA patent/CN102655872B/zh active Active
- 2010-08-13 RU RU2016123808A patent/RU2642302C1/ru active
- 2010-08-13 BR BR122020019169-4A patent/BR122020019169B1/pt active IP Right Grant
- 2010-08-13 NZ NZ598348A patent/NZ598348A/en unknown
- 2010-08-13 MX MX2012001916A patent/MX2012001916A/es active IP Right Grant
-
2012
- 2012-02-12 IL IL218052A patent/IL218052A/en active IP Right Grant
- 2012-02-13 MX MX2019010341A patent/MX2019010341A/es unknown
-
2015
- 2015-12-03 JP JP2015236828A patent/JP2016034981A/ja not_active Withdrawn
-
2017
- 2017-05-01 IL IL252045A patent/IL252045B/en active IP Right Grant
- 2017-05-01 IL IL252046A patent/IL252046B/en active IP Right Grant
- 2017-05-01 IL IL25204417A patent/IL252044B/en active IP Right Grant
-
2018
- 2018-08-17 JP JP2018153528A patent/JP6860533B2/ja active Active
-
2020
- 2020-07-05 IL IL275851A patent/IL275851B/en unknown
- 2020-09-29 JP JP2020163806A patent/JP2020203953A/ja active Pending
Patent Citations (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US1265208A (en) | 1915-09-07 | 1918-05-07 | Edward C Kahn | Liquid-fuel burner. |
| WO1987005330A1 (en) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Method for enhancing glycoprotein stability |
| US5283317A (en) | 1987-08-03 | 1994-02-01 | Ddi Pharmaceuticals, Inc. | Intermediates for conjugation of polypeptides with high molecular weight polyalkylene glycols |
| WO1990008822A1 (en) | 1989-02-03 | 1990-08-09 | Genetics Institute, Inc. | Erythropoietin receptor |
| US5278065A (en) | 1989-02-03 | 1994-01-11 | Genetics Institute, Inc. | Recombinant DNA endoding an erythropoietin receptor |
| US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
| US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
| US6319499B1 (en) | 1994-07-26 | 2001-11-20 | Amgen Inc. | Methods for activating an erythropoietin receptor using antibodies |
| WO1996026432A1 (en) | 1995-02-23 | 1996-08-29 | University Of Utah Research Foundation | Composite waveguide for solid phase binding assays |
| US5955280A (en) | 1995-04-11 | 1999-09-21 | The General Hospital Corporation | Reverse two-hybrid system |
| US5965368A (en) | 1995-04-11 | 1999-10-12 | The General Hospital Corporation | Reverse two-hybrid systems |
| WO2000043781A2 (en) | 1999-01-21 | 2000-07-27 | Metamorphix, Inc. | Growth differentiation factor inhibitors and uses therefor |
| WO2006012627A2 (en) | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| WO2007053775A1 (en) | 2005-11-01 | 2007-05-10 | Amgen Inc. | Novel activin receptor and uses thereof |
| WO2008097541A2 (en) | 2007-02-02 | 2008-08-14 | Acceleron Pharma Inc. | Variants derived from actriib and uses therefor |
| WO2009158015A2 (en) * | 2008-06-26 | 2009-12-30 | Acceleron Pharma Inc. | Antagonists of actriib and uses for increasing red blood cell levels |
| WO2010019261A1 (en) * | 2008-08-14 | 2010-02-18 | Acceleron Pharma Inc. | Use of gdf traps to increase red blood cell levels |
Non-Patent Citations (98)
| Title |
|---|
| ADAMSON: "Harrison's Principles of Internal Medicine, 17th ed.", 2008, MCGRAW HILL, pages: 628 - 634 |
| ADVANCED CHEMTECH MODEL, vol. 396 |
| APLIN; WRISTON, CRC CRIT. REV. BIOCHEM., 1981, pages 259 - 306 |
| ASHMORE ET AL., GROWTH, vol. 38, 1974, pages 501 - 507 |
| ATTISANO ET AL., CELL, vol. 68, 1992, pages 97 - 108 |
| ATTISANO ET AL., CELL, vol. 68, no. 1, 10 January 1992 (1992-01-10), pages 97 - 108 |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1992, JOHN WILEY & SONS |
| BARTEL ET AL., BIOTECHNIQUES, vol. 14, 1993, pages 920 - 924 |
