WO2010144508A1 - Glucose-regulating polypeptides and methods of making and using same - Google Patents
Glucose-regulating polypeptides and methods of making and using same Download PDFInfo
- Publication number
- WO2010144508A1 WO2010144508A1 PCT/US2010/037855 US2010037855W WO2010144508A1 WO 2010144508 A1 WO2010144508 A1 WO 2010144508A1 US 2010037855 W US2010037855 W US 2010037855W WO 2010144508 A1 WO2010144508 A1 WO 2010144508A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- xten
- fusion protein
- sequence
- gpxten
- regulating peptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/605—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/12—Antidiarrhoeals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/02—Drugs for disorders of the urinary system of urine or of the urinary tract, e.g. urine acidifiers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/04—Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/57563—Vasoactive intestinal peptide [VIP]; Related peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2200/00—Function of food ingredients
- A23V2200/30—Foods, ingredients or supplements having a functional effect on health
- A23V2200/328—Foods, ingredients or supplements having a functional effect on health having effect on glycaemic control and diabetes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/31—Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
Definitions
- Glucose-regulating peptides are critical regulatory components of human metabolism. Various peptides have been described with biological effects that result in either an increase or decrease in serum glucose levels. These peptides tend to be highly homologous to each other, even when they possess opposite biological functions. Many glucose regulating peptides, including those used as therapeutics, are typically labile molecules exhibiting short shelf-lives, particularly when formulated in aqueous solutions. In addition, many glucose regulating peptides have limited solubility, or become aggregated during recombinant productions, requiring complex solubilization and refolding procedures. Various chemical polymers can be attached to such peptides and proteins to modify their properties.
- hydrophilic polymers that have flexible conformations and are well hydrated in aqueous solutions.
- a frequently used polymer is polyethylene glycol (PEG). These polymers tend to have large hydrodynamic radii relative to their molecular weight (Kubetzko, S., et al. (2005) MoI Pharmacol, 68: 1439-54), and can result in enhanced pharmacokinetic properties.
- PEG polyethylene glycol
- the chemical conjugation of polymers to proteins requires complex multi-step processes; typically, the protein component needs to be produced and purified prior to the chemical conjugation step and the conjugation step can result in the formation of heterogeneous product mixtures that need to be separated, leading to significant product loss. Alternatively, such mixtures can be used as the final pharmaceutical product, but are difficult to standardize.
- the present disclosure is directed to compositions and methods that can be useful for or the treatment of any disease, disorder or condition that is improved, ameliorated, or inhibited by the administration of a glucose regulating peptide.
- the present invention provides compositions of fusion proteins comprising one or more extended recombinant polypeptides with a non-repetitive sequence and/or unstructured conformation (XTEN) linked to glucose regulating peptide (GP).
- XTEN non-repetitive sequence and/or unstructured conformation linked to glucose regulating peptide
- GP glucose regulating peptide
- the present disclosure is directed to pharmaceutical compositions comprising the fusion proteins and the uses thereof for treating glucose regulating peptide -related diseases, disorders or conditions.
- the invention provides an isolated fusion protein, comprising a glucose regulating peptide that is at least about 90%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% identical to an amino acid sequence selected from Table 1 , wherein said glucose regulating peptide is linked to an extended recombinant polypeptide (XTEN) of at least about 100, or at least about 200, or at least about 400, or at least about 800, or at least about 900, or at least about 1000, or at least about 2000, up to about 3000 amino acids residues, wherein the XTEN is characterized in that (a) the XTEN comprises at least about 200 contiguous amino acids that exhibits at least about 90%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% identical to a comparable length of an amino acid sequence selected from a sequence shown in Table 5; (b) the XTEN sequence lacks a predicted T-cell epitope when analyzed by TE
- the glucose regulating peptide of the isolated fusion protein is human glucose regulating peptide.
- the isolated fusion protein comprises at least a second XTEN, wherein the fusion protein adopts a multiple-XTEN configuration shown in Table 5, or a variant thereof.
- the XTEN sequence of the GPXTEN fusion proteins is characterized in that is has greater than 90% random coil formation, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% random coil formation as determined by GOR algorithm; and the XTEN sequence has less than 2% alpha helices and 2% beta-sheets as determined by the Chou-Fasman algorithm.
- the invention provides GPXTEN fusion proteins, wherein the XTEN is characterized in that the sum of asparagine and glutamine residues is less than 10% of the total amino acid sequence of the XTEN, the sum of methionine and tryptophan residues is less than 2% of the total amino acid sequence of the XTEN, the XTEN sequence has less than 5% amino acid residues with a positive charge, the XTEN sequence has greater than 90% random coil formation, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% random coil formation as determined by GOR algorithm; and the XTEN sequence has less than 2% alpha helices and 2% beta-sheets as determined by the Chou-Fasman algorithm.
- the invention provides GPXTEN fusion proteins, wherein the XTEN is characterized in that at least about 80%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% of the XTEN sequence consists of non-overlapping sequence motifs wherein each of the sequence motifs has about 9 to about 14 amino acid residues and wherein the sequence of any two contiguous amino acid residues does not occur more than twice in each of the sequence motifs the sequence motifs consist of four to six types of amino acids selected from glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P).
- G glycine
- A alanine
- S serine
- T threonine
- E glutamate
- P proline
- no one type of amino acid constitutes more than 30% of the XTEN sequence of the GPXTEN.
- the XTEN has a sequence in which no three contiguous amino acids are identical unless the amino acid is serine, in which case no more than three contiguous amino acids are serine residues.
- at least about 80%, or about 90%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99%, or 100% of the XTEN sequence consists of non-overlapping sequence motifs, wherein each of the sequence motifs has 12 amino acid residues.
- the XTEN sequence consists of non-overlapping sequence motifs, wherein the sequence motifs are from one or more sequences of Table 2.
- GPXTEN fusion proteins exhibits enhanced pharmacokinetic properties compared to GP not linked to XTEN, wherein the enhanced properties include but are not limited to longer terminal half-life, larger area under the curve, increased time in which the blood concentration remains within the therapeutic window, increased time between consecutive doses, and decreased dose in moles over time.
- the terminal half- life of the GPXTEN fusion protein administered to a subject is increased at least about two fold, or at least about three-fold, or at least about four- fold, or at least about five-fold, or at least about six-fold, or at least about eight-fold, or at least about ten-fold, or at least about 20- fold, or at least about 40-fold, or at least about 60-fold, or at least about 100-fold compared to GP not linked to XTEN and administered to a subject at a comparable dose.
- the enhanced pharmacokinetic property is reflected by the fact that the blood concentrations that remain within the therapeutic window for the GPXTEN fusion protein for a given period are at least about two fold, or at least about three-fold, or at least about four- fold, or at least about five-fold, or at least about six-fold, or at least about eight-fold, or at least about ten- fold longer, or at least about 20-fold, or at least about 40-fold, or at least about 60-fold, or at least about 100-fold, or ever higher as compared to GP not linked to XTEN and administered to a subject at a comparable dose.
- the therapeutically effective dose regimen results in a gain in time of at least two-fold, or at least three-fold, or at least four-fold, or at least five-fold, or at least six-fold, or at least eight-fold, or at least 10-fold, or at least about 20-fold, or at least about 40-fold, or at least about 60-fold, or at least about 100-fold between at least two consecutive Cj 113x peaks and/or C 111111 troughs for blood levels of the fusion protein compared to the corresponding GP not linked to the fusion protein and administered using a comparable dose regimen to a subject.
- the XTEN enhances thermostability of a biologically active protein when linked to the biologically active protein wherein the thermostability is ascertained by measuring the retention of biological activity after exposure to a temperature of about 37°C for at least about 7 days of the biologically active protein in comparison to the XTEN linked to the biologically active protein.
- the retention of biological activity in increased by at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 100%, or about 150%, at least about 200%, at least about 300%, or about 500% longer compared to the GP not linked to the XTEN comprises of the XTEN.
- the isolated fusion protein with at least a first XTEN comprises a GP wherein the GP is human glucose regulating peptide.
- the isolated fusion protein further comprises a second XTEN, which can be identical or can be different from the first XTEN, and wherein the fusion protein adopts a multiple -XTEN configuration shown in Table 7.
- the first and the second XTEN can each be a sequence selected from Table 5, or can exhibit at least at least about 80%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% or 100% sequence identity to a sequence selected from Table 5.
- the isolated fusion protein compring a second XTEN sequence adopts a multiple-XTEN configuration shown in Table 7.
- the isolated fusion protein is less immunogenic compared to the GP not linked to the XTEN, wherein immunogenicity is ascertained by, e.g., measuring production of IgG antibodies selectively binding to the biologically active protein after administration of comparable doses to a subject.
- the glucose regulating peptide and the XTEN of the fusion protein is linked via a spacer, wherein the spacer sequence comprises between about 1 to about 50 amino acid residues that optionally comprises a cleavage sequence.
- the cleavage sequence is susceptible to cleavage by a protease.
- Non- limiting examples of such protease include FXIa, FXIIa, kallikrein, FVIIa, FIXa, FXa, thrombin, elastase-2, granzyme B, MMP- 12, MMP- 13, MMP- 17 or MMP-20, TEV, enterokinase, rhinovirus 3 C protease, and sortase A.
- the isolated fusion protein is configured to have reduced binding affinity for a target receptor of the corresponding GP, as compared to the corresponding GP not linked to the fusion protein.
- the GPXTEN fusion protein exhibits binding affinity for a target receptor of the GP in the range of about 0.01%-30%, or about 0.1% to about 20%, or about 1% to about 15%, or about 2% to about 10% of the binding affinity of the corresponding GP that lacks the XTEN.
- the GPXTEN fusion protein exhibits binding affinity for a target receptor of the GP that is reduced at least about 3-fold, or at least about 5-fold, or at least about 6-fold, or at least about 7-fold, or at least about 8- fold j Or at least about 9-fold, or at least about 10-fold, or at least about 12-fold, or at least about 15-fold, or at least about 17-fold, or at least about 20-fold, or at least about 30-fold, or at least about 50-fold, or at least about 100-fold less binding affinity compared to GP not linked to XTEN.
- a fusion protein with reduced affinity can have reduced receptor-mediated clearance and a corresponding increase in half-life of at least about 3-fold, or at least about 5-fold, or at least about 6-fold, or at least about 7-fold, or at least about 8-fold, or at least about 9-fold, or at least about 10-fold, or at least about 12-fold, or at least about 15-fold, or at least about 17-fold, or at least about 20-fold, or at least about 30-fold, or at least about 50-fold, or at least about 100-fold longer compared to the corresponding GP that is not linked to the fusion protein.
- the invention provides an isolated GPXTEN fusion protein comprising an amino acids sequence that has at least about 80%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99%, or 100% sequence identity to a sequence selected from Table 35, Table 36, and Table 37.
- the invention provides GPXTEN fusion proteins wherein the GPXTEN exhibits increased solubility of at least three-fold, or at least about four- fold, or at least about five-fold, or at least about six-fold, or at least about seven-fold, or at least about eight-fold, or at least about nine-fold, or at least about ten- fold, or at least about 15-fold, or at least a 20-fold, or at least 40-fold, or at least 60-fold at physiologic conditions compared to the GP not linked to the fusion protein.
- GPXTEN fusion proteins exhibit an increased apparent molecular weight as determined by size exclusion chromatography, compared to the actual molecular weight, wherein the apparent molecular weight is at least about 100 kD, or at least about 150 kD, or at least about 200 kD, or at least about 300 kD, or at least about 400 kD, or at least about 500 kD, or at least about 60OkD, or at least about 700 kD, while the actual molecular weight of each GP component of the fusion protein is less than about 25 kD.
- the GPXTEN fusion proteins can have an Apparent Molecular Weight that is about 4-fold greater, or about 5-fold greater, or about 6-fold greater, or about 7-fold greater, or about 8-fold greater than the actual molecular weight of the fusion protein.
- the isolated GPXTEN fusion protein of the foregoing embodiments exhibits an apparent molecular weight factor under physiologic conditions that is greater than about 4, or about 5, or about 6, or about 7, or about 8.
- the invention contemplates GPXTEN fusion proteins compositions comprising, but not limited to GP selected from Table 1 (or fragments or sequence variants thereof), XTEN selected from Table 5 (or sequence variants thereof) that are in a configuration selected from Table 5.
- GPXTEN fusion proteins
- the resulting GPXTEN will retain at least a portion of the biological activity of the corresponding GP not linked to the XTEN.
- the GP component either becomes biologically active or has an increase in activity upon its release from the XTEN by cleavage of an optional cleavage sequence incorporated within spacer sequences into the GPXTEN.
- the invention provides a fusion protein of formula
- XTEN x -GP-(XTEN) y I wherein independently for each occurrence, GP is a is a glucose regulating peptide; x is either 0 or 1 and y is either 0 or 1 wherein x+y >1; and XTEN is an extended recombinant polypeptide.
- the XTEN is fused to the glucose regulating peptide on an N- or C-terminus of the glucose regulating peptide.
- the isolated fusion protein comprises a human glucose regulating peptide and a first and a second XTEN selected from AE912, AM923, AE144, and AE288.
- the invention provides a fusion protein of formula II:
- XTEN x -(GP)-(S) y -(XTEN) y II
- GP is a is a glucose regulating peptide
- S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a cleavage sequence
- x is either 0 or 1
- y is either 0 or 1 wherein x+y >1
- XTEN is an extended recombinant polypeptide.
- the invention provides an isolated fusion protein, wherein the fusion protein is of formula III:
- GP is a is a glucose regulating peptide
- S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a cleavage sequence
- x is either 0 or 1
- y is either 0 or 1
- z is either 0 or 1
- XTEN is an extended recombinant polypeptide.
- the invention provides an isolated fusion protein, wherein the fusion protein is of formula IV:
- GP is a is a glucose regulating peptide
- S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a cleavage sequence
- x is either 0 or 1
- y is either 0 or 1
- z is either 0 or 1
- XTEN is an extended recombinant polypeptide.
- the invention provides an isolated fusion glucose regulating peptide, wherein the fusion protein is of formula V:
- GP is a is a glucose regulating peptide
- S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a cleavage sequence
- x is either 0 or 1
- y is either 0 or 1
- XTEN is an extended recombinant polypeptide.
- the invention provides an isolated fusion protein, wherein the fusion protein is of formula VI:
- GP is a is a glucose regulating peptide
- S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a cleavage sequence
- x is either 0 or 1
- y is either 0 or 1
- XTEN is an extended recombinant polypeptide.
- the invention provides an isolated fusion protein, wherein the fusion protein is of formula VII:
- GP is a is a glucose regulating peptide
- S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a cleavage sequence
- x is either 0 or 1
- y is either 0 or 1
- XTEN is an extended recombinant polypeptide.
- the invention provides an isolated fusion protein, wherein the fusion protein is of formula VIII:
- administration of a therapeutically effective dose of a fusion protein of an embodiment of formulas I-VIII to a subject in need thereof can result in a gain in time of at least two-fold, or at least three-fold, or at least four-fold, or at least five-fold or more spent within a therapeutic window for the fusion protein compared to the corresponding GP not linked to the XTEN of and administered at a comparable dose to a subject.
- administration of a therapeutically effective dose of a fusion protein of an embodiment of formulas I-VIII to a subject in need thereof can result in a gain in time between consecutive doses necessary to maintain a therapeutically effective dose regimen of at least 48 h, or at least 72 h, or at least about 96 h, or at least about 120 h, or at least about 7 days, or at least about 14 days, or at least about 21 days between consecutive doses compared to a GP not linked to XTEN and administered at a comparable dose.
- the fusion proteins can be designed to have different configurations, N- to C-terminus, of a GP, XTEN, and optional spacer sequences, including but not limited to XTEN-GP, GP-XTEN, XTEN-S-GP, GP- S-XTEN, XTEN-GP-XTEN, GP-GP-XTEN, XTEN-GP-GP, GP-S-GP-XTEN, XTEN-GP-S-GP, and multimers thereof, or be of a configuration shown in Table 7.
- the choice of configuration can, as disclosed herein, confer particular pharmacokinetic, physicochemical, or pharmacologic properties.
- the isolated fusion protein is characterized in that: (i) it has a longer half-life compared to the corresponding glucose regulating peptide that lacks the XTEN; (ii) when a smaller molar amount of the fusion protein is administered to a subject in comparison to the corresponding glucose regulating peptide that lacks the XTEN administered to a subject under an otherwise equivalent dose regimen, the fusion protein achieves a comparable area under the curve (AUC) as the corresponding glucose regulating peptide that lacks the XTEN; (iii) when a smaller molar amount of the fusion protein is administered to a subject in comparison to the corresponding glucose regulating peptide that lacks the XTEN administered to a subject under an otherwise equivalent dose regimen, the fusion protein achieves a comparable therapeutic effect as the corresponding glucose regulating peptide that lacks the XTEN; (iv) when the fusion protein is administered to a subject less frequently in comparison to the corresponding glucose regulating peptide that lacks the XTEN; (i
- the GPXTEN fusion proteins of formulas I- VIII described above exhibit a biological activity of at least about 0.1%, or at least about 1%, or at least about 2%, or at least about 3%, or at least about 4%, or at least about 5%, or at least about 10%, or at least about 20%, or at least about 30%, or at least 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90%, or at least about 95% of the biological activity compared to the GP not linked to the fusion protein.
- the GPXTEN fusion proteins of formulas I- VIII bind the same receptors as the corresponding parental GP that is not covalently linked to the fusion protein.
- the invention provides a method of producing a fusion protein comprising a glucose regulating peptide fused to one or more extended recombinant polypeptides (XTEN), comprising: (a) providing host cell comprising a recombinant polynucleotide molecule encoding the fusion protein (b) culturing the host cell under conditions permitting the expression of the fusion protein; and (c) recovering the fusion protein.
- the glucose regulating peptide of the fusion protein has at least 90% sequence identity to human glucose regulating peptide or a sequence selected from Table 1.
- the one or more XTEN of the expressed fusion protein has at least about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% to about 100% sequence identity to a sequence selected from Table 5.
- the polynucleotide encoding the XTEN is codon optimized for enhanced expression of said fusion protein in the host cell.
- the host cell is a prokaryotic cell.
- the host cell is E. coli.
- the isolated fusion protein is recovered from the host cell cytoplasm in substantially soluble form.
- the invention provides isolated nucleic acids comprising a polynucleotide sequence selected from (a) a polynucleotide encoding the fusion protein of any of the foregoing embodiments, or (b) the complement of the polynucleotide of (a).
- the invention provides an isolated nucleic acid comprising a polynucleotide sequence that has at least 80% sequence identity, or about 85%, or at least about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% to about 100% sequence identity to (a) a polynucleotide sequence of comparable length selected from Table 35, Table 36, and Table 37; or (b) the complement of the polynucleotide of (a).
- the invention provides expression vectors comprising the nucleic acid of any of the embodiments hereinabove described in this paragraph.
- the expression vector of the foregoing further comprises a recombinant regulatory sequence operably linked to the polynucleotide sequence.
- the polynucleotide sequence of the expression vectors of the foregoing is fused in frame to a polynucleotide encoding a secretion signal sequence, which can be a prokaryotic signal sequence.
- the secretion signal sequence is selected from OmpA, DsbA, and PhoA signal sequences.
- the invention provides a host cell, which can comprise an expression vector disclosed in the foregoing paragraph.
- the host cell is a prokaryotic cell.
- the host cell is E. coli.
- the host cell is a eukaryotic cell.
- the invention provides pharmaceutical compositions comprising the fusion protein of any of the foregoing embodiments and a pharmaceutically acceptable carrier.
- the invention provides kits, comprising packaging material and at least a first container comprising the pharmaceutical composition of the foregoing embodiment and a label identifying the pharmaceutical composition and storage and handling conditions, and a sheet of instructions for the reconstitution and/or administration of the pharmaceutical compositions to a subject.
- the invention provides a method of treating a glucose regulating peptide -related condition in a subject, comprising administering to the subject a therapeutically effective amount of the fusion protein of any of the foregoing embodiments.
- the glucose regulating peptide - related condition is selected from, but not limited to, juvenile diabetes, type I diabetes, type II diabetes, obesity, acute hypoglycemia, acute hyperglycemia, nocturnal hypoglycemia, chronic hyperglycemia, glucagonomas, secretory disorders of the airway, arthritis, osteoporosis, central nervous system disease, restenosis, neurodegenerative disease, renal failure, congestive heart failure, nephrotic syndrome, cirrhosis, pulmonary edema, hypertension, and disorders wherein the reduction of food intake is desired, stroke, irritable bowel syndrome, myocardial infarction (e.g., reducing the morbidity and/or mortality associated therewith), stroke, acute coronary syndrome (e.g., characterized by an absence of Q-wave) myocardial infarction, post-surgical catabolic changes, hibernating myocardium or diabetic cardiomyopathy, insufficient urinary sodium excretion, excessive urinary potassium
- the composition can be administered subcutaneously, intramuscularly, or intravenously. In one embodiment, the composition is administered at a therapeutically effective amount. In one embodiment, the therapeutically effective amount results in a gain in time spent within a therapeutic window for the fusion protein compared to the corresponding GP of the fusion protein not linked to the fusion protein and administered at a comparable dose to a subject.
- the gain in time spent within the therapeutic window can at least three-fold longer than the corresponding GP not linked to the fusion protein, or alternatively, at least four- fold, or five-fold, or six-fold, or seven- fold, or eight- fold, or nine-fold, or at least 10-fold, or at least 20-fold, or at least about 30-fold, or at least about 50-fold, or at least about 100-fold longer than the corresponding GP not linked to the fusion protein.
- a smaller molar amount of e.g.
- the fusion protein is administered in comparison to the corresponding glucose regulating peptide that lacks the XTEN under an otherwise same dose regimen, and the fusion protein achieves a comparable area under the curve and/or a comparable therapeutic effect as the corresponding glucose regulating peptide that lacks the XTEN; (ii) the fusion protein is administered less frequently (e.g., every two days, about every seven days, about every 14 days, about every 21 days, or about, monthly) in comparison to the corresponding glucose regulating peptide that lacks the XTEN under an otherwise same dose amount, and the fusion protein achieves a comparable area under the curve and/or a comparable therapeutic effect as the corresponding glucose regulating peptide that lacks the XTEN; or (iii) an accumulative smaller molar amount (e.g.
- the fusion protein achieves a comparable area under the curve and/or a comparable therapeutic effect as the corresponding glucose regulating peptide that lacks the XTEN.
- the accumulative smaller molar amount is measure for a period of at least about one week, or about 14 days, or about 21 days, or about one month.
- the therapeutic effect is a measured parameter selected from HbAIc concentrations, insulin concentrations, stimulated C peptide, fasting plasma glucose (FPG), serum cytokine levels, CRP levels, insulin secretion and Insulin- sensitivity index derived from an oral glucose tolerance test (OGTT), body weight, and food consumption.
- FPG fasting plasma glucose
- OGTT oral glucose tolerance test
- invention provides a method of treating a disease, disorder or condition, comprising administering the pharmaceutical composition described above to a subject using multiple consecutive doses of the pharmaceutical composition administered using a therapeutically effective dose regimen.
- the therapeutically effective dose regimen can result in a gain in time of at least three-fold, or alternatively, at least four- fold, or five-fold, or six-fold, or seven- fold, or eight- fold, or nine-fold, or at least 10-fold, or at least 20-fold, or at least about 30-fold, or at least about 50- fold, or at least about 100-fold longer time between at least two consecutive C m3x peaks and/or C mm troughs for blood levels of the fusion protein compared to the corresponding GP of the fusion protein not linked to the fusion protein and administered at a comparable dose regimen to a subject.
- the administration of the fusion protein results in improvement in at least one measured parameter of a glucose regulating peptide-related disease using less frequent dosing or a lower total dosage in moles of the fusion protein of the pharmaceutical composition compared to the corresponding biologically active protein component(s) not linked to the fusion protein and administered to a subject d using a therapeutically effective regimen to a subject.
- the invention further provides use of the compositions comprising the fusion protein of any of the foregoing embodiments in the preparation of a medicament for treating a disease, disorder or condition in a subject in need thereof.
- the disease, disorder or condition is selected from, but not limited to, juvenile diabetes, type I diabetes, type II diabetes, obesity, acute hypoglycemia, acute hyperglycemia, nocturnal hypoglycemia, chronic hyperglycemia, glucagonomas, secretory disorders of the airway, arthritis, osteoporosis, central nervous system disease, restenosis, neurodegenerative disease, renal failure, congestive heart failure, nephrotic syndrome, cirrhosis, pulmonary edema, hypertension, and disorders wherein the reduction of food intake is desired, stroke, irritable bowel syndrome, myocardial infarction (e.g., reducing the morbidity and/or mortality associated therewith), stroke, acute coronary syndrome (e.g., characterized by an absence
- exendin-4, GLP-I or glucagon is utilized, or any other indication for which GP can be utilized (but for which endogenous glucose regulating peptide levels in a subject are not necessarily deficient). Any of the disclosed embodiments can be practiced alone or in combination depending on the interested application.
- FIG. 1 shows schematic representations of exemplary GPXTEN fusion proteins (FIGS. IA-H), all depicted in an N- to C-terminus orientation.
- FIG. IA shows two different configurations of GPXTEN fusion proteins (100), each comprising a single GP and an XTEN, the first of which has an XTEN molecule (102) attached to the C-terminus of a GP (103), and the second of which has an XTEN molecule attached to the N- terminus of a GP (103).
- FIG. 1 shows schematic representations of exemplary GPXTEN fusion proteins (FIGS. IA-H), all depicted in an N- to C-terminus orientation.
- FIG. IA shows two different configurations of GPXTEN fusion proteins (100), each comprising a single GP and an XTEN, the first of which has an XTEN molecule (102) attached to the C-terminus of a GP (103), and the second of which has an XTEN molecule attached to the
- IB shows two different configurations of GPXTEN fusion proteins (100), each comprising a single GP, a spacer sequence and an XTEN, the first of which has an XTEN molecule (102) attached to the C-terminus of a spacer sequence (104) and the spacer sequence attached to the C-terminus of a GP (103) and the second of which has an XTEN molecule attached to the N-terminus of a spacer sequence (104) and the spacer sequence attached to the N-terminus of a GP (103).
- 1C shows two different configurations of GPXTEN fusion proteins (101), each comprising two molecules of a single GP and one molecule of an XTEN, the first of which has an XTEN linked to the C-terminus of a first GP and that GP is linked to the C-terminus of a second GP, and the second of which is in the opposite orientation in which the XTEN is linked to the N-terminus of a first GP and that GP is linked to the N-terminus of a second GP.
- ID shows two different configurations of GPXTEN fusion proteins (101), each comprising two molecules of a single GP, a spacer sequence and one molecule of an XTEN, the first of which has an XTEN linked to the C-terminus of a spacer sequence and the spacer sequence linked to the C-terminus of a first GP which is linked to the C-terminus of a second GP, and the second of which is in the opposite orientation in which the XTEN is linked to the N-terminus of a spacer sequence and the spacer sequence is linked to the N-terminus of a first GP that that GP is linked to the N-terminus of a second GP.
- IE shows two different configurations of GPXTEN fusion proteins (101), each comprising two molecules of a single GP, a spacer sequence and one molecule of an XTEN, the first of which has an XTEN linked to the C-terminus of a first GP and the first GP linked to the C-terminus of a spacer sequence which is linked to the C-terminus of a second GP molecule, and the second of which is in the opposite configuration of XTEN linked to the N- terminus of a first GP which is linked to the N-terminus of a spacer sequence which in turn is linked to the N-terminus of a second molecule of GP.
- FIG. IF shows a configuration of GPXTEN fusion protein (105), each comprising one molecule of GP and two molecules of an XTEN linked to the N-terminus and the C- terminus of the GP.
- FIG. IG shows a configuration (106) of a single GP linked to two XTEN, with the second XTEN separated from the GP by a spacer sequence.
- FIG. IH s a configuration (106) of a two GP linked to two XTEN, with the second XTEN linked to the C-terminus of the first GP and the N-terminus of the second GP, which is at the C-terminus of the GPXTEN.
- FIG. 2 is a schematic illustration of exemplary polynucleotide constructs (FIGS. 2A- H) of GPXTEN genes that encode the corresponding GPXTEN polypeptides of FIG. 1; all depicted in a 5' to 3' orientation.
- the genes encode GPXTEN fusion proteins with one GP and XTEN (200); or one GP, one spacer sequence and one XTEN (200); two GP and one XTEN (201); or two GP, a spacer sequence and one XTEN (201); one GP and two XTEN (205); or two GP and two XTEN (206).
- FIG. 3 is a schematic illustration of two exemplary monomeric GPXTEN and the ability of the monomeric fusion proteins to bind to a target receptor on a cell surface, with subsequent cell signaling.
- FIG. 3A shows a GPXTEN fusion protein (100) consisting of a GP (103) and an XTEN (102) and a second GPXTEN fusion protein (105) consisting of a GP linked to two XTEN (105).
- FIG. 3A shows a GPXTEN fusion protein (100) consisting of a GP (103) and an XTEN (102) and a second GPXTEN fusion protein (105) consisting of a GP linked to two XTEN (105).
- FIG. 3B shows the interaction of the GPXTEN with the GP on the C-terminus (100) and the GPXTEN with an XTEN on the C-terminus (105) with target receptors (108) to GP on a cell surface (107).
- binding to the receptor with high affinity is exhibited when GP has a free C-terminus, while the GPXTEN with a C-terminal XTEN does not bind tightly to the receptor, and disassociates, as seen in FIG. 3C.
- 3D shows that the bound GPXTEN (100) with high binding affinity remains bound to the receptor (106) and has been internalized into an endosome (110) within the cell, illustrating receptor-mediated clearance of the bound GP and triggering cell signaling (109), portrayed as stippled cytoplasm.
- FIG. 4 is a schematic flowchart of representative steps in the assembly, production and the evaluation of a XTEN.
- FIG. 5 is a schematic flowchart of representative steps in the assembly of a GP-XTEN polynucleotide construct encoding a fusion protein.
- Individual oligonucleotides 501 are annealed into sequence motifs 502 such as a 12 amino acid motif ("12-mer"), which is subsequently ligated with an oligo containing Bbsl, and Kpnl restriction sites 503. Additional sequence motifs from a library are annealed to the 12-mer until the desired length of the XTEN gene 504 is achieved.
- the XTEN gene is cloned into a staffer vector.
- FIG. 6 is a schematic flowchart of representative steps in the assembly of a gene encoding fusion protein comprising a biologically active protein (GP) and XTEN, its expression and recovery as a fusion protein, and its evaluation as a candidate GPXTEN product.
- GP biologically active protein
- FIG. 7 is a schematic representation of the design of Ex4XTEN expression vectors with different processing strategies.
- FIG. 7A shows an exemplary expression vector encoding XTEN fused to the 3' end of the sequence encoding biologically active protein Ex4. Note that no additional leader sequences are required in this vector.
- FIG. 7B depicts an expression vector encoding XTEN fused to the 5' end of the sequence encoding Ex4 with a CBD leader sequence and a TEV protease site.
- FIG. 7C depicts an expression vector as in FIG. 7B where the CBD and TEV processing site have been replaced with an optimized N-terminal leader sequence (NTS).
- FIG. 7D depicts an expression vector encoding an NTS sequence, an XTEN, a sequence encoding Ex4, and than a second sequence encoding an XTEN.
- FIG. 8 is a schematic representation of the step-wise construction of GPXTEN genes that contain N- terminal XTEN encoding sequences linked to a sequence encoding exendin-4 (Ex4) and the subsequent linkage of sequences encoding either 144 or 288 XTEN linked to the C-terminus of XTEN, as described in Example 18.
- FIG. 9 shows results of expression assays for the indicated constructs comprising GFP and XTEN sequences.
- the expression cultures were assayed using a fluorescence plate reader (excitation 395 nm, emission 510 nm) to determine the amount of GFP reporter present.
- the results, graphed as box and whisker plots, indicate that while median expression levels were approximately half of the expression levels compared to the "benchmark" CBD N-terminal helper domain, the best clones from the libraries were much closer to the benchmarks, indicating that further optimization around those sequences was warranted.
- the results also show that the libraries starting with amino acids MA had better expression levels than those beginning with ME (see Example 14).
- FIG. 10 shows three randomized libraries used for the third and fourth codons in the N-terminal sequences of clones from LCW546, LCW547 and LCW552, as described in Example 15.
- the libraries were designed with the third and fourth residues modified such that all combinations of allowable XTEN codons were present at these positions, as shown.
- nine pairs of oligonucleotides encoding 12 amino acids with codon diversities of third and fourth residues were designed, annealed and ligated into the Ndel/Bsal restriction enzyme digested staffer vector pCW0551 (Stuffer-XTEN_AM875-GFP), and transformed into E. coli BL21Gold(DE3) competent cells to obtain colonies of the three libraries LCW0569, LCW0570, and LCW0571.
- FIG. 11 shows a histogram of a retest of the top 75 clones after the optimization step, as described in Example 15, for GFP fluorescence signal, relative to the benchmark CBD AM875 construct. The results indicated that several clones were now superior to the benchmark clones.
- FIG. 12 is a schematic of a combinatorial approach undertaken for the union of codon optimization preferences for two regions of the N-terminus 48 amino acids, as described in Example 16.
- the approach created novel 48mers at the N-terminus of the XTEN protein for evaluation of the optimization of expression that resulted in leader sequences that may be a solution for expression of XTEN proteins where the XTEN is N-terminal to the GP.
- FIG. 13 shows an SDS-PAGE gel confirming expression of preferred clones obtained from the XTEN N-terminal codon optimization experiments, in comparison to benchmark XTEN clones comprising CBD leader sequences at the N-terminus of the construct sequences.
- FIG. 14 shows an SDS-PAGE gel of samples from a stability study of the fusion protein of XTEN AE864 fused to the N-terminus of GFP (see Example 24).
- the GFP-XTEN was incubated in cynomolgus plasma and rat kidney lysate for up to 7 days at 37oC.
- GFP-XTEN administered to cynomolgus monkeys was also assessed. Samples were withdrawn at 0, 1 and 7 days and analyzed by SDS PAGE followed by detection using Western analysis and detection with antibodies against GFP.
- FIG. 15 shows an SDS-PAGE gel confirming expression of glucagon fused to XTEN of various lengths; i.e., Y288, Y144, Y72 and Y36, in comparison to molecular weight standards.
- FIG. 16 shows results of a of a size exclusion chromatography analysis of glucagon-XTEN construct samples measured against protein standards of known molecular weight, with the graph output as absorbance versus retention volume, as described in Example 22.
- the glucagon-XTEN constructs are 1) glucagon- Y288; 2) glucagonY-144; 3) glucagon-Y72; and 4) glucagon- Y36.
- the results indicate an increase in apparent molecular weight with increasing length of XTEN moiety.
- FIG. 17 shows the pharmacokinetic results of the GPXTEN Ex4-AE864 administered to cynomolgus monkeys by the subcutaneous and intravenous routes (see Example 27 for experimental details).
- FIG. 18 illustrates allometric scaling results for predicted human response to Ex4-XTEN_AE864 based on measured results from four animal species; i.e., mice, rats, cynomolgus monkeys and dogs, as described in Example 28.
- FIG. 18A shows measured terminal half-life versus body mass, with a predicted Tl/2 in humans of 139 h.
- FIG. 18B shows measured drug clearance versus body mass, with a predicted clearance rate value of 30 ml/h in humans.
- FIG. 18C shows measured volume of distribution versus body mass, with a predicted value of 5970 ml in humans.
- FIG. 19 shows results of studies of the biophysical characterization and stability of Gcg-XTEN (see Example 21 for experimental details).
- FIG. 19A is a SDS-PAGE analysis of the purified protein product (lane 2). Molecular weight markers are shown in lane 1 with relevant size markers labeled at the left. Note that the true molecular weight of the molecule is 16305 Daltons (confirmed by mass spectrometry; not shown). Slow migration in SDS-PAGE relative to globular protein standards is typical of XTEN fusion proteins due to differences in primary amino acid composition.
- FIG. 19A is a SDS-PAGE analysis of the purified protein product (lane 2). Molecular weight markers are shown in lane 1 with relevant size markers labeled at the left. Note that the true molecular weight of the molecule is 16305 Daltons (confirmed by mass spectrometry; not shown). Slow migration in SDS-PAGE relative to globular protein standards is typical of XTEN fusion proteins due to differences in primary amino acid composition.
- FIG. 19B shows results of a glucagon receptor (GcgR) Ca2+-flux assay comparing the efficacy of Gcg-XTEN to unmodified glucagon. Calculated EC50 values for each curve fit are shown.
- FIG. 19C shows results of a reverse phase Cl 8 HPLC analysis.
- FIG. 19D shows results of a size exclusion chromatography HPLC analysis of the purified Gcg-XTEN construct at the time of production.
- FIG. 19E shows results of a reverse phase Cl 8 HPLC analysis.
- FIG. 19F shows results of size exclusion chromatography HPLC analyses of Gcg-XTEN after 6 months storage at either -80 0 C, 2-8°C, or 25°C, with all three curves essentially superimposed. [0064] FIG.
- FIG. 20 shows results of a pharmacodynamic study in dogs dosed with glucagon or Gcg-XTEN (see Example 29 for experimental details).
- Glucagon FIG. 20A
- Gcg-XTEN FIG. 20B
- Glucagon FIG. 20A
- Gcg-XTEN FIG. 20B
- FIG. 21 shows results of a pharmacodynamic study in dogs dosed with glucagon or Gcg-XTEN and challenged with insulin in order to test whether Gcg-XTEN confers temporally-controlled resistance to insulin- induced hypoglycemia in dogs (see Example 30 for experimental details).
- Beagle dogs were fed three hours prior to the start of the experiment and fasted thereafter.
- animals received either a dose of 0.6 nmol/kg Gcg-XTEN or placebo (open arrows).
- FIG. 21 C represents a hypothetical timeline for human administration over a meal-sleep-wake cycle that is intended to correspond to the dosage administration and experimental design of the experiment.
- FIG. 22 shows results of a pharmacodynamic experiment dosed with glucagon or Gcg-XTEN_Y288 (Construct 1) to test the ability of the compounds to inhibit an increase in blood glucose after the end of fasting in cynomolgus monkeys (see Example 31 for experimental details).
- Example 23 shows body weight results from a pharmacodynamic and metabolic study using a combination of two GPXTEN fusion proteins; i.e., glucagon linked to Y288 (Gcg-XTEN) and exendin-4 linked to AE864 (Ex4-XTEN) to evaluate the combination for efficacy in a diet-induced obesity model in mice (see Example 26 for experimental details).
- the graph shows change in body weight in Diet-Induced Obese mice over the course of 28 days continuous drug administration. Values shown are the average +/- SEM of 10 animals per group (20 animals in the placebo group).
- FIG. 24 shows change in fasting glucose levels from a pharmacodynamic and metabolic study using single and combinations of two GPXTEN fusion proteins; i.e., glucagon linked to Y288 (Gcg-XTEN) and exendin-4 linked to AE864 (Ex4-XTEN) in a diet-induced obesity model in mice (see Example 26 for experimental details).
- Groups are as follows: Gr. 1 Tris Vehicle; Gr. 2 Ex4-AE576, 10 mg/kg; Gr. 3 Ex4- AE576, 20 mg/kg; Gr. 4 Vehicle, 50% DMSO; Gr. 5 Exenatide, 30 ⁇ g/kg/day; Gr.
- FIG. 25 shows the triglyceride and cholesterol levels in Diet-Induced Obese mice after 28 days continuous drug administration of Gcg-XTEN and exendin-4, either singly or in combination (see Example 26 for experimental details). Values shown are the average +/- SEM of 10 animals per group.
- FIG. 26 shows the results of a pharmacokinetic study in cynomolgus monkeys testing the effects of XTEN length with different compositions of GFP linked to XTEN administered either subcutaneously or intravenously, as described in Example 23. The compositions were GFP-L288, GFP-L576, GFP-AF576, GFP-Y576 and AD836-GFP. Results are presented as the plasma concentration versus time (h) after dosing.
- FIG. 27 shows the near UV circular dichroism spectrum of Ex4-XTEN_AE864, performed as described in Example 34.
- FIG. 28 shows the results of blood levels over time for glucagon-XTEN fusion proteins administered to cynomolgus monkeys, as described in Example 32.
- the GPXTEN administered were glucagon-Y288, glucagonY-144, and glucagon-Y72.
- the results from the glucagon-Y144 dosing shows ⁇ 3-fold variation in blood levels over 0-6 hrs, with blood levels dropping below the 10x threshold from the C max at 10-12 hours.
- polypeptide As used herein, the following terms have the meanings ascribed to them unless specified otherwise. [0077] As used in the specification and claims, the singular forms “a”, “an” and “the” include plural references unless the context clearly dictates otherwise. For example, the term “a cell” includes a plurality of cells, including mixtures thereof. [0078]
- polypeptide polypeptide
- peptide and “protein” are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non amino acids.
- amino acid refers to either natural and/or unnatural or synthetic amino acids, including but not limited to glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics. Standard single or three letter codes are used to designate amino acids.
- natural L-amino acid means the L optical isomer forms of glycine (G), proline (P), alanine (A), valine (V), leucine (L), isoleucine (I), methionine (M), cysteine (C), phenylalanine (F), tyrosine (Y), tryptophan (W), histidine (H), lysine (K), arginine (R), glutamine (Q), asparagine (N), glutamic acid (E), aspartic acid (D), serine (S), and threonine (T).
- non-naturally occurring means polypeptide or polynucleotide sequences that do not have a counterpart to, are not complementary to, or do not have a high degree of homology with a wild-type or naturally-occurring sequence found in a mammal.
- a non-naturally occurring polypeptide may share no more than 99%, 98%, 95%, 90%, 80%, 70%, 60%, 50% or even less amino acid sequence identity as compared to a natural sequence when suitably aligned.
- hydrophilic and hydrophobic refer to the degree of affinity that a substance has with water.