| BODANSKY, M.: "Principles of Peptide Synthesis", 1993, SPRINGER VERLAG |
| BRON ET AL., SEMIN ONCOL, vol. 28, no. 8, 2001, pages 1 - 6 |
| BROWN ET AL., GROWTH FACTORS, vol. 3, 1990, pages 35 - 43 |
| BUNN, N ENGL J MED, vol. 346, no. 7, 2002, pages 522 - 523 |
| CHIBA ET AL., NATURE, vol. 362, 1993, pages 646 |
| CHIBA ET AL., PROC NATL ACAD SCI USA, vol. 90, 1993, pages 11593 |
| D'ANDREA ET AL., CELL, vol. 57, 1989, pages 277 |
| DELANTY ET AL., NEUROLOGY, vol. 49, 1997, pages 686 - 689 |
| DEMETRI ET AL., J CLIN ONCOL, vol. 16, 1998, pages 3412 - 3425 |
| DENNLER ET AL., EMBO, vol. 17, 1998, pages 3091 - 3100 |
| DEPAOLO ET AL., PROC SOC EP BIOL MED., vol. 198, 1991, pages 500 - 512 |
| DYSON ET AL., CURR BIOL., vol. 7, 1997, pages 81 - 84 |
| EDGE ET AL., ANAL. BIOCHEM., vol. 118, 1981, pages 131 |
| ESCHBACH ET AL., N ENGL J MED, vol. 316, 1987, pages 73 |
| ESTEY, CURR OPIN HEMATOL, vol. 10, 2003, pages 60 - 67 |
| FRALEY ET AL., TRENDS BIOCHEM. SCI., vol. 6, 1981, pages 77 |
| GAFTER ET AL., KIDNEY INT, vol. 45, 1994, pages 224 - 231 |
| GAMER ET AL., DEV BIOL., vol. 208, 1999, pages 222 - 32 |
| GAMER ET AL., DEV BIOL., vol. 229, 2001, pages 407 - 20 |
| GAMER ET AL., DEV. BIOL., vol. 208, 1999, pages 222 - 232 |
| GANZ, J AM SOC NEPHROL, vol. 18, 2007, pages 394 - 400 |
| GLASPY ET AL., J CLIN ONCOL, vol. 15, 1997, pages 1218 - 1234 |
| GLASPY, ANNU REV MED, vol. 60, 2009, pages 181 - 192 |
| GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS |
| GONZALEZ-CADAVID ET AL., PNAS, vol. 95, 1998, pages 14938 - 43 |
| GRANT G. A.: "Synthetic Peptides: A User's Guide", 1992, W. H. FREEMAN AND COMPANY |
| GROBET ET AL., NAT GENET., vol. 17, no. l, 1997, pages 71 - 4 |
| GROOPMAN ET AL., J NATL CANCER INST, vol. 91, 1999, pages 1616 - 1634 |
| HAKIMUDDIN ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 259, 1987, pages 52 |
| HILDEN ET AL., BLOOD, vol. 83, no. 8, 15 April 1994 (1994-04-15), pages 2163 - 70 |
| HOCHULI ET AL., J. CHROMATOGRAPHY, vol. 411, 1987, pages 177 |
| HORL ET AL., NEPHROL DIAL TRANSPLANT, vol. 15, 2000, pages 43 - 50 |
| HORL ET AL., NEPHROL DIAL TRANSPLANT, vol. 15, no. 4, 2000, pages 51 - 56 |
| IWABUCHI ET AL., ONCOGENE, vol. 8, 1993, pages 1693 - 1696 |
| JACOBS ET AL., NEPHROL DIAL TRANSPLANT, vol. 15, 2000, pages 15 - 19 |
| JAKOBY WB ET AL., METHODS IN ENZYMOLOGY, vol. 46, 1974, pages 1 |
| JANKNECHT ET AL., PNAS USA, vol. 88, pages 8972 |
| JELKMANN ET AL., CRIT REV ONCOL. HEMATOL, vol. 67, 2008, pages 39 - 61 |
| JONES ET AL., BLOOD, vol. 76, 1990, pages 31 |
| KAMBADUR ET AL., GENOME RES., vol. 7, 1997, pages 910 - 915 |
| KLINGMULLER ET AL., CELL, vol. 80, 1995, pages 729 - 738 |
| KOURY ET AL., SCIENCE, vol. 248, 1990, pages 378 - 381 |
| KRAPF ET AL., CLIN J AM SOC NEPHROL, vol. 4, 2009, pages 470 - 480 |
| LEE, J NUCL MED, vol. 25, 1985, pages 72 - 76 |
| LEE; MCPHERRON, PROC. NATL. ACAD. SCI., vol. 98, 2001, pages 9306 - 9311 |
| LEVIN ET AL., AM J KIDNEY DIS, vol. 27, 1999, pages 347 - 354 |
| LIBOI ET AL., PROC NATL ACAD SCI USA, vol. 90, 1993, pages 11351 - 11355 |
| LIBOI, PROC NATL ACAD SCI USA |
| MACDOUGALL ET AL., N ENGL J MED, vol. 361, 2009, pages 1848 - 1855 |
| MACIAS-SILVA ET AL., J BIOL CHEM., vol. 273, 1998, pages 25628 - 36 |
| MADURA ET AL., J BIOL CHEM, vol. 268, 1993, pages 12046 - 12054 |
| MAKOTO SHIOZAKI ET AL.: "In vivo treatment with erythroid differentiation factor (EDF /Activin A) increases erythroid precursors (CFU-E and BFU-E) in mice", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 3, 1989, pages 1155 - 1161, XP024840019 * |