- a hydrophilic substance has a strong affinity for water, tending to dissolve in, mix with, or be wetted by water, while a hydrophobic substance substantially lacks affinity for water, tending to repel and not absorb water and tending not to dissolve in or mix with or be wetted by water.
- Amino acids can be characterized based on their hydrophobicity. A number of scales have been developed.
- hydrophilic amino acids are arginine, lysine, threonine, alanine, asparagine, and glutamine. Of particular interest are the hydrophilic amino acids aspartate, glutamate, and serine, and glycine.
- hydrophobic amino acids are tryptophan, tyrosine, phenylalanine, methionine, leucine, isoleucine, and valine.
- a "fragment” is a truncated form of a native biologically active protein that retains at least a portion of the therapeutic and/or biological activity.
- a “variant” is a protein with sequence homology to the native biologically active protein that retains at least a portion of the therapeutic and/or biological activity of the biologically active protein.
- a variant protein may share at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% amino acid sequence identity with the reference biologically active protein.
- biologically active protein moiety includes proteins modified deliberately, as for example, by site directed mutagenesis, insertions, or accidentally through mutations.
- a "host cell” includes an individual cell or cell culture which can be or has been a recipient for the subject vectors. Host cells include progeny of a single host cell. The progeny may not necessarily be completely identical (in morphology or in genomic of total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation. A host cell includes cells transfected in vivo with a vector of this invention.
- Isolated when used to describe the various polypeptides disclosed herein, means polypeptide that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would typically interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. As is apparent to those of skill in the art, a non-naturally occurring polynucleotide, peptide, polypeptide, protein, antibody, or fragments thereof, does not require "isolation" to distinguish it from its naturally occurring counterpart.
- a “concentrated”, “separated” or “diluted” polynucleotide, peptide, polypeptide, protein, antibody, or fragments thereof is distinguishable from its naturally occurring counterpart in that the concentration or number of molecules per volume is generally greater than that of its naturally occurring counterpart.
- a polypeptide made by recombinant means and expressed in a host cell is considered to be “isolated.”
- An "isolated" polynucleotide or polypeptide-encoding nucleic acid or other polypeptide-encoding nucleic acid is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the natural source of the polypeptide-encoding nucleic acid.
- An isolated polypeptide-encoding nucleic acid molecule is other than in the form or setting in which it is found in nature. Isolated polypeptide-encoding nucleic acid molecules therefore are distinguished from the specific polypeptide-encoding nucleic acid molecule as it exists in natural cells.
- an isolated polypeptide-encoding nucleic acid molecule includes polypeptide-encoding nucleic acid molecules contained in cells that ordinarily express the polypeptide where, for example, the nucleic acid molecule is in a chromosomal or extra-chromosomal location different from that of natural cells.
- a "chimeric" protein contains at least one fusion polypeptide comprising regions in a different position in the sequence than that which occurs in nature.
- the regions may normally exist in separate proteins and are brought together in the fusion polypeptide; or they may normally exist in the same protein but are placed in a new arrangement in the fusion polypeptide.
- a chimeric protein may be created, for example, by chemical synthesis, or by creating and translating a polynucleotide in which the peptide regions are encoded in the desired relationship.
- Conjugated refers to the joining together of two or more chemical elements or components, by whatever means including chemical conjugation or recombinant means.
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence.
- operably linked means that the DNA sequences being linked are contiguous, and in reading phase or in- frame.
- An "in- frame fusion” refers to the joining of two or more open reading frames (ORFs) to form a continuous longer ORF, in a manner that maintains the correct reading frame of the original ORFs.
- ORFs open reading frames
- the resulting recombinant fusion protein is a single protein containing two or more segments that correspond to polypeptides encoded by the original ORFs (which segments are not normally so joined in nature).
- a “linear sequence” or a “sequence” is an order of amino acids in a polypeptide in an amino to carboxyl terminus direction in which residues that neighbor each other in the sequence are contiguous in the primary structure of the polypeptide.
- a “partial sequence” is a linear sequence of part of a polypeptide that is known to comprise additional residues in one or both directions.
- "Heterologous” means derived from a genotypically distinct entity from the rest of the entity to which it is being compared. For example, a glycine rich sequence removed from its native coding sequence and operatively linked to a coding sequence other than the native sequence is a heterologous glycine rich sequence.
- heterologous as applied to a polynucleotide, a polypeptide, means that the polynucleotide or polypeptide is derived from a genotypically distinct entity from that of the rest of the entity to which it is being compared.
- polynucleotides refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three-dimensional structure, and may perform any function, known or unknown.
- polynucleotides coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
- modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- complement of a polynucleotide denotes a polynucleotide molecule having a complementary base sequence and reverse orientation as compared to a reference sequence, such that it could hybridize with a reference sequence with complete fidelity.
- Recombinant as applied to a polynucleotide means that the polynucleotide is the product of various combinations of in vitro cloning, restriction and/or ligation steps, and other procedures that result in a construct that can potentially be expressed in a host cell.
- gene or “gene fragment” are used interchangeably herein. They refer to a polynucleotide containing at least one open reading frame that is capable of encoding a particular protein after being transcribed and translated.
- a gene or gene fragment may be genomic or cDNA, as long as the polynucleotide contains at least one open reading frame, which may cover the entire coding region or a segment thereof.
- a “fusion gene” is a gene composed of at least two heterologous polynucleotides that are linked together.
- "Homology” or “homologous” refers to sequence similarity or interchangeability between two or more polynucleotide sequences or two or more polypeptide sequences.
- polynucleotides that are homologous are those which hybridize under stringent conditions as defined herein and have at least 70%, or at least 80%, or at least 90%, or 95%, or 97%, or 98%, or 99% sequence identity to those sequences.
- "Ligation” refers to the process of forming phosphodiester bonds between two nucleic acid fragments or genes, linking them together.
- stringent conditions or “stringent hybridization conditions” includes reference to conditions under which a polynucleotide will hybridize to its target sequence, to a detectably greater degree than other sequences (e.g., at least 2-fold over background). Generally, stringency of hybridization is expressed, in part, with reference to the temperature and salt concentration under which the wash step is carried out.
- stringent conditions will be those in which the salt concentration is less than about 1.5 M Na ion, typically about 0.01 to 1.0 M Na ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30 0 C. for short polynucleotides (e.g., 10 to 50 nucleotides) and at least about 60 0 C. for long polynucleotides (e.g., greater than 50 nucleotides) — for example, "stringent conditions” can include hybridization in 50% formamide, 1 M NaCl, 1% SDS at 37°C, and three washes for 15 min each in O. l xSSC/1% SDS at 60 to 65°C.
- temperatures of about 65°C, 60 0 C, 55°C, or 42°C may be used.
- SSC concentration may be varied from about 0.1 to 2> ⁇ SSC, with SDS being present at about 0.1%.
- wash temperatures are typically selected to be about 5°C to 20 0 C lower than the thermal melting point for the specific sequence at a defined ionic strength and pH.
- the Tm is the temperature (under defined ionic strength and pH) at which 50% of the target sequence hybridizes to a perfectly matched probe.
- blocking reagents are used to block non-specific hybridization.
- blocking reagents include, for instance, sheared and denatured salmon sperm DNA at about 100-200 ⁇ g/ml.
- Organic solvent such as formamide at a concentration of about 35- 50% v/v, may also be used under particular circumstances, such as for RNA:DNA hybridizations. Useful variations on these wash conditions will be readily apparent to those of ordinary skill in the art.
- percent identity and % identity refer to the percentage of residue matches between at least two polynucleotide sequences aligned using a standardized algorithm. Such an algorithm may insert, in a standardized and reproducible way, gaps in the sequences being compared in order to optimize alignment between two sequences, and therefore achieve a more meaningful comparison of the two sequences.
- Percent identity may be measured over the length of an entire defined polynucleotide sequence, for example, as defined by a particular SEQ ID number, or may be measured over a shorter length, for example, over the length of a fragment taken from a larger, defined polynucleotide sequence, for instance, a fragment of at least 45, at least 60, at least 90, at least 120, at least 150, at least 210 or at least 450 contiguous residues.
- Such lengths are exemplary only, and it is understood that any fragment length supported by the sequences shown herein, in the tables, figures or Sequence Listing, may be used to describe a length over which percentage identity may be measured.
- Percent (%) amino acid sequence identity is defined as the percentage of amino acid residues in a query sequence that are identical with the amino acid residues of a second, reference polypeptide sequence or a portion thereof, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software.
- Percent identity may be measured over the length of an entire defined polypeptide sequence, for example, as defined by a particular SEQ ID number, or may be measured over a shorter length, for example, over the length of a fragment taken from a larger, defined polypeptide sequence, for instance, a fragment of at least 15, at least 20, at least 30, at least 40, at least 50, at least 70 or at least 150 contiguous residues.
- Such lengths are exemplary only, and it is understood that any fragment length supported by the sequences shown herein, in the tables, figures or Sequence Listing, may be used to describe a length over which percentage identity may be measured.
- non-repetitiveness refers to a lack or limited degree of internal homology in a peptide or polypeptide sequence.
- substantially non- repetitive can mean, for example, that there are few or no instances of four contiguous amino acids in the sequence that are identical amino acid types or that the polypeptide has a subsequence score (defined infra) of 10 or less or that there isn't a pattern in the order, from N- to C-terminus, of the sequence motifs that constitute the polypeptide sequence.
- a “repetitiveness” as used herein in the context of a polypeptide refers to the degree of internal homology in a peptide or polypeptide sequence.
- a “repetitive” sequence may contain multiple identical copies of short amino acid sequences.
- a polypeptide sequence of interest may be divided into n-mer sequences and the number of identical sequences can be counted.
- Highly repetitive sequences contain a large fraction of identical sequences while non-repetitive sequences contain few identical sequences.
- a sequence can contain multiple copies of shorter sequences of defined or variable length, or motifs, in which the motifs themselves have non-repetitive sequences, rendering the full-length polypeptide substantially non-repetitive.
- the length of polypeptide within which the non-repetitiveness is measured can vary from 3 amino acids to about 200 amino acids, about from 6 to about 50 amino acids, or from about 9 to about 14 amino acids.
- “Repetitiveness” used in the context of polynucleotide sequences refers to the degree of internal homology in the sequence such as, for example, the frequency of identical nucleotide sequences of a given length. Repetitiveness can, for example, be measured by analyzing the frequency of identical sequences.
- a "vector” is a nucleic acid molecule, preferably self-replicating in an appropriate host, which transfers an inserted nucleic acid molecule into and/or between host cells.
- the term includes vectors that function primarily for insertion of DNA or RNA into a cell, replication of vectors that function primarily for the replication of DNA or RNA, and expression vectors that function for transcription and/or translation of the DNA or RNA. Also included are vectors that provide more than one of the above functions.
- An "expression vector” is a polynucleotide which, when introduced into an appropriate host cell, can be transcribed and translated into a polypeptide(s).
- An "expression system” usually connotes a suitable host cell comprised of an expression vector that can function to yield a desired expression product.
- serum degradation resistance refers to the ability of the polypeptides to withstand degradation in blood or components thereof, which typically involves proteases in the serum or plasma.
- the serum degradation resistance can be measured by combining the protein with human (or mouse, rat, monkey, as appropriate) serum or plasma, typically for a range of days (e.g. 0.25, 0.5, 1, 2, 4, 8, 16 days), typically at about 37°C.
- the samples for these time points can be run on a Western blot assay and the protein is detected with an antibody.
- the antibody can be to a tag in the protein. If the protein shows a single band on the western, where the protein's size is identical to that of the injected protein, then no degradation has occurred.
- the time point where 50% of the protein is degraded is the serum degradation half- life or "serum half- life" of the protein.
- t 1/2 as used herein means the terminal half-life calculated as ln(2)/K el .
- K el is the terminal elimination rate constant calculated by linear regression of the terminal linear portion of the log concentration vs. time curve.
- Half-life typically refers to the time required for half the quantity of an administered substance deposited in a living organism to be metabolized or eliminated by normal biological processes.
- the terms 'Hy 2 ", "terminal half-life", “elimination half- life” and “circulating half-life” are used interchangeably herein.
- Apparent Molecular Weight Factor or “Apparent Molecular Weight” are related terms referring to a measure of the relative increase or decrease in apparent molecular weight exhibited by a particular amino acid sequence.
- the Apparent Molecular Weight is determined using size exclusion chromatography (SEC) and similar methods compared to globular protein standards and is measured in "apparent kD" units.
- the Apparent Molecular Weight Factor is the ratio between the Apparent Molecular Weight and the actual molecular weight; the latter predicted by adding, based on amino acid composition, the calculated molecular weight of each type of amino acid in the composition.
- the "hydrodynamic radius” or “Stokes radius” is the effective radius (R h in nm) of a molecule in a solution measured by assuming that it is a body moving through the solution and resisted by the solution's viscosity.
- the hydrodynamic radius measurements of the XTEN fusion proteins correlate with the 'Apparent Molecular Weight Factor', which is a more intuitive measure.
- the "hydrodynamic radius” of a protein affects its rate of diffusion in aqueous solution as well as its ability to migrate in gels of macromolecules.
- the hydrodynamic radius of a protein is determined by its molecular weight as well as by its structure, including shape and compactness.
- Physiological conditions refer to a set of conditions in a living host as well as in vitro conditions, including temperature, salt concentration, pH, that mimic those conditions of a living subject.
- a physiological buffer contains a physiological concentration of salt and is adjusted to a neutral pH ranging from about 6.5 to about 7.8, and preferably from about 7.0 to about 7.5.
- Physiologically relevant temperature ranges from about 25 0 C to about 38 0 C, and preferably from about 35 0 C to about 37 0 C.
- a "reactive group” is a chemical structure that can be coupled to a second reactive group.
- reactive groups are amino groups, carboxyl groups, sulfhydryl groups, hydroxyl groups, aldehyde groups, azide groups.
- Some reactive groups can be activated to facilitate coupling with a second reactive group. Examples for activation are the reaction of a carboxyl group with carbodiimide, the conversion of a carboxyl group into an activated ester, or the conversion of a carboxyl group into an azide function.
- Controlled release agent “slow release agent”, “depot formulation” or “sustained release agent” are used interchangeably to refer to an agent capable of extending the duration of release of a polypeptide of the invention relative to the duration of release when the polypeptide is administered in the absence of agent.
- Different embodiments of the present invention may have different release rates, resulting in different therapeutic amounts.
- antigen a tumor necrosis factor
- target antigen a tumor necrosis factor
- payload refers to a protein or peptide sequence that has biological or therapeutic activity; the counterpart to the pharmacophore of small molecules.
- payloads include, but are not limited to, cytokines, enzymes, hormones and blood and growth factors.
- Payloads can further comprise genetically fused or chemically conjugated moieties such as chemotherapeutic agents, antiviral compounds, toxins, or contrast agents. These conjugated moieties can be joined to the rest of the polypeptide via a linker that may be cleavable or non-cleavable.
- antagonist includes any molecule that partially or fully blocks, inhibits, or neutralizes a biological activity of a native polypeptide disclosed herein.
- Methods for identifying antagonists of a polypeptide may comprise contacting a native polypeptide with a candidate antagonist molecule and measuring a detectable change in one or more biological activities normally associated with the native polypeptide.
- antagonists may include proteins, nucleic acids, carbohydrates, antibodies or any other molecules that decrease the effect of a biologically active protein.
- agonist is used in the broadest sense and includes any molecule that mimics a biological activity of a native polypeptide disclosed herein.
- Suitable agonist molecules specifically include agonist antibodies or antibody fragments, fragments or amino acid sequence variants of native polypeptides, peptides, small organic molecules, etc.
- Methods for identifying agonists of a native polypeptide may comprise contacting a native polypeptide with a candidate agonist molecule and measuring a detectable change in one or more biological activities normally associated with the native polypeptide.
- Activity for the purposes herein refers to an action or effect of a component of a fusion protein consistent with that of the corresponding native biologically active protein, wherein “biological activity” refers to an in vitro or in vivo biological function or effect, including but not limited to receptor binding, antagonist activity, agonist activity, or a cellular or physiologic response.
- treatment or “treating,” or “palliating” or “ameliorating” is used interchangeably herein. These terms refer to an approach for obtaining beneficial or desired results including but not limited to a therapeutic benefit and/or a prophylactic benefit.
- therapeutic benefit is meant eradication or amelioration of the underlying disorder being treated.
- a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with the underlying disorder such that an improvement is observed in the subject, notwithstanding that the subject may still be afflicted with the underlying disorder.
- compositions may be administered to a subject at risk of developing a particular disease, or to a subject reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease may not have been made.
- a "therapeutic effect" refers to a physiologic effect, including but not limited to the cure, mitigation, amelioration, or prevention of disease in humans or other animals, or to otherwise enhance physical or mental wellbeing of humans or animals, caused by a fusion polypeptide of the invention other than the ability to induce the production of an antibody against an antigenic epitope possessed by the biologically active protein. Determination of a therapeutically effective amount is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein.
- terapéuticaally effective amount refers to an amount of a biologically active protein, either alone or as a part of a fusion protein composition, that is capable of having any detectable, beneficial effect on any symptom, aspect, measured parameter or characteristics of a disease state or condition when administered in one or repeated doses to a subject. Such effect need not be absolute to be beneficial.
- terapéuticaally effective dose regimen refers to a schedule for consecutively administered doses of a biologically active protein, either alone or as a part of a fusion protein composition, wherein the doses are given in therapeutically effective amounts to result in sustained beneficial effect on any symptom, aspect, measured parameter or characteristics of a disease state or condition.
- the present invention relates in part to fusion protein compositions comprising glucose regulating peptides (GP).
- GP glucose regulating peptides
- Such compositions can have utility in the treatment or prevention of certain diseases, disorder or conditions related to glucose homeostasis, obesity, insulin resistance, dyslipidemia, hypertension, and the like.
- Endocrine and obesity-related diseases or disorders have reached epidemic proportions in most developed countries, and represent a substantial and increasing health care burden in most developed nations, which include a large variety of conditions affecting the organs, tissues, and circulatory system of the body. Of particular concern are endocrine and obesity-related diseases and disorders, which. Chief amongst these is diabetes; one of the leading causes of death in the United States. Diabetes is divided into two major sub- classes-Type I, also known as juvenile diabetes, or Insulin-Dependent Diabetes Mellitus (IDDM), and Type II, also known as adult onset diabetes, or Non-Insulin-Dependent Diabetes Mellitus (NIDDM).
- IDDM Insulin-Dependent Diabetes Mellitus
- NIDDM Non-Insulin-Dependent Diabetes Mellitus
- Type I Diabetes is a form of autoimmune disease that completely or partially destroys the insulin producing cells of the pancreas in such subjects, and requires use of exogenous insulin during their lifetime. Even in well- managed subjects, episodic complications can occur, some of which are life -threatening.
- Type II diabetics rising blood glucose levels after meals do not properly stimulate insulin production by the pancreas. Additionally, peripheral tissues are generally resistant to the effects of insulin, and such subjects often have higher than normal plasma insulin levels (hyperinsulinemia) as the body attempts to overcome its insulin resistance. In advanced disease states insulin secretion is also impaired.
- Insulin resistance and hyperinsulinemia have also been linked with two other metabolic disorders that pose considerable health risks: impaired glucose tolerance and metabolic obesity.
- Impaired glucose tolerance is characterized by normal glucose levels before eating, with a tendency toward elevated levels (hyperglycemia) following a meal. These individuals are considered to be at higher risk for diabetes and coronary artery disease. Obesity is also a risk factor for the group of conditions called insulin resistance syndrome, or "Syndrome X,” as is hypertension, coronary artery disease (arteriosclerosis), and lactic acidosis, as well as related disease states. The pathogenesis of obesity is believed to be multifactorial but an underlying problem is that in the obese, nutrient availability and energy expenditure are not in balance until there is excess adipose tissue.
- Dyslipidemia is a frequent occurrence among diabetics; typically characterized by elevated plasma triglycerides, low HDL (high density lipoprotein) cholesterol, normal to elevated levels of LDL (low density lipoprotein) cholesterol and increased levels of small dense, LDL particles in the blood. Dyslipidemia is a main contributor to an increased incidence of coronary events and deaths among diabetic subjects.
- Glucose-increasing peptides are exemplified by the peptide hormone glucagon, while glucose-lowering peptides include exendin-4, glucagon- like peptide 1, and amylin.
- one aspect of the present invention is the incorporation of peptides involved in glucose homeostasis, insulin resistance and obesity (collectively, “glucose regulating peptides") in GPXTEN fusion proteins to create compositions that can be used in the treatment of glucose, insulin, and obesity disorders, diseases and related conditions (referred to herein as “glucose regulating peptide -related diseases, disorders or conditions”).
- Glucose regulating peptides can include any protein of biologic, therapeutic, or prophylactic interest or function that is useful for preventing, treating, mediating, or ameliorating a disease, disorder or condition of glucose homeostasis or insulin resistance or obesity.
- Suitable glucose-regulating peptides that can be linked to the XTEN to create GPXTEN include all biologically active polypeptides that increase glucose-dependent secretion of insulin by pancreatic beta-cells or potentiate the action of insulin or play a role in glucose homeostasis.
- Glucose-regulating peptides can also include all biologically active polypeptides that stimulate pro-insulin gene transcription in the pancreatic beta-cells.
- glucose- regulating peptides can also include all biologically active polypeptides that slow down gastric emptying time and reduce food intake.
- Glucose-regulating peptides can also include all biologically active polypeptides that inhibit glucagon release from the alpha cells of the Islets of Langerhans.
- Glucose regulating peptides of the inventive GPXTEN compositions can be a peptide that exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a protein sequence selected from Table 1.
- Table 1 Glucose regulating peptides from animal species
- Amylin means the human peptide hormone referred to as amylin, pramlintide, and species variations thereof, as described in U.S. Pat. No. 5,234,906, having at Jear ⁇ r a portio ⁇ of the biological activity of native aniylm.
- Amylin is a 37-amino acid polypeptide hormone co-secreted with insulin by pancreatic beta cells in response to nutrient intake (Koda et al., Lancet 339: 1179-1180. 1992), and has been reported to modulate several key pathways of carbohydrate meiabolism. including incorporation of glucose int ⁇ glycogen.
- Aray Ii n -containing fusion proteins of the invention may find particular use in diabetes and obesity for regulating gastric emptying, suppressing glucagon secretion and food intake, thereby affecting the rate of glucose appearance in the circulation.
- the fusion proteins may complement the action of insulin, which regulates the rate of glucose disappearance from the circulation and iis upiakc by peripheral tissues.
- AmyJi ⁇ analogues have been cloned, as described in U.S. Pat. Nos. 5,686,411 and 7,271,238. Amylin mimetics can be created that retain biologic activity.
- pramlintide has the sequence KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY, wherein amino acids from the rat amylin sequence are substituted for amino acids in the human amylin sequence.
- the invention contemplates fusion proteins comprising amylin mimetics of the sequence KCNTATCATX 1 RLANFLVHSSNNFGX 2 ILX 2 X 2 TNVGSNTY wherein Xi is independently N or Q and X 2 is independently S, P or G.
- the amylin mimetic incorporated into a GPXTEN has the sequence
- the mimetic has the sequence KCNTATCATNRLANFLVHSSNNFGGILGGTNVGSNTY(NH2)
- Exendin-3 means a glucose regulating peptide isolated from Heloderma horridum and sequence variants thereof having at least a portion of the biological activity of native exendin-3.
- Exendin-3 amide is a specific exendin receptor antagonist from that mediates an increase in pancreatic cAMP, and release of insulin and amylase.
- Exendin-3 -containing fusion proteins of the invention may find particular use in the treatment of diabetes and insulin resistance disorders. The sequence and methods for its assay are described in United States Patent 5,4242,86.
- Exendin-4" means a glucose regulating peptide found in the saliva of the Gila-monster Heloderma suspectum, as well as species and sequence variants thereof, and includes the native 39 amino acid sequence His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu- Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser and homologous sequences and peptide mimetics, and variants thereof; natural sequences, such as from primates and non-natural having at least a portion of the biological activity of native exendin-4.
- Exendin-4 is an incretin polypeptide hormone that decreases blood glucose, promotes insulin secretion, slows gastric emptying and improves satiety, providing a marked improvement in postprandial hyperglycemia.
- the exendins have some sequence similarity to members of the glucagon- like peptide family, with the highest identity being to GLP-I (Goke, et al., J. Biol. Chem., 268: 19650-55 (1993)).
- GLP-I Goke, et al., J. Biol. Chem., 268: 19650-55 (1993)
- GLP-I Garnier, et al., J. Biol. Chem., 268: 19650-55 (1993)
- Table 2 shows the sequences from a wide variety of species, while Table 3 shows a list of synthetic GLP-I analogs; all of which are contemplated for use as glucose regulating peptides in the GPXTEN described herein.
- Exendin-4 binds at GLP-I receptors on insulin-secreting ⁇ TCl cells, and also stimulates somatostatin release and inhibits gastrin release in isolated stomachs (Goke, et al., J. Biol. Chem . 268: 19650-55, 1993). As a mimetic of GLP-I, exendin-4 displays a similar broad range of biological activities, yet has a longer half- life than GLP-I, with a mean terminal half- life of 2.4 h.
- Exenatide is a synthetic version of exendin-4, marketed as Byetta. However, due to its short half- life, exenatide is currently dosed twice daily, limiting its utility. Exendin-4-containing fusion proteins of the invention may find particular use in the treatment of diabetes and insulin resistance disorders.
- Glucagon means the human glucagon glucose regulating peptide, or species and sequence variants thereof, including the native 29 amino acid sequence and homologous sequences; natural, such as from primates, and non-natural sequence variants having at least a portion of the biological activity of native glucagon.
- the term "glucagon” as used herein also includes peptide mimetics of glucagon. Native glucagon is produced by the pancreas, released when blood glucose levels start to fall too low, causing the liver to convert stored glycogen into glucose and release it into the bloodstream.
- GLP-I means human glucagon like peptide- 1 and sequence variants thereof having at least a portion of the biological activity of native GLP-I.
- GLP-I includes human GLP-l(l-37), GLP- 1(7-37), and GLP-I (7-36)amide.
- GLP-I stimulates insulin secretion, but only during periods of hyperglycemia.
- the safety of GLP- 1 compared to insulin is enhanced by this property and by the observation that the amount of insulin secreted is proportional to the magnitude of the hyperglycemia.
- the biological half-life of GLP-I (7-37)OH is a mere 3 to 5 minutes (U.S. Pat. No. 5,118,666).
- GLP- 1 -containing fusion proteins of the invention may find particular use in the treatment of diabetes and insulin-resistance disorders for glucose regulation.
- GLP-I has been cloned and derivatives prepared, as described in U.S. Pat. No. 5,118,666.
- Non- limited examples of GLP-I sequences from a wide variety of species are shown in Table 2, while Table 3 shows the sequences of a number of synthetic GLP-I analogs; all of which are contemplated for use as glucose regulating peptides in the GPXTEN compositions described herein.
- Table 2 Naturally GLP-I Homologs
- GLP native sequences may be described by several sequence motifs, which are presented below. Letters in brackets represent acceptable amino acids at each sequence position: [HVY] [AGISTV] [DEHQ] [AG] [ILMPSTV] [FLY] [DINST] [ADEKNST] [ADENSTV] [LMVY] [ANRSTY] [EHIKNQRST] [AHILMQVY] [LMRT] [ADEGKQS] [ADEGKNQSY] [AEIKLMQR] [AKQRSVY] [AILMQSTV] [GKQR] [DEKLQR] [FHLVWY] [ILV] [ADEGPIKNQRST] [ADEGNRSTW] [GILVW] [AIKLMQSV] [ADGIKNQRST] [GKRSY].
- GLP- 1 and pramlintide can be useful as fusion partners to XTEN to create GPXTEN with biological activity useful in treatment of glucose-related disorders.
- Non- limited examples of synthetic GLP-I and pramlintide sequences can be found in Table 3.
- further sequences homologous to GLP-I, pramlintide, as well as sequences homologous to exendin- 4, amylin, or glucagon may be found by standard homology searching techniques.
- GLP-2 means human glucagon like peptide-2 and sequence variants thereof having at least a portion ⁇ f the biological activity ol native GLP -2. More particularly, GLP-2 is a 33 amino acid peptide, co- secreted along with GLP- 1 from intestinal endocrine cells in the small and large intestine.
- the present invention relates in part to fusion protein compositions comprising glucose regulating peptides (GP).
- the invention provides isolated monomeric fusion proteins of GP comprising the full-length sequence or sequence variants of GP covalently ⁇ inked to extended recombinant polypeptides ("XTEN" or "XTENs").
- XTEN extended recombinant polypeptides
- the fusion proteins can optionally include spacer sequences that further comprise cleavage sequences to release the GP from the fusion protein when acted on by a protease, releasing GP from the XTEN sequence(s).
- the invention provides an isolated fusion protein comprising at least a first biologically active glucose regulating peptide covalently linked to one or more extended recombinant polypeptides ("XTEN"), resulting in a glucose regulating peptide-XTEN fusion protein composition (hereinafter "GPXTEN").
- XTEN extended recombinant polypeptides
- GPXTEN glucose regulating peptide-XTEN fusion protein composition
- the glucose regulating peptide linked to one or more XTEN is inactive or has reduced activity that can optionally include spacer sequences that can further comprise cleavage sequences to release the GP from the fusion protein when acted on by a protease in a more active form.
- GPXTEN is meant to encompass fusion polypeptides that comprise one or more payload regions each comprising a biologically active GP that mediates one or more biological or therapeutic activities associated with a glucose regulating peptide and at least one other region comprising at least a first XTEN polypeptide that serves as a carrier.
- Polynucleotide sequences may be a wild type polynucleotide sequence encoding a given GP (e.g., either full length or mature), or in some instances the sequence may be a variant of the wild type polynucleotide sequence (e.g., a polynucleotide which encodes the wild type biologically active protein, wherein the DNA sequence of the polynucleotide has been optimized, for example, for expression in a particular species; or a polynucleotide encoding a variant of the wild type protein, such as a site directed mutant or an allelic variant.
- a variant of the wild type protein e.g., a polynucleotide which encodes the wild type biologically active protein, wherein the DNA sequence of the polynucleotide has been optimized, for example, for expression in a particular species
- a polynucleotide encoding a variant of the wild type protein such as a site directed mutant or an allelic variant
- the GP for inclusion in the GPXTEN of the invention include any glucose regulating peptide or sequence variant of biologic, therapeutic, prophylactic, or diagnostic interest or function, or that is useful for mediating or preventing or ameliorating a disease, disorder or condition associated with a glucose regulating peptide deficiency or a defect in sensitivity to one or more GP by the subject.
- GPXTEN fusion protein compositions for which an increase in a pharmacokinetic parameter, increased solubility, increased stability, or some other enhanced pharmaceutical property compared to native GP is sought, or for which increasing the terminal half-life would improve efficacy, safety, or result in reduce dosing frequency and/or improve patient compliance.
- the GPXTEN fusion protein compositions are prepared with various objectives in mind, including improving the therapeutic efficacy of the bioactive GP by, for example, increasing the in vivo exposure or the length that the GPXTEN remains within the therapeutic window when administered to a subject, compared to a GP not linked to XTEN.
- the GP incorporated into the subject compositions can be a recombinant polypeptide with a sequence corresponding to a protein found in nature.
- the GP can be sequence variants, fragments, homologs, and mimetics of a natural sequence that retain at least a portion of the biological activity of the native GP.
- the GP for incorporation into the GPXTEN of the invention can be a sequence that exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or at least about 99%, or 100% sequence identity to a protein sequence selected from the sequences of Table 1 , Table 2 and Table 3.
- a GPXTEN fusion protein can comprise a single GP molecule linked to an XTEN (as described more fully below).
- the GPXTEN can comprise a first GP and a second molecule of the same GP, resulting in a fusion protein comprising the two GP linked to one or more XTEN (for example, two molecules of GLP-I).
- the GPXTEN fusion protein can comprise a single GP molecule linked to a first and a second XTEN, with an N- to C-terminus configuration of XTEN-GP-XTEN, in which the GP can be a sequence that exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or at least about 99%, or 100% sequence identity to a sequence selected from the sequences of Table 1, Table 2 and Table 3, and the first and/or the second XTEN can be sequences that exhibits at least about 80% sequence identity, or alternatively 81%, 82%
- the GP fusion partner component of the GPXTEN will exhibit a binding specificity to a given target or another desired biological characteristic when used in vivo or when utilized in an in vitro assay.
- the GPXTEN can be an agonist, having the ability to bind to a cell receptor for a glucose regulating peptide.
- the binding of GPXTEN to its receptor can lead to at least a portion of the activation of intercellular signal transduction pathway compared to the corresponding native glucose regulating peptide not linked to XTEN.
- the GPXTEN bound to a cell receptor for a glucose regulating peptide can exhibit at least about 1%, or about 5%, or about 10%, or about 15%, or about 20%, or about 25%, or about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 80%, or about 90%, or at least about 95% of the activation of intercellular signal transduction pathway compared to native glucose regulating peptide not linked to XTEN.
- the subject GPXTEN of the present invention can exhibit an enhancement of one or more pharmacokinetic parameters, which optionally could be enhanced for a biologic effect by release of GP from the fusion protein by cleavage of a spacer sequence.
- the GPXTEN with enhanced pharmacokinetic parameters would permit less frequent dosing or an enhanced pharmacologic effect, such as but not limited to maintaining the biologically active GPXTEN within the therapeutic window between the minimum effective dose or blood concentration (C mn ) and the maximum tolerated dose or blood concentration (C m3x ).
- the linking of the GP to a fusion protein comprising a select XTEN sequence(s) can result in an improvement in these properties, making them more useful as therapeutic or preventive agents compared to GP not linked to XTEN.
- the invention provides XTEN polypeptide compositions that are useful as a fusion protein partner to which GP is linked, resulting in a GPXTEN fusion protein.
- XTEN are generally extended length polypeptides with non-naturally occurring, substantially non-repetitive sequences that are composed mainly of small hydrophilic amino acids, with the sequence having a low degree or no secondary or tertiary structure under physiologic conditions.
- XTENs can have utility as a fusion protein partners partner in that they can serve as a "carrier", conferring certain desirable pharmacokinetic, physicochemical and pharmaceutical properties when linked to a GP protein to a create a fusion protein. Such desirable properties include but are not limited to enhanced pharmacokinetic parameters and solubility characteristics of the compositions, amongst other properties described below. Such fusion protein compositions have utility to treat certain glucose regulating peptide - related diseases, disorders or conditions, as described herein. As used herein, "XTEN” specifically excludes antibodies or antibody fragments such as single-chain antibodies or Fc fragments of a light chain or a heavy chain.
- XTEN are long polypeptides having greater than about 100 to about 3000 amino acid residues, preferably greater than 400 to about 3000 residues when used as a carrier or cumulatively when more than one XTEN unit is used in a single fusion protein.
- an XTEN sequence shorter than 100 amino acid residues such as about 96, or about 84, or about 72, or about 60, or about 48, or about 36 amino acid residues may be incorporated into a fusion protein composition with the GP to effect the property.
- the selection criteria for the XTEN to be linked to the biologically active proteins used to create the inventive fusion proteins compositions generally relate to attributes of physical/chemical properties and conformational structure of the XTEN that can be, in turn, used to confer enhanced pharmaceutical and pharmacokinetic properties to the fusion protein compositions.
- the XTEN of the present invention may exhibit one or more of the following advantageous properties: conformational flexibility, enhanced aqueous solubility, high degree of protease resistance, low immunogenicity, low binding to mammalian receptors, and increased hydrodynamic (or Stokes) radii; properties that can make them particularly useful as fusion protein partners.
- Non-limiting examples of the properties of the fusion proteins comprising GP that may be enhanced by XTEN include increases in the overall solubility and/or metabolic stability, reduced susceptibility to proteolysis, reduced immunogenicity, reduced rate of absorption when administered subcutaneously or intramuscularly, and enhanced pharmacokinetic properties such as longer terminal half- life and increased area under the curve (AUC), slower absorption after subcutaneous or intramuscular injection compared to GP not linked to XTEN and administered by a similar route such that the C max is lower, which may, in turn, result in reductions in adverse effects of the GP that, collectively with increased half- life and/or AUC, can result in an increased period of time that a fusion protein of a GPXTEN composition administered to a subject retains therapeutic activity.
- AUC area under the curve
- a variety of methods and assays are known in the art for determining the physical/chemical properties of proteins such as the compositions comprising the inventive XTEN; properties such as solubility, secondary or tertiary structure, solubility, protein aggregation, melting properties, contamination and water content.
- Such methods include analytical centrifugation, EPR, HPLC-ion exchange, HPLC-size exclusion, HPLC-reverse phase, light scattering, capillary electrophoresis, circular dichroism, differential scanning calorimetry, fluorescence, HPLC-ion exchange, HPLC-size exclusion, IR, NMR, Raman spectroscopy, refractometry, and UV/Visible spectroscopy. Additional methods are disclosed in Arnau et al., Prot Expr and Purif (2006) 48, 1-13. Application of these methods to the invention would be within the grasp of a person skilled in the art.
- XTEN are designed to behave like denatured peptide sequences under physiological conditions, despite the extended length of the polymer.
- Denatured describes the state of a peptide in solution that is characterized by a large conformational freedom of the peptide backbone. Most peptides and proteins adopt a denatured conformation in the presence of high concentrations of denaturants or at elevated temperature. Peptides in denatured conformation have, for example, characteristic circular dichroism (CD) spectra and are characterized by a lack of long-range interactions as determined by NMR.
- CD characteristic circular dichroism
- the invention provides XTEN sequences that, under physiologic conditions, can resemble denatured sequences largely devoid in secondary structure.
- the XTEN sequences can be substantially devoid of secondary structure under physiologic conditions.
- “Largely devoid,” as used in this context, means that less than 50% of the XTEN amino acid residues of the XTEN sequence contribute to secondary structure as measured or determined by the means described herein.
- “Substantially devoid,” as used in this context, means that at least about 60%, or about 70%, or about 80%, or about 90%, or about 95%, or at least about 99% of the XTEN amino acid residues of the XTEN sequence do not contribute to secondary structure, as measured or determined by the means described herein.
- Secondary structure can be measured spectrophotometrically, e.g., by circular dichroism spectroscopy in the "far-UV" spectral region (190-250 nm). Secondary structure elements, such as alpha-helix and beta-sheet, each give rise to a characteristic shape and magnitude of CD spectra. Secondary structure can also be predicted for a polypeptide sequence via certain computer programs or algorithms, such as the well-known Chou-Fasman algorithm (Chou, P. Y., et al.
- the XTEN sequences used in the inventive fusion protein compositions can have an alpha-helix percentage ranging from 0% to less than about 5% as determined by a Chou-Fasman algorithm. In other cases, the XTEN sequences of the fusion protein compositions can have a beta-sheet percentage ranging from 0% to less than about 5% as determined by a Chou-Fasman algorithm. In some cases, the XTEN sequences of the fusion protein compositions can have an alpha-helix percentage ranging from 0% to less than about 5% and a beta-sheet percentage ranging from 0% to less than about 5% as determined by a Chou-Fasman algorithm.
- the XTEN sequences of the fusion protein compositions will have an alpha-helix percentage less than about 2% and a beta-sheet percentage less than about 2%. In other cases, the XTEN sequences of the fusion protein compositions can have a high degree of random coil percentage, as determined by a GOR algorithm. In some embodiments, an XTEN sequence can have at least about 80%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, and most preferably at least about 99% random coil, as determined by a GOR algorithm. 1. Non-repetitive Sequences
- XTEN sequences of the subject compositions can be substantially non-repetitive.
- repetitive amino acid sequences have a tendency to aggregate or form higher order structures, as exemplified by natural repetitive sequences such as collagens and leucine zippers, or form contacts resulting in crystalline or pseudocrystaline structures.
- the low tendency of non-repetitive sequences to aggregate enables the design of long-sequence XTENs with a relatively low frequency of charged amino acids that would be likely to aggregate if the sequences were otherwise repetitive.
- the GPXTEN fusion proteins comprise XTEN sequences of greater than about 100 to about 3000 amino acid residues, preferably greater than 400 to about 3000 cumulative residues, wherein the sequences are substantially non-repetitive.
- the XTEN sequences can have greater than about 100 to about 3000 amino acid residues in which no three contiguous amino acids in the sequence are identical amino acid types unless the amino acid is serine, in which case no more than three contiguous amino acids are serine residues.
- the XTEN sequence would be substantially non-repetitive.
- the degree of repetitiveness of a polypeptide or a gene can be measured by computer programs or algorithms or by other means known in the art. Repetitiveness in a polypeptide sequence can, for example, be assessed by determining the number of times shorter sequences of a given length occur within the polypeptide. For example, a polypeptide of 200 amino acid residues has 192 overlapping 9-amino acid sequences (or 9-mer "frames") and 198 3-mer frames, but the number of unique 9-mer or 3-mer sequences will depend on the amount of repetitiveness within the sequence.
- a score can be generated (hereinafter "subsequence score") that is reflective of the degree of repetitiveness of the subsequences in the overall polypeptide sequence.
- subsequence score means the sum of occurrences of each unique 3-mer frame across a 200 consecutive amino acid sequence of the polypeptide divided by the absolute number of unique 3-mer subsequences within the 200 amino acid sequence. Examples of such subsequence scores derived from the first 200 amino acids of repetitive and non-repetitive polypeptides are presented in Example 40.
- the present invention provides GPXTEN each comprising one or more XTEN in which the XTEN can have a subsequence score less than 12, more preferably less than 10, more preferably less than 9, more preferably less than 8, more preferably less than 7, more preferably less than 6, and most preferably less than 5 when derived from a segment of 200 contiguous amino acid residues.
- an XTEN with a subsequence score less than about 10 would be “substantially non-repetitive.”
- the non-repetitive characteristic of XTEN can impart to fusion proteins with GP a greater degree of solubility and less tendency to aggregate compared to polypeptides having repetitive sequences. These properties can facilitate the formulation of XTEN-comprising pharmaceutical preparations containing extremely high drug concentrations, in some cases exceeding 100 mg/ml.