| MANNINO ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 682 |
| MASSAGUE, NAT. REV. MOL. CELL BIOL., vol. 1, 2000, pages 169 - 178 |
| MATHEWS; AND, CELL, vol. 65, 1991, pages 973 - 982 |
| MATTHEW M HSEIH ET AL.: "HIF prolyl hydroxylase inhibition results in endogenous erythropoietin induction, erythrocytosis, and modest fetal haemoglobin expression in rhesus macaques", BLOOD, vol. 110, no. 6, 2007, pages 2140 - 2147, XP008152440 * |
| MCPHERRON ET AL., NAT. GENET., vol. 22, 1999, pages 260 - 264 |
| MCPHERRON ET AL., NATURE, vol. 387, 1997, pages 83 - 90 |
| MCPHERRON; LEE, PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 12457 - 12461 |
| MIYAZONO ET AL., J. BIOL. CHEM., vol. 263, 1988, pages 6407 - 6415 |
| MURATA ET AL., PNAS, vol. 85, 1988, pages 2434 |
| NAKANO ET AL., BLOOD, vol. 104, 2004, pages 4300 - 4307 |
| NAKASHIMA ET AL., MECH. DEV., vol. 80, 1999, pages 185 - 189 |
| NISSENSON, AM J KIDNEY DIS, vol. 20, no. 1, 1992, pages 21 - 24 |
| NOGUCHI ET AL., MOL CELL BIOL, vol. 8, 1988, pages 2604 |
| OH, GENES DEV., vol. 16, 2002, pages 2749 - 54 |
| PATEL ET AL., J BIOL CHEM, vol. 267, 1992, pages 21300 |
| PHARR ET AL., PROC NATL ACAD SCI USA, vol. 90, 1993, pages 938 |
| QURESHI ET AL., PROC NATL ACAD SCI USA, vol. 96, 1999, pages 12156 - 12161 |
| REVICKI ET AL., AM J KIDNEY DIS, vol. 25, 1995, pages 548 - 554 |
| SAKUMA, GENES CELLS., vol. 7, 2002, pages 401 - 12 |
| SAMBROOK; FRITSCH; MANIATIS: "Molecular Cloning A Laboratory Manual, 2nd ed.", 1989, COLD SPRING HARBOR LABORATORY PRESS, article "Chapters 16 and 17" |
| SCHUELKE ET AL., N ENGL J MED, vol. 350, 2004, pages 2682 - 8 |
| See also references of EP2464369A4 |
| SINGIBARTI, J. CLIN INVESTIG, vol. 72, no. 6, 1994, pages S36 - S43 |
| SOCOLOVSKY ET AL., BLOOD, vol. 98, 2001, pages 3261 - 3273 |
| STEAD ET AL., BLOOD, vol. 108, 2006, pages 1830 - 1834 |
| SWATLAND; KIEFFER, J. ANIM. SCI., vol. 38, 1994, pages 752 - 757 |
| THOTAKURA, MCTH. ENZYMOL., vol. 138, 1987, pages 350 |
| VIDAL; LEGRAIN, NUCLEIC ACIDS RES, vol. 27, 1999, pages 919 - 29 |
| VIDAL; LEGRAIN, TRENDS BIOTECHNOL, vol. 17, 1999, pages 374 - 81 |
| WAKEFIELD ET AL., J. BIOL. CHEM., vol. 263, 1988, pages 7646 - 7654 |
| WEATHERALL; PROVAN, LANCET, vol. 355, 2000, pages 1169 - 1175 |
| WINKELMAN ET AL., BLOOD, vol. 76, 1990, pages 24 |
| WOODRUFF, BIOCHEM PHARMACOL., vol. 55, 1998, pages 953 - 963 |
| WU ET AL., NEURON., vol. 37, 2003, pages 197 - 207 |
| YAMASHITA ET AL., J. CELL BIOL., vol. 130, 1995, pages 217 - 226 |
| YCO; WHITMAN, MOL. CELL, vol. 7, 2001, pages 949 - 957 |
| YING ET AL., BLOOD, vol. 108, 2006, pages 123 - 133 |
| ZERVOS ET AL., CELL, vol. 72, 1993, pages 223 - 232 |
Cited By (114)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9138459B2 (en) | 2004-07-23 | 2015-09-22 | Acceleron Pharma Inc. | ACTRIIB-FC polynucleotides, polypeptides, and compositions |
| US11129873B2 (en) | 2005-11-23 | 2021-09-28 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
| US9572865B2 (en) | 2005-11-23 | 2017-02-21 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating multiple myeloma |
| US9163075B2 (en) | 2005-11-23 | 2015-10-20 | Acceleron Pharma Inc. | Isolated polynucleotide that encodes an ActRIIa-Fc fusion polypeptide |
| US10239940B2 (en) | 2005-11-23 | 2019-03-26 | Acceleron Pharma Inc. | Method of promoting bone growth by an anti-actriia antibody |
| US10071135B2 (en) | 2005-11-23 | 2018-09-11 | Acceleron Pharma Inc. | Method of identifying an agent that promotes bone growth or increases bone density |
| US10093707B2 (en) | 2006-12-18 | 2018-10-09 | Acceleron Pharma Inc. | Antagonists of activin-ActRIIa and uses for increasing red blood cell levels |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| US9526759B2 (en) | 2007-02-01 | 2016-12-27 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating or preventing breast cancer |
| US9399669B2 (en) | 2007-02-02 | 2016-07-26 | Acceleron Pharma Inc. | Variants derived from ActRIIB |
| US10259861B2 (en) | 2007-02-02 | 2019-04-16 | Acceleron Pharma Inc. | Variants derived from ActRIIB and uses therefor |
| US9353356B2 (en) | 2007-09-18 | 2016-05-31 | Acceleron Pharma Inc. | Activin-actriia antagonists for treating a follicle-stimulating horomone-secreting pituitary tumor |
| US11155791B2 (en) | 2008-08-14 | 2021-10-26 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US10131700B2 (en) | 2008-08-14 | 2018-11-20 | Acceleron Pharma Inc. | Methods for treating refractory anemia with ringed sideroblasts |
| US11168311B2 (en) | 2008-08-14 | 2021-11-09 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US10889626B2 (en) | 2008-08-14 | 2021-01-12 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US10377996B2 (en) | 2008-08-14 | 2019-08-13 | Acceleron Pharma Inc. | Methods of identifying ActRIIB variants |
| US11162085B2 (en) | 2008-08-14 | 2021-11-02 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US9439945B2 (en) | 2008-08-14 | 2016-09-13 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US9932379B2 (en) | 2008-08-14 | 2018-04-03 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US10689427B2 (en) | 2008-08-14 | 2020-06-23 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US8703927B2 (en) | 2008-08-14 | 2014-04-22 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US10829533B2 (en) | 2008-08-14 | 2020-11-10 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US10829532B2 (en) | 2008-08-14 | 2020-11-10 | Acceleron Pharma Inc. | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| US9790284B2 (en) | 2009-06-08 | 2017-10-17 | Acceleron Pharma Inc. | Methods for increasing thermogenic adipocytes |
| US10968282B2 (en) | 2009-06-08 | 2021-04-06 | Acceleron Pharma Inc. | Methods for screening compounds for increasing thermogenic adipocytes |
| US8703694B2 (en) | 2009-06-08 | 2014-04-22 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
| US9181533B2 (en) | 2009-06-12 | 2015-11-10 | Acceleron Pharma, Inc. | Truncated ACTRIIB-FC fusion protein |
| US9745559B2 (en) | 2009-06-12 | 2017-08-29 | Acceleron Pharma Inc. | Method for decreasing the body fat content in a subject by administering an ActRIIB protein |
| EP2440577A4 (en) * | 2009-06-12 | 2013-01-23 | Acceleron Pharma Inc | SHORTEN ACTRIIB FC FUSION PROTEINS |
| US11066654B2 (en) | 2009-06-12 | 2021-07-20 | Acceleron Pharma Inc. | Methods and compositions for reducing serum lipids |
| US10358633B2 (en) | 2009-06-12 | 2019-07-23 | Acceleron Pharma Inc. | Method for producing an ActRIIB-Fc fusion polypeptide |
| EP3805259A1 (en) * | 2009-06-12 | 2021-04-14 | Acceleron Pharma Inc. | Truncated actriib-fc fusion proteins |
| US10968262B2 (en) | 2009-11-17 | 2021-04-06 | Acceleron Pharma Inc. | Methods of increasing sarcolemmal utrophin |
| US9617319B2 (en) | 2009-11-17 | 2017-04-11 | Acceleron Pharma Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| US9493556B2 (en) | 2010-11-08 | 2016-11-15 | Acceleron Pharma Inc. | Actriia binding agents and uses thereof |
| EP3520805A1 (en) * | 2011-10-17 | 2019-08-07 | Acceleron Pharma Inc. | Compositions for treating myelofibrosis |