- the XTEN polypeptide sequences of the embodiments are designed to have a low degree of internal repetitiveness in order to reduce or substantially eliminate immunogenicity when administered to a mammal.
- Polypeptide sequences composed of short, repeated motifs largely limited to three amino acids, such as glycine, serine and glutamate, may result in relatively high antibody titers when administered to a mammal despite the absence of predicted T-cell epitopes in these sequences.
- the present invention encompasses XTEN that can comprise multiple units of shorter sequences, or motifs, in which the amino acid sequences of the motifs are non-repetitive.
- XTEN sequences it was discovered that the non-repetitive criterion may be met despite the use of a "building block" approach using a library of sequence motifs that are multimerized to create the XTEN sequences.
- an XTEN sequence may consist of multiple units of as few as four different types of sequence motifs, because the motifs themselves generally consist of non-repetitive amino acid sequences, the overall XTEN sequence is rendered substantially non-repetitive.
- XTEN can have a non-repetitive sequence of greater than about 100 to about 3000 amino acid residues, or greater than 400 to about 3000 residues, wherein at least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 97%, or about 100% of the XTEN sequence consists of non-overlapping sequence motifs, wherein each of the motifs has about 9 to 36 amino acid residues. In other embodiments, at least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 97%, or about 100% of the XTEN sequence consists of non-overlapping sequence motifs wherein each of the motifs has 9 to 14 amino acid residues.
- At least about 80%, or at least about 85%, or at least about 90%, or at least about 95%, or at least about 97%, or about 100% of the XTEN sequence component consists of non-overlapping sequence motifs wherein each of the motifs has 12 amino acid residues.
- the sequence motifs be composed mainly of small hydrophilic amino acids, such that the overall sequence has an unstructured, flexible characteristic.
- amino acids that can be included in XTEN are, e.g., arginine, lysine, threonine, alanine, asparagine, glutamine, aspartate, glutamate, serine, and glycine.
- XTEN compositions with enhanced characteristics mainly include glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) residues wherein the sequences are designed to be substantially non-repetitive.
- XTEN sequences have predominately four to six types of amino acids selected from glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) or proline (P) that are arranged in a substantially non-repetitive sequence that is greater than about 100 to about 3000 amino acid residues, or greater than 400 to about 3000 residues in length.
- G glycine
- A alanine
- S serine
- T threonine
- E glutamate
- P proline
- XTEN can have sequences of greater than about 100 to about 3000 amino acid residues, or greater than 400 to about 3000 residues, wherein at least about 80% of the sequence consists of non-overlapping sequence motifs wherein each of the motifs has 9 to 36 amino acid residues wherein each of the motifs consists of 4 to 6 types of amino acids selected from glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P), and wherein the content of any one amino acid type in the full-length XTEN does not exceed 30%.
- G glycine
- A alanine
- S serine
- T threonine
- P proline
- At least about 90% of the XTEN sequence consists of non-overlapping sequence motifs wherein each of the motifs has 9 to 36 amino acid residues wherein the motifs consist of 4 to 6 types of amino acids selected from glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P), and wherein the content of any one amino acid type in the full-length XTEN does not exceed 30%.
- G glycine
- A alanine
- S serine
- T threonine
- P proline
- At least about 90% of the XTEN sequence consists of non-overlapping sequence motifs wherein each of the motifs has 12 amino acid residues consisting of 4 to 6 types of amino acids selected from glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P), and wherein the content of any one amino acid type in the full-length XTEN does not exceed 30%.
- At least about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99%, to about 100% of the XTEN sequence consists of non-overlapping sequence motifs wherein each of the motifs has 12 amino acid residues consisting of glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P), and wherein the content of any one amino acid type in the full-length XTEN does not exceed 30%.
- XTENs comprise non-repetitive sequences of greater than about 100 to about 3000 amino acid residues, or greater than 400 to about 3000 amino acid residues wherein at least about 80%, or at least about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% of the sequence consists of non-overlapping sequence motifs of 9 to 14 amino acid residues wherein the motifs consist of 4 to 6 types of amino acids selected from glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P), and wherein the sequence of any two contiguous amino acid residues in any one motif is not repeated more than twice in the sequence motif.
- G glycine
- A alanine
- S serine
- T threonine
- P proline
- At least about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% of an XTEN sequence consists of non- overlapping sequence motifs of 12 amino acid residues wherein the motifs consist of 4 to 6 types of amino acids selected from glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P), and wherein the sequence of any two contiguous amino acid residues in any one sequence motif is not repeated more than twice in the sequence motif.
- At least about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% of an XTEN sequence consists of non-overlapping sequence motifs of 12 amino acid residues wherein the motifs consist of glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P), and wherein the sequence of any two contiguous amino acid residues in any one sequence motif is not repeated more than twice in the sequence motif.
- XTENs consist of 12 amino acid sequence motifs wherein the amino acids are selected from glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P), and wherein the sequence of any two contiguous amino acid residues in any one sequence motif is not repeated more than twice in the sequence motif, and wherein the content of any one amino acid type in the full-length XTEN does not exceed 30%.
- G glycine
- A alanine
- S serine
- T threonine
- E glutamate
- P proline
- the invention provides compositions comprising non-repetitive XTEN sequence(s) of greater than about 100 to about 3000 amino acid residues, or of cumulatively greater than 400 to about 3000 residues, wherein at least about 80%, or at least about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% to about 100% of the sequence consists of multiple units of two or more non-overlapping sequence motifs selected from the amino acid sequences of Table 4.
- the XTEN comprises non-overlapping sequence motifs in which about 80%, or at least about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% to about 100% of the sequence consists of two or more non-overlapping sequences selected from a single motif family of Table 4, resulting in a "family" sequence in which the overall sequence remains substantially non-repetitive.
- an XTEN sequence can comprise multiple units of non-overlapping sequence motifs of the AD motif family, or the AE motif family, or the AF motif family, or the AG motif family, or the AM motif family, or the AQ motif family, or the BC family, or the BD family of sequences of Table 4.
- the XTEN comprises motif sequences from two or more of the motif families of Table 4.
- GPXTEN composition can comprise one or more non-repetitive XTEN sequences of greater than about 100 to about 3000 amino acid residues, or cumulatively greater than 400 to about 3000 residues, wherein at least about 80%, or at least about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99% to about 100% of the sequence consists of non-overlapping 36 amino acid sequence motifs selected from one or more of the polypeptide sequences of Tables 10-13.
- the XTEN component of the GPXTEN fusion protein has less than 100% of its amino acids consisting of four to six amino acid selected from glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P), or less than 100% of the sequence consisting of the sequence motifs of Table 4, or less than 100% sequence identity with an XTEN from Table 5,
- the other amino acid residues can be selected from any other of the 14 natural L-amino acids, but are preferentially selected from hydrophilic amino acids such that the XTEN sequence contains at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% hydrophilic amino acids.
- the XTEN amino acids that are not glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) are interspersed throughout the XTEN sequence, are located within or between the sequence motifs, or are concentrated in one or more short stretches of the XTEN sequence.
- the XTEN component of the GPXTEN comprises amino acids other than glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P)
- it is preferred that the amino acids not be hydrophobic residues and should not substantially confer secondary structure of the XTEN component.
- Hydrophobic residues that are less favored in construction of XTEN include tryptophan, phenylalanine, tyrosine, leucine, isoleucine, valine, and methionine. Additionally, one can design the XTEN sequences to contain few (e.g. less than 5%) or none of the following amino acids: cysteine (to avoid disulfide formation and oxidation), methionine (to avoid oxidation), asparagine and glutamine (to avoid desamidation).
- the XTEN component of the GPXTEN fusion protein comprising other amino acids in addition to glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) would have a sequence with less than 5% of the residues contributing to alpha-helices and beta-sheets as measured by the Chou-Fasman algorithm and would have at least 90%, or at least about 95% or more random coil formation as measured by the GOR algorithm. 3. Length of Sequence
- the invention encompasses GPXTEN compositions comprising carriers of XTEN polypeptides with extended length sequences.
- the present invention makes use of the discovery that increasing the length of non-repetitive, unstructured polypeptides enhances the unstructured nature of the XTENs and correspondingly enhances the biological and pharmacokinetic properties of fusion proteins comprising the XTEN carrier.
- proportional increases in the length of the XTEN can result in a sequence with a higher percentage of random coil formation, as determined by GOR algorithm, compared to shorter XTEN lengths.
- Non- limiting examples of XTEN contemplated for inclusion in the GPXTEN of the invention are presented in Table 5.
- the invention provides GPXTEN compositions wherein the XTEN sequence length of the fusion protein(s) is greater than about 100 to about 3000 amino acid residues, and in some cases is greater than 400 to about 3000 amino acid residues, wherein the XTEN confers enhanced pharmacokinetic properties on the GPXTEN in comparison to GP not linked to XTEN.
- the XTEN sequences of the GPXTEN compositions of the present invention can be about 100, or about 144, or about 288, or about 401, or about 500, or about 600, or about 700, or about 800, or about 900, or about 1000, or about 1500, or about 2000, or about 2500 or up to about 3000 amino acid residues in length.
- the XTEN sequences can be about 100 to 150, about 150 to 250, about 250 to 400, 401 to about 500, about 500 to 900, about 900 to 1500, about 1500 to 2000, or about 2000 to about 3000 amino acid residues in length.
- the GPXTEN can comprise an XTEN sequence wherein the sequence exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a XTEN selected from Table 5.
- the XTEN sequence is designed for optimized expression as the N-terminal component of the GPXTEN by inclusion of encoding nucleotides for an optimized N-terminal leader sequence (NTS) in the XTEN portion of the gene encoding the fusion protein.
- NTS N-terminal leader sequence
- the N-terminal XTEN sequence of the expressed GPXTEN has at least 90% sequence identity to the sequence of AE48 or AM48, AE624, or AE912 or AM923. In another embodiment of the foregoing, the XTEN has the N-terminal residues described in Examples 14-17.
- the GPXTEN fusion protein can comprise a first and a second XTEN sequence, wherein the cumulative total of the residues in the XTEN sequences is greater than about 400 to about 3000 amino acid residues.
- the GPXTEN fusion protein can comprise a first and a second XTEN sequence wherein the sequences each exhibit at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to at least a first or additionally a second XTEN selected from Table 5.
- the invention provides methods in which the GPXTEN is designed by selecting the length of the XTEN to confer a target half-life on a fusion protein administered to a subject.
- XTEN lengths longer that about cumulative 400 residues incorporated into the GPXTEN compositions result in longer half-life compared to shorter cumulative lengths; e.g., shorter than about 280 residues.
- GPXTEN fusion proteins can be designed to comprise XTEN with a longer sequence length that is selected to additionally confer slower rates of systemic absorption after subcutaneous or intramuscular administration to a subject.
- the C max is reduced in comparison to a comparable dose of a GP not linked to XTEN, thereby contributing to the ability to keep the GPXTEN within the therapeutic window for the composition.
- the XTEN confers the property of a depot to the administered GPXTEN, in addition to the other physical/chemical properties described herein.
- the invention provides an isolated GPXTEN fusion protein wherein the cumulative length of the XTEN component is greater than about 100 to about 3000 amino acid residues containing at least one polypeptide sequence segment selected from Tables 5, 10, 11, 12, and 13 and wherein at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98% or more of the remainder of the XTEN sequence consists of hydrophilic amino acids and less than about 2% of the remainder of the XTEN by and large contains hydrophobic, aromatic or cysteine amino acids.
- the XTEN can contain multiple segments wherein the segments are identical or different.
- the invention provides an isolated GPXTEN fusion protein wherein the cumulative length of the XTEN component is greater than about 100 to about 3000 amino acid residues and comprises at least one sequence segment of at least about 100 to about 923, or at least about 100 to about 875, or at least about 100 to about 576, or at least about 100 to about 288, or at least about 100 to about 144 amino acid residues wherein the sequence segment(s) consists of at least three different types of amino acids and the sum of glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) residues in the sequence segment(s) constitutes at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 9
- G glycine
- the invention provides an isolated GPXTEN fusion protein wherein the cumulative length of the XTEN component is greater than about 100 to about 3000 amino acid residues and comprises at least one sequence segment of at least about 200 to about 923, or at least about 200 to about 875, or at least about 200 to about 576, or at least about 200 to about 288 amino acid residues wherein the sequence segment(s) the sum of glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) residues in the sequence segment(s) constitutes at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% of the total amino acid sequence of the sequence segment and wherein the subsequence score of the segment is less than 12, more preferably less than 10, more preferably less
- the invention provides a short-length XTEN sequence as the N-terminal portion of the GPXTEN fusion protein.
- the expression of the fusion protein is enhanced in a host cell transformed with a suitable expression vector comprising an optimized N-terminal leader polynucleotide sequence (that encodes the N-terminal XTEN) incorporated into the polynucleotide encoding the binding fusion protein.
- NTS N-terminal leader sequence
- the invention provides GPXTEN fusion proteins comprising an NTS wherein the expression of the binding fusion protein from the encoding gene in a host cell is enhanced about 50%, or about 75%, or about 100%, or about 150%, or about 200%, or about 400% compared to expression of a GPXTEN fusion protein not comprising the N-terminal XTEN sequence (where the encoding gene lacks the NTS).
- the N-terminal XTEN polypeptide of the GPXTEN comprises a sequence that exhibits at least about 80%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least 99%, or exhibits 100% sequence identity to the amino acid sequence of AE48 or AM48, the respective sequences of which are as follows:
- the short-length N-terminal XTEN can be linked to an XTEN of longer length to form the N-terminal region of the GPXTEN fusion protein, wherein the polynucleotide sequence encoding the short-length N-terminal XTEN confers the property of enhanced expression in the host cell, and wherein the long length of the expressed XTEN contributes to the enhanced properties of the XTEN carrier in the fusion protein, as described above.
- the short-length XTEN can be linked to any of the XTEN disclosed herein (e.g., an XTEN of Table 5) and the resulting XTEN, in turn, is linked to the N- terminal of any of the GP disclosed herein (e.g., a GP of Tables 1-3) as a component of the fusion protein.
- polynucleotides encoding the short-length XTEN (or its complement) is linked to polynucleotides encoding any of the XTEN (or its complement) disclosed herein and the resulting gene encoding the N-terminal XTEN, in turn, is linked to the 5' end of polynucleotides encoding any of the GP (or to the 3 ' end of its complement) disclosed herein.
- the N-terminal XTEN polypeptide with long length exhibits at least about 80%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least 99%, or exhibits 100% sequence identity to an amino acid sequence selected from the group consisting of the sequences AE624, AE912, and AM923.
- the N-terminal XTEN can have from about one to about six additional amino acid residues, preferably selected from GESTPA, to accommodate the restriction endonuclease restriction sites that would be employed to join the nucleotides encoding the N-terminal XTEN to the gene encoding the targeting moiety of the fusion protein.
- additional amino acid residues preferably selected from GESTPA
- the XTEN polypeptides have an unstructured characteristic imparted by incorporation of amino acid residues with a net charge and/or reducing the proportion of hydrophobic amino acids in the XTEN sequence.
- the overall net charge and net charge density is controlled by modifying the content of charged amino acids in the XTEN sequences.
- the net charge density of the XTEN of the compositions may be above +0.1 or below -0.1 charges/residue.
- the net charge of a XTEN can be about 0%, about 1%, about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10% about 11%, about 12%, about 13%, about 14%, about 15%, about 16%, about 17%, about 18%, about 19%, or about 20% or more.
- the XTEN sequences are designed to have a net negative charge to minimize non-specific interactions between the XTEN containing compositions and various surfaces such as blood vessels, healthy tissues, or various receptors.
- the XTEN can adopt open conformations due to electrostatic repulsion between individual amino acids of the XTEN polypeptide that individually carry a net negative charge and that are distributed across the sequence of the XTEN polypeptide.
- Such a distribution of net negative charge in the extended sequence lengths of XTEN can lead to an unstructured conformation that, in turn, can result in an effective increase in hydrodynamic radius.
- the negative charge is conferred by incorporation of glutamic acid residues.
- the invention provides XTEN in which the XTEN sequences contain about 8, 10, 15, 20, 25, or even about 30% glutamic acid. Generally, the glutamic residues would be spaced uniformly across the XTEN sequence.
- the XTEN can contain about 10-80, or about 15-60, or about 20-50 glutamic residues residues per 2OkD of XTEN that can result in an XTEN with charged residues that would have very similar pKa, which can increase the charge homogeneity of the product and sharpen its isoelectric point, enhancing the physicochemical properties of the resulting GPXTEN fusion protein for, example, simplifying purification procedures.
- the XTEN of the compositions of the present invention generally have no or a low content of positively charged amino acids.
- the XTEN may have less than about 10% amino acid residues with a positive charge, or less than about 7%, or less than about 5%, or less than about 2%, or less than about 1% amino acid residues with a positive charge.
- the invention contemplates constructs where a limited number of amino acids with a positive charge, such as lysine, are incorporated into XTEN to permit conjugation between the epsilon amine of the lysine and a reactive group on a peptide, a linker bridge, or a reactive group on a drug or small molecule to be conjugated to the XTEN backbone.
- the XTEN has between about 1 to about 100 lysine residues, or about 1 to about 70 lysine residues, or about 1 to about 50 lysine residues, or about 1 to about 30 lysine residues, or about 1 to about 20 lysine residues, or about 1 to about 10 lysine residues, or about 1 to about 5 lysine residues, or alternatively only a single lysine residue.
- fusion proteins are constructed that comprises XTEN, a glucose regulating peptide, plus a chemotherapeutic agent useful in the treatment of glucose diseases or disorders, wherein the maximum number of molecules of the agent incorporated into the XTEN component is determined by the numbers of lysines or other amino acids with reactive side chains (e.g., cysteine) incorporated into the XTEN.
- the XTEN sequence comprises charged residues separated by other residues such as serine or glycine, which leads to better expression or purification behavior. Based on the net charge, some XTENs have an isoelectric point (pi) of 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, or even 6.5. In preferred embodiments, the XTEN will have an isoelectric point between 1.5 and 4.5. In these embodiments, the XTEN incorporated into the GPXTEN fusion protein compositions of the present invention carry a net negative charge under physiologic conditions that contribute to the unstructured conformation and reduced binding of the XTEN component to mammalian proteins and tissues.
- the invention provides that the content of hydrophobic amino acids in the XTEN will typically be less than 5%, or less than 2%, or less than 1% hydrophobic amino acid content.
- the amino acid content of methionine and tryptophan in the XTEN component of a GPXTEN fusion protein is typically less than 5%, or less than 2%, and most preferably less than 1%.
- the XTEN will have a sequence that has less than 10% amino acid residues with a positive charge, or less than about 7%, or less that about 5%, or less than about 2% amino acid residues with a positive charge, the sum of methionine and tryptophan residues will be less than 2%, and the sum of asparagine and glutamine residues will be less than 10% of the total XTEN sequence.
- the invention provides compositions in which the XTEN sequences have a low degree of immunogenicity or are substantially non-immunogenic.
- Several factors can contribute to the low immunogenicity of XTEN, e.g., the non-repetitive sequence, the unstructured conformation, the high degree of solubility, the low degree or lack of self-aggregation, the low degree or lack of proteolytic sites within the sequence, and the low degree or lack of epitopes in the XTEN sequence.
- Conformational epitopes are formed by regions of the protein surface that are composed of multiple discontinuous amino acid sequences of the protein antigen.
- the precise folding of the protein brings these sequences into a well-defined, stable spatial configurations, or epitopes, that can be recognized as "foreign" by the host humoral immune system, resulting in the production of antibodies to the protein orthe activation of a cell-mediated immune response.
- the immune response to a protein in an individual is heavily influenced by T-cell epitope recognition that is a function of the peptide binding specificity of that individual's HLA-DR allotype.
- a lower degree of immunogenicity is achieved by designing XTEN sequences that resist antigen processing in antigen presenting cells, and/or choosing sequences that do not bind MHC receptors well.
- the invention provides GPXTEN fusion proteins with substantially non-repetitive XTEN polypeptides designed to reduce binding with MHC II receptors, as well as avoiding formation of epitopes for T-cell receptor or antibody binding, resulting in a low degree of immunogenicity. Avoidance of immunogenicity is, in part, a direct result of the conformational flexibility of XTEN sequences; i.e., the lack of secondary structure due to the selection and order of amino acid residues.
- fusion proteins comprising XTEN using conventional therapeutic practices and dosing, would generally not result in the formation of neutralizing antibodies to the XTEN sequence, and also reduce the immunogenicity of the GP fusion partner in the GPXTEN compositions.
- the XTEN sequences utilized in the subject fusion proteins can be substantially free of epitopes recognized by human T cells.
- the elimination of such epitopes for the purpose of generating less immunogenic proteins has been disclosed previously; see for example WO 98/52976, WO 02/079232, and WO 00/3317 which are incorporated by reference herein.
- Assays for human T cell epitopes have been described (Stickler, M., et al. (2003) J Immunol Methods , 281 : 95-108).
- peptide sequences that can be oligomerized without generating T cell epitopes or non-human sequences.