| AU2018247262B2 (en) * | 2011-10-17 | 2020-12-24 | Acceleron Pharma, Inc. | Methods and compositions for treating ineffective erythropoiesis |
| EP3875104A1 (en) * | 2011-10-17 | 2021-09-08 | Acceleron Pharma Inc. | Compositions for treating myelofibrosis |
| WO2013059347A1 (en) * | 2011-10-17 | 2013-04-25 | Acceleron Pharma, Inc. | Methods and compositions for treating ineffective erythropoiesis |
| AU2012326207B2 (en) * | 2011-10-17 | 2016-12-15 | Acceleron Pharma, Inc. | Methods and compositions for treating ineffective erythropoiesis |
| EA034563B1 (ru) * | 2011-10-17 | 2020-02-20 | Акселерон Фарма Инк. | Способ лечения или предотвращения перегрузки железом у пациента с талассемией |
| US11807673B2 (en) | 2012-04-06 | 2023-11-07 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
| EP3351260A1 (en) | 2012-04-06 | 2018-07-25 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
| US9809636B2 (en) | 2012-04-06 | 2017-11-07 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels comprising administering BMP9 |
| US10829534B2 (en) | 2012-04-06 | 2020-11-10 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
| US10344066B2 (en) | 2012-04-06 | 2019-07-09 | Acceleron Pharma Inc. | Methods and compositions for increasing red blood cells |
| EP2844272A4 (en) * | 2012-04-06 | 2015-11-04 | Acceleron Pharma Inc | METHOD AND COMPOSITIONS FOR INCREASING RED BLOOD BODIES |
| EP2912462A4 (en) * | 2012-10-24 | 2016-06-15 | Celgene Corp | BIOMARKERS FOR USE IN THE TREATMENT OF ANEMIA |
| AU2013334659B2 (en) * | 2012-10-24 | 2019-07-11 | Celgene Corporation | Biomarker for use in treating anemia |
| WO2014066486A2 (en) | 2012-10-24 | 2014-05-01 | Celgene Corporation | Biomarker for use in treating anemia |
| EP3608419A1 (en) * | 2012-10-24 | 2020-02-12 | Celgene Corporation | Biomarker for use in treating anemia |
| US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
| EP3119418A4 (en) * | 2014-03-21 | 2018-01-03 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels and treating ineffective erythropoiesis by inhibiting activin b and/or gdf11 |
| WO2015143403A1 (en) | 2014-03-21 | 2015-09-24 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating ineffective erythropoiesis by inhibiting activin b and/or gdf11 |
| CN106659769A (zh) * | 2014-03-21 | 2017-05-10 | 阿塞勒隆制药公司 | 用于通过抑制激活素b和/或gdf11来提高红细胞水平和治疗无效性红细胞生成的方法 |
| CN107135646B (zh) * | 2014-06-13 | 2022-03-15 | 阿塞勒隆制药公司 | 用于治疗溃疡的方法和组合物 |
| WO2015192111A1 (en) * | 2014-06-13 | 2015-12-17 | Acceleron Pharma, Inc. | Methods and compositions for treating ulcers |
| US10487144B2 (en) | 2014-06-13 | 2019-11-26 | Acceleron Pharma Inc. | Methods for treating ulcers in a hemoglobinopathy anemia with a soluble actRIIB polypeptide |
| CN114699529A (zh) * | 2014-06-13 | 2022-07-05 | 阿塞勒隆制药公司 | 用于治疗溃疡的方法和组合物 |
| US11260107B2 (en) | 2014-06-13 | 2022-03-01 | Acceleron Pharma Inc. | Methods and compositions for treating ulcers |
| AU2015274277B2 (en) * | 2014-06-13 | 2021-03-18 | Acceleron Pharma, Inc. | Methods and compositions for treating ulcers |
| CN107135646A (zh) * | 2014-06-13 | 2017-09-05 | 阿塞勒隆制药公司 | 用于治疗溃疡的方法和组合物 |
| US9850298B2 (en) | 2014-06-13 | 2017-12-26 | Acceleron Pharma Inc. | Methods for treating ulcers in thalassemia syndrome with an ActRIIB polypeptide |
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| EP3212213A4 (en) * | 2014-10-30 | 2018-05-30 | Acceleron Pharma Inc. | Methods and compositions using gdf15 polypeptides for increasing red blood cells |
| US10603359B2 (en) | 2014-10-30 | 2020-03-31 | Acceleron Pharma Inc. | Methods and compositions using GDF15 polypeptides for increasing red blood cells |