- the XTEN sequences are substantially non-immunogenic by the restriction of the numbers of epitopes of the XTEN predicted to bind MHC receptors. With a reduction in the numbers of epitopes capable of binding to MHC receptors, there is a concomitant reduction in the potential for T cell activation as well as T cell helper function, reduced B cell activation or upregulation and reduced antibody production.
- the low degree of predicted T-cell epitopes can be determined by epitope prediction algorithms such as, e.g., TEPITOPE (Sturniolo, T., et al. (1999) Nat Biotechnol, 17: 555-61), as shown in Example 45.
- the TEPITOPE score of a given peptide frame within a protein is the log of the K d (dissociation constant, affinity, off-rate) of the binding of that peptide frame to multiple of the most common human MHC alleles, as disclosed in Sturniolo, T. et al. (1999) Nature Biotechnology 17:555).
- the score ranges over at least 20 logs, from about 10 to about -10 (corresponding to binding constraints of 1Oe 10 K d to 1Oe 40 K d ), and can be reduced by avoiding hydrophobic amino acids that serve as anchor residues during peptide display on MHC, such as M, I, L, V, F.
- an XTEN component incorporated into a GPXTEN does not have a predicted T-cell epitope at a TEPITOPE score of about -5 or greater, or -6 or greater, or -7 or greater, or -8 or greater, or at a TEPITOPE score of -9 or greater.
- the inventive XTEN sequences are rendered substantially non-immunogenic by the restriction of known proteolytic sites from the sequence of the XTEN, reducing the processing of XTEN into small peptides that can bind to MHC II receptors.
- the XTEN sequence is rendered substantially non- immunogenic by the use a sequence that is substantially devoid of secondary structure, conferring resistance to many proteases due to the high entropy of the structure.
- an XTEN of a GPXTEN fusion protein can have >100 nM K d binding to a mammalian receptor, or greater than 500 nM K d , or greater than 1 ⁇ M K d towards a mammalian cell surface or circulating polypeptide receptor.
- the non-repetitive sequence and corresponding lack of epitopes of XTEN limit the ability of B cells to bind to or be activated by XTEN.
- a repetitive sequence is recognized and can form multivalent contacts with even a few B cells and, as a consequence of the cross-linking of multiple T-cell independent receptors, can stimulate B cell proliferation and antibody production.
- each individual B cell may only make one or a small number of contacts with an individual XTEN due to the lack of repetitiveness of the sequence.
- XTENs typically have a much lower tendency to stimulate proliferation of B cells and thus an immune response.
- the GPXTEN may have reduced immunogenicity as compared to the corresponding GP that is not fused.
- the administration of up to three parenteral doses of a GPXTEN to a mammal result in detectable anti-GPXTEN IgG at a serum dilution of 1 : 100 but not at a dilution of 1 : 1000.
- the administration of up to three parenteral doses of an GPXTEN to a mammal may result in detectable anti-GP IgG at a serum dilution of 1 : 100 but not at a dilution of 1 : 1000.
- the administration of up to three parenteral doses of a GPXTEN to a mammal result in detectable anti-GP IgG at a serum dilution of 1 : 100 but not at a dilution of 1 : 1000.
- the administration of up to three parenteral doses of a GPXTEN to a mammal results in detectable anti-XTEN IgG at a serum dilution of 1 : 100 but not at a dilution of 1 : 1000.
- the mammal can be a mouse, a rat, a rabbit, or a cynomolgus monkey.
- Non-repetitive XTENs form weaker contacts with antibodies.
- Antibodies are multivalent molecules. For instance, IgGs have two identical binding sites and IgMs contain 10 identical binding sites. Thus antibodies against repetitive sequences can form multivalent contacts with such repetitive sequences with high avidity, which can affect the potency and/or elimination of such repetitive sequences.
- antibodies against non-repetitive XTENs may yield monovalent interactions, resulting in less likelihood of immune clearance such that the GPXTEN compositions can remain in circulation for an increased period of time.
- the present invention provides XTEN in which the XTEN polypeptides have a high hydrodynamic radius that confers a corresponding increased Apparent Molecular Weight to the GPXTEN fusion protein incorporating the XTEN.
- the linking of XTEN to GP sequences can result in GPXTEN compositions that can have increased hydrodynamic radii, increased Apparent Molecular Weight, and increased Apparent Molecular Weight Factor compared to a GP not linked to an XTEN.
- compositions in which a XTEN with a high hydrodynamic radius is incorporated into a fusion protein comprising one or more GP can effectively enlarge the hydrodynamic radius of the composition beyond the glomerular pore size of approximately 3-5 nm (corresponding to an apparent molecular weight of about 70 kDA) (Caliceti. 2003. Pharmacokinetic and biodistribution properties of poly(ethylene glycol)-protein conjugates. Adv Drug Deliv Rev 55: 1261-1277), resulting in reduced renal clearance of circulating proteins.
- the hydrodynamic radius of a protein is determined by its molecular weight as well as by its structure, including shape or compactness.
- the XTEN can adopt open conformations due to electrostatic repulsion between individual charges of the peptide or the inherent flexibility imparted by the particular amino acids in the sequence that lack potential to confer secondary structure.
- the open, extended and unstructured conformation of the XTEN polypeptide can have a greater proportional hydrodynamic radius compared to polypeptides of a comparable sequence length and/or molecular weight that have secondary and/or tertiary structure, such as typical globular proteins.
- Methods for determining the hydrodynamic radius are well known in the art, such as by the use of size exclusion chromatography (SEC), as described in U.S. Patent Nos. 6,406,632 and 7,294,513.
- the GPXTEN fusion protein can be configured with an XTEN such that the fusion protein can have a hydrodynamic radius of at least about 5 nm, or at least about 8 nm, or at least about 10 nm, or 12 nm, or at least about 15 nm.
- the large hydrodynamic radius conferred by the XTEN in an GPXTEN fusion protein can lead to reduced renal clearance of the resulting fusion protein, leading to a corresponding increase in terminal half-life, an increase in mean residence time, and/or a decrease in renal clearance rate.
- an XTEN of a chosen length and sequence can be selectively incorporated into a GPXTEN to create a fusion protein that have, under physiologic conditions, an Apparent Molecular Weight of at least about 150 kDa, or at least about 300 kDa, or at least about 400 kDa, or at least about 500 kDA, or at least about 600 kDa, or at least about 700 kDA, or at least about 800 kDa, or at least about 900 kDa, or at least about 1000 kDa, or at least about 1200 kDa, or at least about 1500 kDa, or at least about 1800 kDa, or at least about 2000 kDa, or at least about 2300 kDa or more.
- an XTEN of a chosen length and sequence can be selectively linked to a GP to result in a GPXTEN fusion protein that has, under physiologic conditions, an Apparent Molecular Weight Factor of at least three, alternatively of at least four, alternatively of at least five, alternatively of at least six, alternatively of at least eight, alternatively of at least 10, alternatively of at least 15, or an Apparent Molecular Weight Factor of at least 20 or greater.
- the GPXTEN fusion protein has, under physiologic conditions, an Apparent Molecular Weight Factor that is about 4 to about 20, or is about 6 to about 15, or is about 8 to about 12, or is about 9 to about 10 relative to the actual molecular weight of the fusion protein.
- the GP of the subject compositions are not limited to native, full-length polypeptides, but also include recombinant versions as well as biologically and/or pharmacologically active variants or fragments thereof.
- various amino acid deletions, insertions and substitutions can be made in the GP to create variants without departing from the spirit of the invention with respect to the biological activity or pharmacologic properties of the GP. Examples of conservative substitutions for amino acids in polypeptide sequences are shown in Table 6.
- the invention contemplates substitution of any of the other 19 natural L-amino acids for a given amino acid residue of the given GP, which may be at any position within the sequence of the GP, including adjacent amino acid residues. If any one substitution results in an undesirable change in biological activity, then one of the alternative amino acids can be employed and the construct evaluated by the methods described herein, or using any of the techniques and guidelines for conservative and non-conservative mutations set forth, for instance, in U.S. Pat. No. 5,364,934, the contents of which is incorporated by reference in its entirety, or using methods generally known in the art.
- variants can include, for instance, polypeptides wherein one or more amino acid residues are added or deleted at the N- or C-terminus of the full-length native amino acid sequence of a GP that retains some if not all of the biological activity of the native peptide.
- the invention provides GPXTEN fusion protein compositions with the GP and XTEN components linked in specific N- to C-terminus configurations.
- one or more GPs are linked to one or more XTENs, either at the N-terminus or at the C-terminus, with or without a spacer, to form a block copolymer, and the sequential arrangement of the GPs and the XTENs in the GPXTEN fusion protein are the same as the configuration known in the block copolymer chemistry.
- each of the GP, the XTEN, or the spacer When there is more than one GP, XTEN, or spacer, each of the GP, the XTEN, or the spacer have the same or different sequences, and the GPs and/or XTENs are linked either continous or alternately (regular or irregular).
- the GPXTEN when there is more than one GP, XTEN, or spacer, each of the GP, XTEN, and spacer are the same or different.
- the GPXTEN is a monomeric fusion protein with a GP linked to one XTEN polypeptide. In other cases, the GPXTEN is a monomeric fusion protein with a GP linked to two or more XTEN polypeptides.
- the GPXTEN is a monomeric fusion protein with two or more GP linked to one XTEN polypeptide. In still other embodiments, the GPXTEN is a monomeric fusion protein with two or more GP linked to two or more XTEN polypeptide. Table 7 provides non- limiting examples of configurations that are encompassed by the GPXTEN fusion proteins of the invention; numerous other variations will be apparent to the ordinarily skilled artisan, including the incorporation the spacer and cleavage sequences disclosed herein or known in the art.
- the invention contemplates GPXTEN fusion proteins compositions comprising, but not limited to GP selected from the sequences of Tables 1 -3 (or fragments or sequence variants thereof), XTEN selected from Table 5 (or sequence variants thereof) that are in a configuration shown in Table 7.
- the resulting GPXTEN will retains at least a portion of the biological activity of the corresponding GP not linked to the XTEN.
- the GP component either becomes biologically active or has an increase in activity upon its release from the XTEN by cleavage of an optional cleavage sequence incorporated within spacer sequences into the GPXTEN, described more fully below.
- the invention provides a fusion protein of formula I:
- XTEN x -GP-(XTEN) 5 , I wherein independently for each occurrence, GP is a is a glucose regulating peptide; x is either 0 or 1 and y is either 0 or 1 wherein x+y >1; and XTEN is an extended recombinant polypeptide.
- the invention provides a fusion protein of formula II:
- XTEN x -(GP)-(S) y -(XTEN) II wherein independently for each occurrence, GP is a is a glucose regulating peptide a; S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a cleavage sequence; x is either 0 or 1 and y is either 0 or 1 wherein x+y >1; and XTEN is an extended recombinant polypeptide.
- the invention provides an isolated fusion protein, wherein the fusion protein is of formula III:
- GP is a is a glucose regulating peptide
- S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a cleavage sequence
- x is either 0 or 1
- y is either 0 or 1
- z is either 0 or 1
- XTEN is an extended recombinant polypeptide.
- the invention provides an isolated fusion protein, wherein the fusion protein is of formula IV:
- GP is a is a glucose regulating peptide
- S is a spacer sequence having between 1 to about 50 amino acid residues that can optionally include a cleavage sequence
- x is either 0 or 1
- y is either 0 or 1
- z is either 0 or 1
- XTEN is an extended recombinant polypeptide.
- the invention provides an isolated fusion protein, wherein the fusion protein is of formula VIII:
- administration of a therapeutically effective dose of a fusion protein of an embodiment of formulas I-VIII to a subject in need thereof can result in a gain in time of at least two-fold, or at least three-fold, or at least four-fold, or at least five-fold or more spent within a therapeutic window for the fusion protein compared to the corresponding GP not linked to the XTEN of and administered at a comparable dose to a subject.
- administration of a therapeutically effective dose of a fusion protein of an embodiment of formulas I-VIII to a subject in need thereof can result in a gain in time between consecutive doses necessary to maintain a therapeutically effective dose regimen of at least 48 h, or at least 72 h, or at least about 96 h, or at least about 120 h, or at least about 7 days, or at least about 14 days, or at least about 21 days between consecutive doses compared to a GP not linked to XTEN and administered at a comparable dose.
- any spacer sequence group is optional in the fusion proteins encompassed by the invention.
- the spacer may be provided to enhance expression of the fusion protein from a host cell or to decrease steric hindrance such that the GP component may assume its desired tertiary structure and/or interact appropriately with its target receptor.
- the spacer comprises one or more peptide sequences that are between 1-50 amino acid residues in length, or about 1-25 residues, or about 1-10 residues in length.
- Spacer sequences can comprise any of the 20 natural L amino acids, and will preferably comprise hydrophilic amino acids that are sterically unhindered that can include, but not be limited to, glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P).
- the spacer can be polyglycines or polyalanines, or is predominately a mixture of combinations of glycine and alanine residues.
- the spacer polypeptide exclusive of a cleavage sequence is largely to substantially devoid of secondary structure; e.g., less than about 10%, or less than about 5% as determined by the Chou-Fasman and/or GOR algorithms.
- one or both spacer sequences in a GPXTEN fusion protein composition may each further contain a cleavage sequence, which may be identical or may be different, wherein the cleavage sequence may be acted on by a protease to release the GP from the fusion protein.
- the incorporation of the cleavage sequence into the GPXTEN is designed to permit release of a GP that becomes active or more active upon its release from the XTEN.
- the cleavage sequences are located sufficiently close to the GP sequences, generally within 18, or within 12, or within 6, or within 2 amino acids of the GP sequence terminus, such that any remaining residues attached to the GP after cleavage do not appreciably interfere with the activity (e.g., such as binding to a receptor) of the GP, yet provide sufficient access to the protease to be able to effect cleavage of the cleavage sequence.
- the cleavage site is a sequence that can be cleaved by a protease endogenous to the mammalian subject such that the GPXTEN can be cleaved after administration to a subject.
- the GPXTEN can serve as a prodrug or a circulating depot for the GP.
- cleavage sites contemplated by the invention include, but are not limited to, a polypeptide sequence cleavable by a mammalian endogenous protease selected from FXIa, FXIIa, kallikrein, FVIIa, FIXa, FXa, FIIa (thrombin), Elastase-2, granzyme B, MMP- 12, MMP- 13, MMP- 17 or MMP-20, or by non-mammalian proteases such as TEV, enterokinase, PreScissionTM protease (rhinovirus 3C protease), and sortase A.
- a mammalian endogenous protease selected from FXIa, FXIIa, kallikrein, FVIIa, FIXa, FXa, FIIa (thrombin), Elastase-2, granzyme B, MMP- 12, MMP- 13, MMP- 17 or MMP-20,
- thrombin activate clotting factor II
- LTPRSLLV sequence LTPRSLLV
- active FIIa is produced by cleavage of FII by FXa in the presence of phospholipids and calcium and is down stream from factor IX in the coagulation pathway.
- FIIa activity is tightly controlled and only occurs when coagulation is necessary for proper hemostasis.
- the XTEN domain would be removed from the adjoining GP concurrent with activation of either the extrinsic or intrinsic coagulation pathways when coagulation is required physiologically, thereby releasing GP over time.
- incorporation of other sequences into GPXTEN that are acted upon by endogenous proteases would provide for sustained release of GP that may, in certain cases, provide a higher degree of activity for the GP from the "prodrug" form of the GPXTEN.
- the known cleavage sequence can have one or more deletions or insertions or one or two or three amino acid substitutions for any one or two or three amino acids in the known sequence, wherein the deletions, insertions or substitutions result in reduced or enhanced susceptibility but not an absence of susceptibility to the protease, resulting in an ability to tailor the rate of release of the GP from the XTEN. Exemplary substitutions are shown in Table
- a GP incorporated into a GPXTEN fusion protein can have a sequence that exhibits at least about 80% sequence identity to a sequence from Tables 1-3, alternatively at least about 81%, or about 82%, or about 83%, or about 84%, or about 85%, or about 86%, or about 87%, or about 88%, or about 89%, or about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99%, or about 100% sequence identity as compared with a sequence from Tables 1-3.
- the GP of the foregoing embodiment can be evaluated for activity using assays or measured or determined parameters as described herein, and those sequences that retain at least about 40%, or about 50%, or about 55%, or about 60%, or about 70%, or about 80%, or about 90%, or about 95% or more activity compared to the corresponding native GP sequence would be considered suitable for inclusion in the subject GPXTEN.
- the GP found to retain a suitable level of activity can be linked to one or more XTEN polypeptides described hereinabove.
- a GP found to retain a suitable level of activity can be linked to one or more XTEN polypeptides having at least about 80% sequence identity to a sequence from Table 5, alternatively at least about 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or about 100% sequence identity as compared with a sequence of Table 5, resulting in a chimeric fusion protein.
- Non- limiting examples of sequences of GPXTEN fusion proteins containing a single GP linked to a single XTEN are presented in Table 36, and sequences of GPXTEN fusion proteins containing a single GP linked to two XTEN are presented in Table 37.
- a GPXTEN composition would comprise a fusion protein having at least about 80% sequence identity to a GPXTEN from Tables 36-37, alternatively at least about 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or about 100% sequence identity as compared with a GPXTEN from Tables 36- 37.
- the invention also contemplates substitution of other GP with sequences exhibiting at least about 90% sequence identity to a sequence selected from Tables 1 -3 linked to one or two XTEN, which may be the same or different, exhibiting at least about 90% sequence identity selected from Table 5.
- the GPXTEN fusion protein can further comprise a cleavage sequence from Table 8; the cleavage sequence being located between the GP and the XTEN or between adjacent GP (if more than one GP is included in the GPXTEN).
- the GPXTEN comprising the cleavage sequences will also have one or more spacer sequence amino acids between the GP and the cleavage sequence or the XTEN and the cleavage sequence to facilitate access of the protease; the spacer amino acids comprising any natural amino acid, including glycine and alanine as preferred amino acids.
- Non- limiting examples of GPXTEN comprising GP, XTEN, cleavage sequence(s) and spacer amino acids are presented in Table 38.
- the invention also contemplates substitution of any of the GP sequences of Tables 1-3 for a GP sequence of Tables 36-38, substitution of any XTEN sequence of Table 5 for an XTEN sequence of Tables 36-38, and substitution of any cleavage sequence of Table 8 for a cleavage sequence of Table 38.
- the invention provides GPXTEN fusion proteins with enhanced pharmacokinetics compared to the GP not linked to XTEN that, when used at the dose determined for the composition by the methods described herein, can achieve a circulating concentration resulting in a pharmacologic effect, yet stay within the safety range for biologically active component of the composition for an extended period of time compared to a comparable dose of the GP not linked to XTEN. In such cases, the GPXTEN remains within the therapeutic window for the fusion protein composition for the extended period of time.
- a "comparable dose” means a dose with an equivalent moles/kg for the active GP pharmacophore that is administered to a subject in a comparable fashion.
- a "comparable dosage" of GPXTEN fusion protein would represent a greater weight of agent but would have essentially the same mole- equivalents of GP in the dose of the fusion protein and/or would have the same approximate molar concentration relative to the GP.
- the pharmacokinetic properties of a GP that can be enhanced by linking a given XTEN to the GP include terminal half- life, area under the curve (AUC), C m3x volume of distribution, and bioavailability providing enhanced utility in the treatment of glucose regulating peptide-related disorders, diseases and related conditions.
- the GP of the GPXTEN compositions exhibiting enhanced PK properties can be a sequence that exhibits at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a protein sequence selected from Tables 1-3, linked to one or more XTEN that exhibit at least about 80% sequence identity, or alternatively 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to a protein sequence selected from Table 5, and can be in a configuration selected from the configurations of Table 7.
- the invention provides GPXTEN fusion proteins comprising XTEN wherein the XTEN can be selected to provide a targeted half- life for the GPXTEN composition administered to a subject.
- the invention provides monomeric fusion proteins comprising XTEN wherein the XTEN is selected to confer an increase in the terminal half-life for the GPXTEN administered to a subject, compared to the corresponding GP not linked to the fusion protein and administered at a comparable dose, of at least about two-fold longer, or at least about three-fold, or at least about four-fold, or at least about five-fold, or at least about six-fold, or at least about seven-fold, or at least about eight-fold, or at least about nine-fold, or at least about ten- fold, or at least about 15-fold, or at least a 20-fold, or at least a 40-fold, or at least a 80-fold, or at least a 100-fold or greater an increase in terminal half- life compared to the GP not linked to the fusion protein.
- Exogenously administered exendin-4 has been reported to have a terminal half- life in humans of 2.4 h and glucagon has a half- life of less than 20 minutes, whereas various GPXTEN compositions disclosed herein that have been experimentally administered to various animals species, as described in the Examples, have resulted in terminal half- life values of several hours.
- the GPXTEN fusion proteins can have an increase in AUC of at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90%, or at least about a 100%, or at least about 150%, or at least about 200%, or at least about 300%, or at least about 500%, or at least about 1000%, or at least about a 2000% increase in AUC compared to the corresponding GP not linked to the fusion protein and administered to a subject at a comparable dose.