| US11642394B2 (en) | 2014-10-30 | 2023-05-09 | Acceleron Pharma Inc. | Methods and compositions using GDF15 polypeptides for increasing red blood cells |
| EP3922259A1 (en) * | 2014-10-30 | 2021-12-15 | Acceleron Pharma Inc. | Methods and compositions using gdf15 polypeptides for increasing red blood cells |
| TWI758237B (zh) * | 2014-12-03 | 2022-03-21 | 美商艾瑟勒朗法瑪公司 | 治療骨髓發育不良症候群及含鐵胚血球性貧血(sideroblastic anemias)之方法 |
| US10189882B2 (en) | 2014-12-03 | 2019-01-29 | Acceleron Pharma Inc. | Methods for treating myelodysplastic syndromes and sideroblastic anemias |
| AU2015358469B2 (en) * | 2014-12-03 | 2021-05-27 | Acceleron Pharma Inc. | Activin-ActRII antagonists and uses for treating anemia |
| EP4233889A3 (en) * | 2014-12-03 | 2023-10-11 | Celgene Corporation | Activin-actrii antagonists and uses for treating myelodysplastic syndrome |
| AU2021212084B2 (en) * | 2014-12-03 | 2023-05-18 | Acceleron Pharma Inc. | Activin-ActRII antagonists and uses for treating anemia |
| EP3227675A4 (en) * | 2014-12-03 | 2018-08-08 | Celgene Corporation | Activin-actrii antagonists and uses for treating anemia |
| US10829531B2 (en) | 2014-12-03 | 2020-11-10 | Acceleron Pharma Inc. | Methods for treating myelodysplastic syndromes and sideroblastic anemias |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| AU2015358398B2 (en) * | 2014-12-03 | 2021-10-07 | Acceleron Pharma Inc. | Methods for treating myelodysplastic syndromes and sideroblastic anemias |
| WO2016090077A1 (en) | 2014-12-03 | 2016-06-09 | Celgene Corporation | Activin-actrii antagonists and uses for treating anemia |
| WO2016090188A1 (en) * | 2014-12-03 | 2016-06-09 | Acceleron Pharma Inc. | Methods for treating myelodysplastic syndromes and sideroblastic anemias |
| WO2016128523A1 (en) * | 2015-02-12 | 2016-08-18 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods for predicting the responsiveness of a patient affected with malignant hematological disease to chemotherapy treatment and methods of treatment of such disease |
| US11292826B2 (en) | 2015-04-22 | 2022-04-05 | Biogen Ma Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US10913782B2 (en) | 2015-04-22 | 2021-02-09 | Biogen Ma Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US11932677B2 (en) | 2015-04-22 | 2024-03-19 | Alivegen Inc. | Hybrid ActRIIB ligand trap proteins for treating muscle wasting diseases |
| US10548976B2 (en) | 2015-05-20 | 2020-02-04 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps |
| US11123430B2 (en) | 2015-11-04 | 2021-09-21 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels and treating ineffective erythropoiesis |
| WO2017079591A3 (en) * | 2015-11-04 | 2017-09-21 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels and treating ineffective erythropoiesis |
| US10550170B2 (en) | 2015-11-23 | 2020-02-04 | Acceleron Pharma Inc. | Methods for treating vascular eye disorders with actrii antagonists |
| US11524990B2 (en) | 2015-11-23 | 2022-12-13 | Acceleron Pharma Inc. | Methods for treating vascular eye disorders with ActRII antagonists |
| EP3928784A1 (en) | 2016-07-15 | 2021-12-29 | Acceleron Pharma Inc. | Compositions comprising actriia polypeptides for use in treating pulmonary hypertension |
| WO2018013936A1 (en) | 2016-07-15 | 2018-01-18 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US12194076B2 (en) | 2016-07-27 | 2025-01-14 | Acceleron Pharma Inc. | Methods and compositions for treating myelofibrosis |
| CN109789184A (zh) * | 2016-07-27 | 2019-05-21 | 阿塞勒隆制药公司 | 用于治疗骨髓纤维化的方法和组合物 |
| EP3490582A4 (en) * | 2016-07-27 | 2020-04-01 | Acceleron Pharma Inc. | METHOD AND COMPOSITIONS FOR TREATING MYELOFIBROSE |
| AU2017302282B2 (en) * | 2016-07-27 | 2024-07-25 | Acceleron Pharma Inc. | Methods and compositions for treating myelofibrosis |
| US12240887B2 (en) | 2016-10-05 | 2025-03-04 | Acceleron Pharma Inc. | Variant ActRIIB proteins and uses thereof |
| EP4026556A1 (en) | 2016-10-05 | 2022-07-13 | Acceleron Pharma Inc. | Compositions and method for treating kidney disease |
| US12187783B2 (en) | 2016-10-20 | 2025-01-07 | Alivegen Inc | Methods for treating muscle wasting and bone disease using novel hybrid ActRIIB ligand trap proteins |
| US11090361B2 (en) | 2016-11-10 | 2021-08-17 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11717558B2 (en) | 2016-11-10 | 2023-08-08 | Keros Therapeutics, Inc. | Nucleic acid molecules encoding activin receptor type IIA variants |
| US12350313B2 (en) | 2016-11-10 | 2025-07-08 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11013785B2 (en) | 2016-11-10 | 2021-05-25 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12582700B2 (en) | 2016-11-10 | 2026-03-24 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| EP4454707A2 (en) | 2017-06-14 | 2024-10-30 | Celgene Corporation | Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia |
| WO2018231905A1 (en) | 2017-06-14 | 2018-12-20 | Celgene Corporation | Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12269858B2 (en) | 2018-01-12 | 2025-04-08 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| EP3873441A4 (en) * | 2018-12-10 | 2022-06-29 | Arshintseva, Elena Valentinovna | A new use of the poloxamer as a pharmacologically active substance |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
| US12522646B2 (en) | 2020-03-20 | 2026-01-13 | Keros Therapeutics, Inc. | Activin receptor type II chimeras and methods of use thereof |
| US12186370B1 (en) | 2020-11-05 | 2025-01-07 | Celgene Corporation | ACTRIIB ligand trap compositions and uses thereof |
| CN115317589A (zh) * | 2022-09-05 | 2022-11-11 | 中国海洋大学 | 脯氨酰羟化酶抑制剂及其应用 |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10889626B2 (en) | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels | |
| US11168311B2 (en) | Methods for treating anemia in a subject in need thereof | |
| CA2770822C (en) | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels | |
| AU2021209153A1 (en) | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels | |
| AU2017204230A1 (en) | Use of GDF traps to increase red blood cell levels |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080045618.X Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10808838 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012524910 Country of ref document: JP Ref document number: 2770822 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 218052 Country of ref document: IL |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2012/001916 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010282361 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 20127004678 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010808838 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012109393 Country of ref document: RU |
|
| ENP | Entry into the national phase |
Ref document number: 2010282361 Country of ref document: AU Date of ref document: 20100813 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112012003232 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112012003232 Country of ref document: BR Kind code of ref document: A2 Effective date: 20120213 |