- the pharmacokinetic parameters of a GPXTEN can be determined by standard methods involving dosing, the taking of blood samples at times intervals, and the assaying of the protein using ELISA, HPLC, radioassay, or other methods known in the art or as described herein, followed by standard calculations of the data to derive the half- life and other PK parameters.
- the invention further provides GPXTEN comprising a first and a second GP molecule, optionally separated by a spacer sequence that may further comprise a cleavage sequence, or separated by a second XTEN sequence.
- the GP has less activity when linked to the fusion protein compared to a corresponding GP not linked to the fusion protein.
- the GPXTEN can be designed such that upon administration to a subject, the GP component is gradually released by cleavage of the cleavage sequence(s), whereupon it regains activity or the ability to bind to its target receptor or ligand.
- the GPXTEN of the foregoing serves as a prodrug or a circulating depot, resulting in a longer terminal half-life compared to GP not linked to the fusion protein.
- the present invention provides GPXTEN compositions comprising GP covalently linked to XTEN that can have enhanced properties compared to GP not linked to XTEN, as well as methods to enhance the therapeutic and/or biologic activity or effect of the respective two GP components of the compositions.
- the invention provides GPXTEN compositions with enhanced properties compared to those art- known fusion proteins containing immunoglobulin polypeptide partners, polypeptides of shorter length and/or polypeptide partners with repetitive sequences.
- GPXTEN fusion proteins provide significant advantages over chemical conjugates, such as pegylated constructs, notably the fact that recombinant GPXTEN fusion proteins can be made in bacterial cell expression systems, which can reduce time and cost at both the research and development and manufacturing stages of a product, as well as result in a more homogeneous, defined product with less toxicity for both the product and metabolites of the GPXTEN compared to pegylated conjugates.
- the GPXTEN may possess a number of advantages over therapeutics not comprising XTEN including one or more of the following non- limiting exemplary enhance properties; increased solubility, increased thermal stability, reduced immunogenicity, increased apparent molecular weight, reduced renal clearance, reduced proteolysis, reduced metabolism, enhanced therapeutic efficiency, a lower effective therapeutic dose, increased bioavailability, increased time between dosages capable of maintain blood levels within the therapeutic window for the GP, a "tailored" rate of absorption, enhanced lyophilization stability, enhanced serum/plasma stability, increased terminal half-life, increased solubility in blood stream, decreased binding by neutralizing antibodies, decreased receptor-mediated clearance, reduced side effects, retention of receptor/ligand binding affinity or receptor/ligand activation, stability to degradation, stability to freeze-thaw, stability to proteases, stability to ubiquitination, ease of administration, compatibility with other pharmaceutical excipients or carriers, persistence in the subject, increased stability in storage (e.g., increased shelf-life), reduced toxicity in an organism
- the length and/or the motif family composition of the first and the second XTEN sequences of the first and the second fusion protein may each be selected to confer a different degree of solubility and/or stability on the respective fusion proteins such that the overall pharmaceutical properties of the GPXTEN composition are enhanced.
- the GPXTEN fusion proteins can be constructed and assayed, using methods described herein, to confirm the physicochemical properties and the XTEN adjusted, as needed, to result in the desired properties.
- the XTEN sequence of the GPXTEN is selected such that the fusion protein has an aqueous solubility that is within at least about 25% greater compared to a GP not linked to the fusion protein, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 75%, or at least about 100%, or at least about 200%, or at least about 300%, or at least about 400%, or at least about 500%, or at least about 1000% greater than the corresponding GP not linked to the fusion protein.
- the XTEN of the fusion proteins can have at least about 80% sequence identity, or about 90%, or about 91%, or about 92%, or about 93%, or about 94%, or about 95%, or about 96%, or about 97%, or about 98%, or about 99%, to about 100% sequence identity to an XTEN selected from Table 5.
- the invention provides GPXTEN compositions that can maintain the GP component within a therapeutic window for a greater period of time compared to comparable dosages of the corresponding GP not linked to XTEN.
- a "comparable dosage" of GPXTEN fusion protein would represent a greater weight of agent but would have the same approximate mole-equivalents of GP in the dose of the fusion protein and/or would have the same approximate molar concentration relative to the GP.
- the invention also provides methods to select the XTEN appropriate for conjugation to provide the desired pharmacokinetic properties that, when matched with the selection of dose, enables increased efficacy of the administered composition by maintaining the circulating concentrations of the GP within the therapeutic window for an enhanced period of time.
- therapeutic window means that the amount of drug or biologic as a blood or plasma concentration range, which provides efficacy or a desired pharmacologic effect over time for the disease or condition without unacceptable toxicity; the range of the circulating blood concentrations between the minimal amount to achieve any positive therapeutic effect and the maximum amount which results in a response that is the response immediately before toxicity to the subject (at a higher dose or concentration).
- therapeutic window generally encompasses an aspect of time; the maximum and minimum concentration that results in a desired pharmacologic effect over time that does not result in unacceptable toxicity or adverse events.
- a dosed composition that stays within the therapeutic window for the subject could also be said to be within the "safety range.”
- the characteristics of GPXTEN compositions of the invention may be determined by any suitable screening assay known in the art for measuring the desired characteristic.
- the invention provides methods to assay the GPXTEN fusion proteins of differing composition or configuration in order to provide GPXTEN with the desired degree of biologic and/or therapeutic activity, as well as safety profile.
- Specific in vivo and ex vivo biological assays may be used to assess the activity of each configured GPXTEN and/or GP component to be incorporated into GPXTEN, including but not limited to the assays of the Examples, those assays of Table 35, as well as the following assays or other such assays known in the art for assaying the properties and effects of GP.
- Assays can be conducted that allow determination of binding characteristics of the GPXTEN for GP receptors or a ligand, including binding constant (Kd), EC 5 O values, as well as their half- life of dissociation of the ligand-receptor complex (Ty 2 ).
- Binding affinity can be measured, for example, by a competition-type binding assay that detects changes in the ability to specifically bind to a receptor (see, e.g., Examples). Additionally, techniques such as flow cytometry or surface plasmon resonance can be used to detect binding events.
- the assays may comprise soluble receptor molecules, or may determine the binding to cell-expressed receptors. Such assays may include cell-based assays, including assays for calcium flux, signal transduction, and cell proliferation. Other possible assays may determine receptor binding of expressed polypeptides, wherein the assay may comprise soluble receptor molecules, or may determine the binding to cell-expressed receptors.
- the binding affinity of a GPXTEN for the target receptors of the corresponding GP can be assayed using binding or competitive binding assays, such as Biacore assays with chip-bound receptors or binding proteins or ELISA assays, as described in US Patent 5,534,617, assays described in the Examples herein, radio-receptor assays, or other assays known in the art.
- binding or competitive binding assays such as Biacore assays with chip-bound receptors or binding proteins or ELISA assays, as described in US Patent 5,534,617, assays described in the Examples herein, radio-receptor assays, or other assays known in the art.
- GP sequence variants (assayed as single components or as GPXTEN fusion proteins) can be compared to the native GP using a competitive ELISA binding assay to determine whether they have the same binding specificity and affinity as the native GP, or some fraction thereof such that they are suitable for inclusion in GPXTEN
- Functional assays can include insulin concentrations and/or generation within target cells as a result of exposure to GPXTEN, and/or the resulting stimulatory effects of beta cells, glucose uptake and/or homeostasis, HbAIc concentrations, insulin concentrations, stimulated C peptide, fasting plasma glucose (FPG), serum cytokine levels, CRP levels, insulin secretion and Insulin-sensitivity index derived from an oral glucose tolerance test (OGTT), as well as body weight, food consumption, and other accepted diabetic markers known in the art would be suitable parameters to assess the activity of GP for inclusion in the GPXTEN fusion protein or the resulting GPXTEN.
- Dose optimization is important for all drugs, especially for those with a narrow therapeutic window.
- a standardized single dose of GP for all patients presenting with a diverse symptoms or abnormal clinical parameters may not always be effective.
- a consideration of these factors is well within the purview of the ordinarily skilled clinician for the purpose of determining the therapeutically or pharmacologically effective amount of the GPXTEN, versus that amount that would result in unacceptable toxicity and place it outside of the safety range, or insufficient potency such that clinical improvement is not achieved.
- the therapeutic window for GP in subjects of different ages or degree of disease have been established and are available in published literature or are stated on the drug label for approved products containing the GP. In other cases, the therapeutic window can be established.
- the methods for establishing the therapeutic window for a given composition are known to those of skill in the art (see, e.g., Goodman & Gilman's The Pharmacological Basis of Therapeutics, 11 th Edition, McGraw-Hill (2005)).
- the therapeutic window for a given subject or population of subjects can be determined for a given drug or biologic, or combinations of biologies or drugs.
- the dose escalation studies can evaluate the activity of a GPXTEN through metabolic studies in a subject or group of subjects that monitor physiological or biochemical parameters, as known in the art or as described herein for one or more parameters associated with the metabolic disease or disorder, or clinical parameters associated with a beneficial outcome for the particular indication, together with observations and/or measured parameters to determine the no effect dose, adverse events, maximum tolerated dose and the like, together with measurement of pharmacokinetic parameters that establish the determined or derived circulating blood levels.
- the results can then be correlated with the dose administered and the blood concentrations of the therapeutic that are coincident with the foregoing determined parameters or effect levels.
- a range of doses and blood concentrations can be correlated to the minimum effective dose as well as the maximum dose and blood concentration at which a desired effect occurs and above which toxicity occurs, thereby establishing the therapeutic window for the dosed therapeutic.
- Blood concentrations of the fusion protein (or as measured by the GP component) above the maximum would be considered outside the therapeutic window or safety range.
- a C mm blood level would be established, below which the GPXTEN fusion protein would not have the desired pharmacologic effect, and a C n13x blood level would be established that would represent the highest circulating concentration before reaching a concentration that would elicit unacceptable side effects, toxicity or adverse events, placing it outside the safety range for the GPXTEN.
- the frequency of dosing and the dosage can be further refined by measurement of the C n13x and C mn to provide the appropriate dose and dose frequency to keep the fusion protein(s) within the therapeutic window.
- One of skill in the art can, by the means disclosed herein or by other methods known in the art, confirm that the administered GPXTEN remains in the therapeutic window for the desired interval or requires adjustment in dose or length or sequence of XTEN.
- the determination of the appropriate dose and dose frequency to keep the GPXTEN within the therapeutic window establishes the therapeutically effective dose regimen; the schedule for administration of multiple consecutive doses using a therapeutically effective dose of the fusion protein to a subject in need thereof resulting in consecutive C n13x peaks and/or C n11n troughs that remain within the therapeutic window and results in an improvement in at least one measured parameter relevant for the target disease, disorder or condition.
- the GPXTEN administered at an appropriate dose to a subject may result in blood concentrations of the GPXTEN fusion protein that remains within the therapeutic window for a period at least about two-fold longer compared to the corresponding GP not linked to XTEN and administered at a comparable dose; alternatively at least about three-fold longer; alternatively at least about four- fold longer; alternatively at least about five-fold longer; alternatively at least about six-fold longer; alternatively at least about seven-fold longer; alternatively at least about eight-fold longer; alternatively at least about nine-fold longer or at least about ten- fold longer or greater compared to the corresponding GP not linked to XTEN and administered at a comparable dose.
- an "appropriate dose” means a dose of a drug or biologic that, when administered to a subject, would result in a desirable therapeutic or pharmacologic effect and a blood concentration within the therapeutic window.
- the GPXTEN administered at a therapeutically effective dose regimen results in a gain in time of at least about three-fold longer; alternatively at least about four- fold longer; alternatively at least about five-fold longer; alternatively at least about six-fold longer; alternatively at least about seven-fold longer; alternatively at least about eight- fold longer; alternatively at least about nine-fold longer or at least about ten- fold longer between at least two consecutive C n13x peaks and/or C mm troughs for blood levels of the fusion protein compared to the corresponding biologically active protein of the fusion protein not linked to the fusion protein and administered at a comparable dose regimen to a subject.
- the GPXTEN administered at a therapeutically effective dose regimen results in a comparable improvement in one, or two, or three or more measured parameter using less frequent dosing or a lower total dosage in moles of the fusion protein of the pharmaceutical composition compared to the corresponding biologically active protein component(s) not linked to the fusion protein and administered to a subject using a therapeutically effective dose regimen for the GP.
- the measured parameters may include any of the clinical, biochemical, or physiological parameters disclosed herein, or others known in the art for assessing subjects with glucose- or insulin-related disorders.
- the activity of the GPXTEN compositions of the invention may be determined by any suitable screening assay known in the art for measuring the desired characteristic.
- the activity and structure of the GPXTEN polypeptides comprising GP components may be assessed by measuring parameters described herein, by use of one or more assays selected from Table 35, assays of the Examples, or by methods known in the art to ascertain the degree of solubility, structure and retention of biologic activity.
- Assays can be conducted that allow determination of binding characteristics of the GPXTEN for GP receptors or a ligand, including binding constant (K d ), EC 50 values, as well as their half-life of dissociation of the ligand-receptor complex (T 1/2 ). Binding affinity can be measured, for example, by a competition-type binding assay that detects changes in the ability to specifically bind to a receptor or ligand (see, e.g., Examples). Additionally, techniques such as flow cytometry or surface plasmon resonance can be used to detect binding events.
- the assays may comprise soluble receptor molecules, or may determine the binding to cell-expressed receptors.
- Such assays may include cell-based assays, including assays for proliferation, cell death, apoptosis and cell migration. Other possible assays may determine receptor binding of expressed polypeptides, wherein the assay may comprise soluble receptor molecules, or may determine the binding to cell-expressed receptors.
- the binding affinity of a GPXTEN for the target receptors or ligands of the corresponding GP can be assayed using binding or competitive binding assays, such as Biacore assays with chip-bound receptors or binding proteins or ELISA assays, as described in US Patent 5,534,617, assays described in the Examples herein, radio-receptor assays, or other assays known in the art.
- GP sequence variants (assayed as single components or as GPXTEN fusion proteins) can be compared to the native GP using a competitive ELISA binding assay to determine whether they have the same binding specificity and affinity as the native GP, or some fraction thereof such that they are suitable for inclusion in GPXTEN.
- the invention provides isolated GPXTEN in which the binding affinity for GP target receptors or ligands by the GPXTEN can be at least about 10%, or at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90%, or at least about 95%, or at least about 99%, or at least about 100% or more of the affinity of a native GP not bound to XTEN for the target receptor or ligand.
- the binding affinity K d between the subject GPXTEN and a native receptor or ligand of the GPXTEN is at least about 10 "4 M, alternatively at least about 10 5 M, alternatively at least about 10 6 M, or at least about 10 7 M, or at least about 10 8 M, or at least about 10 9 M of the affinity between the GPXTEN and a native receptor or ligand.
- the invention provides isolated GPXTEN fusion proteins specifically designed to have reduced binding affinity to the GP receptor. In one em, such as fusion proteins comprising an XTEN fused to the C-terimnus of the GP component.
- the GPXTEN can be configured to have reduced binding affinity wherein the binding affinity is assessed by an in vitro cell receptor binding assay wherein the binding is reduced by about 10%, or about 20%, or about 40%, or about 60%, or about 80%, or about 90% compared to native GP.
- the GPXTEN can be configured to have reduced binding affinity wherein the binding affinity is assessed by signal transduction wherein the GPXTEN fusion protein elicits less than about 80%, or less than about 60%, or less than about 40%, or less than about 20%, or less than 10%, or less than about 5% activation of the signaling pathways of the cell with bound GPXTEN in comparison to those evoked by the native GP ligand.
- the binding affinity is "substantially reduced.”
- Non- limiting examples of specific constructs of such GPXTEN with reduced binding affinity include fusion proteins with at least about 80% sequence identity, or at least about 85% sequence identity, or at least about 90% sequence identity, or at least about 95% sequence identity, or at least about 97% sequence identity, or at least about 99% sequence identity to GP fusion proteins selected from AE912-GP-AE144, AE912-GP-AF144, AE912-GP-AE288, AM923-GP-AE144, AM923 -GP-AF 144, AM923-GP-AE288.
- the GPXTEN fusion proteins of the invention retain at least about 10%, or about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, or 99% percent of the biological activity of the corresponding GP not linked to the fusion protein with regard to an in vitro biologic activity or an in vivo pharmacologic effect known or associated with the use of the native GP in the treatment and prevention of metabolic conditions and disorders.
- Non-limiting examples of activities or pharmacologic effects that can be assayed to assess the retained activity of the GPXTEN fusion proteins include including assays for calcium flux and/or signal transduction in response to receptor binding, insulin concentrations and/or generation within target cells as a result of exposure to GPXTEN, and/or the resulting stimulatory effects of beta cells, glucose uptake and/or homeostasis, HbAIc concentrations, insulin concentrations, stimulated C peptide, fasting plasma glucose (FPG), serum cytokine levels, CRP levels, insulin secretion and Insulin-sensitivity index derived from an oral glucose tolerance test (OGTT), as well as body weight, food consumption, and other accepted diabetic markers known in the art would be suitable parameters to assess the activity of GP for inclusion in the GPXTEN fusion protein or the resulting GPXTEN.
- assays for calcium flux and/or signal transduction in response to receptor binding, insulin concentrations and/or generation within target cells as a result of exposure to GPXTEN and/or the
- the activity of the GP component may be manifest by the intact GPXTEN fusion protein, while in other cases the activity of the GP component would be primarily manifested upon cleavage and release of the GP from the fusion protein by action of a protease that acts on a cleavage sequence incorporated into the GPXTEN fusion protein.
- the GPXTEN can be designed to reduce the binding affinity of the GP component for the receptor or ligand when linked to the XTEN but have increased affinity when released from XTEN through the cleavage of cleavage sequence(s) incorporated into the GPXTEN sequence, as described more fully above.
- the GPXTEN can be designed to reduce the binding affinity of the GP component to the GP receptor to increase the terminal half- life of GPXTEN administered to a subject by reducing receptor- mediated clearance; e.g., by adding an XTEN to the C-terminus of the GP component of the fusion protein.
- the GPXTEN are designed to reduce the binding affinity of the GP component to the GP receptor to reduce toxicity or side effects due to the administered composition.
- the invention provides a method for increasing the terminal half-life of a GPXTEN by producing a single-chain fusion protein construct with a specific N- to C-terminus configuration of the components comprising at least a first GP and a first and a second XTEN, wherein the fusion protein in a first N- to C-terminus configuration of the GP and XTEN components has reduced receptor-mediated clearance (RMC) and a corresponding increase in terminal half-life compared to a GPXTEN in a second N- to C-terminus configuration.
- RMC receptor-mediated clearance
- the GPXTEN is configured, N- to C- terminus as XTEN-GP-XTEN, which has reduced receptor binding compared to a GPXTEN configures, N- to C-terminus XTEN-GP.
- the GPXTEN is configured GP-XTEN.
- the two XTEN molecules can be identical or they can be of a different sequence composition or length.
- Non- limiting examples of the foregoing embodiment with two XTEN linked to a single GP include the constructs AE912-GP-AE144, AE912-GP-AE288, AE864-GP-AE144, AM923 -GP-AE 144, and AM923-GP-AE288.
- the invention contemplates other such constructs in which a GP from Tables 1-3 and XTEN from Table 5 are substituted for the respective components of the foregoing examples, and can be produced, for example, in a configuration from Table 7 such that the construct has reduced receptor mediated clearance compared to an alternate configuration of the respective components.
- the foregoing method for increasing the terminal half-life provides configured GPXTEN that can result in an increase in the terminal half- life of at least about 50%, or about 75%, or about 100%, or about 150%, or about 200%, or about 300%, or about 400% or more compared to the half-life of a GPXTEN in a second configuration where receptor binding is not reduced.
- the invention takes advantage of the fact that certain ligands wherein reduced binding affinity to a receptor, either as a result of a decreased on-rate or an increased off-rate, may be effected by the obstruction of either the N- or C-terminus, and using that terminus as the linkage to another polypeptide of the composition, whether another molecule of a GP, an XTEN, or a spacer sequence results in the reduced binding affinity.
- the choice of the particular configuration of the GPXTEN fusion protein can reduce the degree of binding affinity to the receptor such that a reduced rate of receptor-mediated clearance can be achieved.
- activation of the receptor is coupled EG RMC such Ward binding of a polypeptide to Ib recept ⁇ r without activation dues nut icad to RMC.
- the ligand may nevertheless be able to bind sufficiently to initiate cell signaling without triggering receptor mediated clearance, with the net result that the GPXTEN remains bioavailable.
- the configured GPXTEN has an increased half-life compared to those configurations that lead to a higher degree of RMC.
- the invention provides a GPXTEN configured such that the binding affinity of the GPXTEN for a target receptor is in the range of about 0.01%-40%, or about 0.1%-30%, or about l%-20% of the binding affinity compared to a corresponding GPXTEN in a configuration wherein the binding affinity is not reduced.
- the binding affinity of the configured BXTEN is thus preferably reduced by at least about 60%, or at least about 70%, or at least about 80%, or at least about 90%, or at least about 95%, or at least about 99%, or at least about 99.99% as compared to the binding affinity of a corresponding GPXTEN in a configuration wherein the binding affinity of the GP component to the target receptor is not reduced or compared to the GP not linked to the fusion protein, determined under comparable conditions.
- the GP component of the configured GPXTEN may have a binding affinity that is as small as about 0.01%, or at least about 0.1%, or at least about 1%, or at least about 2%, or at least about 3%, or at least about 4%, or at least about 5%, or at least about 10%, or at least about 20%, or at least about 30%, or at least 40% of that of the corresponding GP component of a GPXTEN in a configuration wherein the binding affinity of the GP component is not reduced.
- the binding affinity of the configured GPXTEN for the target receptor would be "substantially reduced” compared to a corresponding native GP or a GPXTEN with a configuration in which the binding affinity of the corresponding GP component is not reduced. Accordingly, the present invention provides compositions and methods to produce compositions with reduced RMC by configuring the GPXTEN, examples of which were provided above, so as to be able to bind and activate a sufficient number of receptors to obtain a desired in vivo biological response yet avoid activation of more receptors than is required for obtaining such response.
- the increased half-life can permit higher dosages and reduced frequency of dosing compared to GP not linked to XTEN or compared to GPXTEN configurations wherein the GP component retains sufficient biological or pharmacological activity to result in a composition with clinical efficacy maintained despite reduced dosing frequency.
- Vl) USES OF THE COMPOSITIONS OF THE PRESENT INVENTION [00217]
- the invention provides a method for achieving a beneficial effect in a disease, disorder or condition mediated by GP.
- the present invention addresses disadvantages and/or limitations of GP that have a relatively short terminal half-life and/or a narrow therapeutic window between the minimum effective dose and the maximum tolerated dose.
- the invention provides a method for achieving a beneficial affect in a subject with a glucose regulating peptide -related disease, disorder or condition comprising the step of administering to the subject a therapeutically- or prophylactically-effective amount of a GPXTEN wherein said administration results in the improvement of one or more biochemical or physiological parameters or clinical endpoints associated with a glucose regulating peptide-related disease, disorder or condition.
- the effective amount can produce a beneficial effect in helping to treat (e.g., cure or reduce the severity) or prevent (e.g., reduce the likelihood of onset or severity) a glucose regulating peptide-related disease, disorder or condition.
- the method for achieving a beneficial effect can include administering a therapeutically effective amount of a GPXTEN fusion protein composition to treat a subject with a glucose regulating peptide-related disease, disorder, or condition, including, but not limited to, juvenile diabetes, type I diabetes, type II diabetes, obesity, acute hypoglycemia, acute hyperglycemia, nocturnal hypoglycemia, chronic hyperglycemia, glucagonomas, secretory disorders of the airway, arthritis, osteoporosis, central nervous system disease, restenosis, neurodegenerative disease, renal failure, congestive heart failure, nephrotic syndrome, cirrhosis, pulmonary edema, hypertension, and disorders wherein the reduction of food intake is desired, stroke, irritable bowel syndrome, myocardial infarction (e.g., reducing the morbidity and/or mortality associated therewith), stroke, acute coronary syndrome (e.g., characterized by an absence of Q- wave) myocardial infarction
- the invention provides a method of stimulating insulin secretion in subjects with a glucose regulating peptide -related disease, disorder or deficiency.
- the method comprises the step of administering therapeutically effective amount of GPXTEN to a subject that results in the increased blood levels and/or duration in increased blood levels of insulin compared to a subject receiving a GP not linked to an XTEN and administered at a comparable dose.
- the increase in insulin secretion and/or area under the curve is at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 75%, or at least about 100%, or at least about 200%, or at least about 300% compared to a subject receiving a GP not linked to an XTEN and administered at a comparable dose.
- the GP may be administered using longer intervals between doses compared to the corresponding GP not linked to XTEN to prevent, treat, alleviate, reverse or ameliorate symptoms or clinical abnormalities of the glucose regulating peptide-related disease, disorder or condition or prolong the survival of the subject being treated.
- the methods of the invention may include administration of consecutive doses of a therapeutically effective amount of the GPXTEN for a period of time sufficient to achieve and/or maintain the desired parameter or clinical effect, and such consecutive doses of a therapeutically effective amount establishes the therapeutically effective dose regimen for the GPXTEN; i.e., the schedule for consecutively administered doses of the fusion protein composition, wherein the doses are given in therapeutically effective amounts to result in a sustained beneficial effect on any clinical sign or symptom, aspect, measured parameter or characteristic of a metabolic disease state or condition, including, but not limited to, those described herein.
- the method comprises administering a therapeutically-effective amount of a pharmaceutical composition comprising a GPXTEN fusion protein composition comprising a GP linked to an XTEN sequence(s) and at least one pharmaceutically acceptable carrier to a subject in need thereof that results in greater improvement in at least one parameter, physiologic condition, or clinical outcome mediated by the GP component(s) (non- limiting examples of which are described above) compared to the effect mediated by administration of a pharmaceutical composition comprising a GP not linked to XTEN and administered at a comparable dose.
- the pharmaceutical composition is administered at a therapeutically effective dose.
- the pharmaceutical composition is administered using multiple consecutive doses using a therapeutically effective dose regimen (as defined herein) for the length of the dosing period.
- a therapeutically effective amount of the GPXTEN may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody or antibody portion to elicit a desired response in the individual.
- a therapeutically effective amount is also one in which any toxic or detrimental effects of the GPXTEN are outweighed by the therapeutically beneficial effects.
- a prophylactically effective amount refers to an amount of GPXTEN required for the period of time necessary to achieve the desired prophylactic result.
- longer acting GPXTEN compositions are preferred, so as to improve patient convenience, to increase the interval between doses and to reduce the amount of drug required to achieve a sustained effect.
- a method of treatment comprises administration of a therapeutically effective dose of a GPXTEN to a subject in need thereof that results in a gain in time spent within a therapeutic window established for the fusion protein of the composition compared to the corresponding GP component(s) not linked to the fusion protein and administered at a comparable dose to a subject.
- the gain in time spent within the therapeutic window is at least about three-fold, or at least about four-fold, or at least about five-fold, or at least about six-fold, or at least about eight-fold, or at least about 10-fold, or at least about 20-fold, or at least about 40-fold compared to the corresponding GP component not linked to the fusion protein and administered at a comparable dose to a subject.
- the methods further provide that administration of multiple consecutive doses of a GPXTEN administered using a therapeutically effective dose regimen to a subject in need thereof can result in a gain in time between consecutive C n13x peaks and/or C mn troughs for blood levels of the fusion protein compared to the corresponding GP not linked to the fusion protein and administered using a dose regimen established for that GP.
- the gain in time spent between consecutive C n13x peaks and/or C m1n troughs can be at least about three-fold, or at least about four- fold, or at least about five-fold, or at least about six-fold, or at least about eight- fold, or at least about 10-fold, or at least about 20-fold, or at least about 40- fold compared to the corresponding GP component not linked to the fusion protein and administered using a dose regimen established for that GP.
- the administration of the fusion protein can result in an improvement in at least one of the parameters (disclosed herein as being useful for assessing the subject diseases, conditions or disorders) using a lower unit dose in moles of fusion protein compared to the corresponding GP component not linked to the fusion protein and administered at a comparable unit dose or dose regimen to a subject.
- the method of treatment comprises administration of a GPXTEN using a therapeutically effective dose regimen to effect improvements in one or more parameters associated with glucose regulating peptide diseases, disorders or conditions.
- administration of the GPXTEN to a subject can result in an improvement in one or more of the biochemical, physiologic, or clinical parameters that is of greater magnitude than that of the corresponding GP component not linked to XTEN, determined using the same assay or based on a measured clinical parameter.
- administration of the GPXTEN to a subject can result in activity in one or more of the biochemical, physiologic, or clinical parameters that is of longer duration than the activity of one of the single GP components not linked to XTEN, determined using that same assay or based on a measured clinical parameter.
- the administration of the GPXTEN to a subject can result in an improvement in peak concentrations and area under the curve of blood GP levels of at least about 10%, or about 20%, or about 30%, or about 40%, or about 50% or more in the subject compared to a comparable dose of GP not linked to XTEN administered to a subject.
- the administration of the GPXTEN to a subject can result in an improvement in one or more parameters selected from, but not limited to HbAIc concentrations, insulin concentrations, stimulated C peptide, fasting plasma glucose (FPG), serum cytokine levels, CRP levels, insulin secretion and Insulin-sensitivity index derived from an oral glucose tolerance test (OGTT), body weight, and food consumption.
- GPXTEN used in accordance with the methods provided herein may be administered in conjunction with other treatment methods and pharmaceutical compositions useful for treating glucose regulating peptide -related diseases, disorders, and conditions, or conditions for which glucose regulating peptide is adjunctive therapy; e.g., insulin resistance and poor glycemic control.
- compositions may include for example, DPP-IV inhibitors, insulin, insulin analogues, PPAR gamma agonists, dual-acting PPAR agonists, GLP-I agonists or analogues, PTPlB inhibitors, SGLT inhibitors, insulin secretagogues, RXR agonists, glycogen synthase kinase-3 inhibitors, insulin sensitizers, immune modulators, beta-3 adrenergic receptor agonists, Pan-PPAR agonists, 1 lbeta-HSDl inhibitors, biguanides, alpha-glucosidase inhibitors, meglitinides, thiazolidinediones, sulfonylureas and other diabetes medicants known in the art, or anti-hypertensive drugs, calcium channel blockers, and related products.
- the administration of a GPXTEN may permit use of lower dosages of the co-administered pharmaceutical composition to achieve a comparable clinical effect or
- the invention provides a method of designing the GPXTEN compositions with desired pharmacologic or pharmaceutical properties.
- the GPXTEN fusion proteins are designed and prepared with various objectives in mind (compared to the GP components not linked to the fusion protein), including improving the therapeutic efficacy for the treatment of glucose regulating peptide-related diseases, disorders, and conditions, enhancing the pharmacokinetic characteristics of the fusion proteins compared to the GP, lowering the dose or frequency of dosing required to achieve a pharmacologic effect, enhancing the pharmaceutical properties, and to enhance the ability of the GP components to remain within the therapeutic window for an extended period of time.
- the steps in the design and production of the fusion proteins and the inventive compositions may, as illustrated in FIGS. 4-6, include: (1) the selection of GPs (e.g., native proteins, analogs or derivatives with activity) to treat the particular disease, disorder or condition; (2) selecting the XTEN that will confer the desired PK and physicochemical characteristics on the resulting GPXTEN (e.g., the administration of the composition to a subject results in the fusion protein being maintained within the therapeutic window for a greater period compared to GP not linked to XTEN); (3) establishing a desired N- to C-terminus configuration of the GPXTEN to achieve the desired efficacy or PK parameters; (4) establishing the design of the expression vector encoding the configured GPXTEN; (5) transforming a suitable host with the expression vector; and (6) expression and recovery of the resultant fusion protein.
- GPs e.g., native proteins, analogs or derivatives with activity
- the XTEN chosen for incorporation will generally have at least about 500, or about 576, or about 864, or about 875, or about 912, or about 923 amino acid residues where a single XTEN is to be incorporated into the GPXTEN.
- the GPXTEN can comprise a first XTEN of the foregoing lengths, and a second XTEN of about 144, or about 288, or about 576, or about 864, or about 875, or about 912, or about 923 amino acid residues.
- a GPXTEN can be designed to include XTEN of shorter lengths.
- the GPXTEN can comprise a GP linked to an XTEN having at least about 24, or about 36, or about 48, or about 60, or about 72, or about 84, or about 96 amino acid residues, in which the solubility of the fusion protein under physiologic conditions is at least three-fold greater than the corresponding GP not linked to XTEN, or alternatively, at least four- fold, or five-fold, or six-fold, or sevenfold, or eight- fold, or nine-fold, or at least 10-fold, or at least 20-fold, or at least 30-fold, or at least 50-fold, or at least 60-fold or greater than GP not linked to XTEN.
- the GP is glucagon.
- the invention provides methods of making GPXTEN compositions to improve ease of manufacture, result in increased stability, increased water solubility, and/or ease of formulation, as compared to the native GP.
- the invention includes a method of increasing the water solubility of a GP comprising the step of linking the GP to one or more XTEN such that a higher concentration in soluble form of the resulting GPXTEN can be achieved, under physiologic conditions, compared to the GP in an un- fused state.
- Factors that contribute to the property of XTEN to confer increased water solubility of GPs when incorporated into a fusion protein include the high solubility of the XTEN fusion partner and the low degree of self-aggregation between molecules of XTEN in solution.
- the method results in a GPXTEN fusion protein wherein the water solubility is at least about 20%, or at least about 30% greater, or at least about 50% greater, or at least about 75% greater, or at least about 90% greater, or at least about 100% greater, or at least about 150% greater, or at least about 200% greater, or at least about 400% greater, or at least about 600% greater, or at least about 800% greater, or at least about 1000% greater, or at least about 2000% greater, or at least about 4000% greater, or at least about 6000% greater under physiologic conditions, compared to the un- fused GP.
- the water solubility is at least about 20%, or at least about 30% greater, or at least about 50% greater, or at least about 75% greater, or at least about 90% greater, or at least about 100% greater, or at least about 150% greater, or at least about 200% greater, or at least about 400% greater, or at least about 600% greater, or at least about 800% greater, or at least about 1000% greater, or at least about 2000% greater
- the invention includes a method of enhancing the shelf- life of a GP comprising the step of linking the GP with one or more XTEN selected such that the shelf- life of the resulting GPXTEN is extended compared to the GP in an un- fused state.
- shelf-life refers to the period of time over which the functional activity of a GP or GPXTEN that is in solution or in some other storage formulation remains stable without undue loss of activity.
- “functional activity” refers to a pharmacologic effect or biological activity, such as the ability to bind a receptor or ligand, or an enzymatic activity, or to display one or more known functional activities associated with a GP, as known in the art.
- a GP that degrades or aggregates generally has reduced functional activity or reduced bioavailability compared to one that remains in solution.
- Factors that contribute to the ability of the method to extend the shelf life of GPs when incorporated into a fusion protein include the increased water solubility, reduced self- aggregation in solution, and increased heat stability of the XTEN fusion partner.
- the low tendency of XTEN to aggregate facilitates methods of formulating pharmaceutical preparations containing higher drug concentrations of GPs, and the heat- stability of XTEN contributes to the property of GPXTEN fusion proteins to remain soluble and functionally active for extended periods.
- the method results in GPXTEN fusion proteins with "prolonged" or “extended” shelf-life that exhibit greater activity relative to a standard that has been subjected to the same storage and handling conditions.
- the standard may be the un-fused full-length GP.
- the method includes the step of formulating the isolated GPXTEN with one or more pharmaceutically acceptable excipients that enhance the ability of the XTEN to retain its unstructured conformation and for the GPXTEN to remain soluble in the formulation for a time that is greater than that of the corresponding un-fused GP.
- the method comprises linking a GP to one or more XTEN to create a GPXTEN fusion protein results in a solution that retains greater than about 100% of the functional activity, or greater than about 105%, 110%, 120%, 130%, 150% or 200% of the functional activity of a standard when compared at a given time point and when subjected to the same storage and handling conditions as the standard, thereby enhancing its shelf- life.
- Shelf- life may also be assessed in terms of functional activity remaining after storage, normalized to functional activity when storage began.
- GPXTEN fusion proteins of the invention with prolonged or extended shelf-life as exhibited by prolonged or extended functional activity may retain about 50% more functional activity, or about 60%, 70%, 80%, or 90% more of the functional activity of the equivalent GP not linked to XTEN when subjected to the same conditions for the same period of time.
- a GPXTEN fusion protein of the invention comprising exendin-4 fused to one or more XTEN sequences may retain about 80% or more of its original activity in solution for periods of up to 2 weeks, or 4 weeks, or 6 weeks or longer under various temperature conditions.
- the GPXTEN retains at least about 50%, or about 60%, or at least about 70%, or at least about 80%, and most preferably at least about 90% or more of its original activity in solution when heated at 80 0 C for 10 min. In other embodiments, the GPXTEN retains at least about 50%, preferably at least about 60%, or at least about 70%, or at least about 80%, or alternatively at least about 90% or more of its original activity in solution when heated or maintained at 37°C for about 7 days. In another embodiment, GPXTEN fusion protein retains at least about 80% or more of its functional activity after exposure to a temperature of about 30 0 C to about 70 0 C over a period of time of about one hour to about 18 hours.
- the retained activity of the GPXTEN would be at least about two-fold, or at least about threefold, or at least about four- fold, or at least about five-fold, or at least about six-fold greater at a given time point than that of the corresponding GP not linked to the fusion protein.
- the present invention provides isolated polynucleic acids encoding GPXTEN chimeric fusion proteins and sequences complementary to polynucleic acid molecules encoding GPXTEN chimeric fusion proteins, including homologous variants thereof.
- the invention encompasses methods to produce polynucleic acids encoding GPXTEN chimeric fusion proteins and sequences complementary to polynucleic acid molecules encoding GPXTEN chimeric fusion protein, including homologous variants thereof. In general, and as illustrated in FIGS.
- the methods of producing a polynucleotide sequence coding for a GPXTEN fusion protein and expressing the resulting gene product include assembling nucleotides encoding GP and XTEN, ligating the components in frame, incorporating the encoding gene into an expression vector appropriate for and that can be recognized by a host cell, transforming the appropriate host cell with the expression vector, and culturing the host cell under conditions causing or permitting the fusion protein to be expressed in the transformed host cell, thereby producing the biologically-active GPXTEN polypeptide, which can be recovered as an isolated fusion protein by standard protein purification methods known in the art.
- nucleic acid sequences that encode GPXTEN may be used to generate recombinant DNA molecules that direct the expression of GPXTEN fusion proteins in appropriate host cells.
- Several cloning strategies are envisioned to be suitable for performing the present invention, many of which can be used to generate a construct that comprises a gene coding for a fusion protein of the GPXTEN composition of the present invention, or its complement.
- the cloning strategy would be used to create a gene that encodes a monomeric GPXTEN that comprises at least a first GP and at least a first XTEN polypeptide, or their complement.
- the gene would comprise a sequence encoding a GP or sequence variant.
- the cloning strategy would be used to create a gene that encodes a monomeric GPXTEN that comprises nucleotides encoding at least a first molecule of GP or its complement and a first and at least a second XTEN or their complement that would be used to transform a host cell for expression of the fusion protein of the GPXTEN composition.
- the genes can further comprise nucleotides encoding spacer sequences that may also encode cleavage sequence(s).
- the XTEN(s) of the expressed fusion protein may consist of multiple units of as few as four different sequence motifs, because the motifs themselves consist of non-repetitive amino acid sequences, the overall XTEN sequence is rendered non-repetitive.
- the XTEN-encoding polynucleotides comprise multiple polynucleotides that encode non-repetitive sequences, or motifs, operably linked in frame and in which the resulting expressed XTEN amino acid sequences are non-repetitive.
- a construct is first prepared containing the DNA sequence corresponding to GPXTEN fusion protein.
- DNA encoding the GP of the compositions may be obtained from a cDNA library prepared using standard methods from tissue or isolated cells believed to possess GP mRNA and to express it at a detectable level. Libraries can be screened with probes containing, for example, about 20 to 100 bases designed to identify the GP gene of interest by hybridization using conventional molecular biology techniques. The best candidates for probes are those that represent sequences that are highly homologous for the given glucose regulating peptide, and should be of sufficient length and sufficiently unambiguous that false positives are minimized, but may be degenerate at one or more positions.
- the coding sequence can be obtained using conventional primer extension procedures as described in Sambrook, et ah, supra, to detect precursors and processing intermediates of mRNA that may not have been reverse- transcribed into cDNA.
- Assays can then be conducted to confirm that hybridizing full-length genes are the desired GP gene(s).
- DNA can be conveniently obtained from a cDNA library prepared from such sources.
- the GP encoding gene(s) may also be obtained from a genomic library or created by standard synthetic procedures known in the art (e.g., automated nucleic acid synthesis using, for example one of the methods described in Engels et al. (Agnew. Chem. Int. Ed. Engl., 28:716-734 1989!), using DNA sequences obtained from publicly available databases, patents, or literature references. Such procedures are well known in the art and well described in the scientific and patent literature.
- sequences can be obtained from Chemical Abstracts Services (CAS) Registry Numbers (published by the American Chemical Society) and/or GenBank Accession Numbers (e.g., Locus ID, NP XXXXX, and XP XXXX) Model Protein identifiers available through the National Center for Biotechnology Information (NCBI) webpage, available on the world wide web at ncbi.nlm.nih.gov that correspond to entries in the CAS Registry or GenBank database that contain an amino acid sequence of the protein of interest or of a fragment or variant of the protein.
- NCBI National Center for Biotechnology Information
- the summary pages associated with each of these CAS and GenBank and GenSeq Accession Numbers as well as the cited journal publications are each incorporated by reference in their entireties, particularly with respect to the amino acid sequences described therein.
- the GP encoding gene encodes a protein from any one of Tables 1-3, or a fragment or variant thereof.
- a gene or polynucleotide encoding the GP portion of the subject GPXTEN protein, in the case of an expressed fusion protein that will comprise a single GP can be then be cloned into a construct, which can be a plasmid or other vector under control of appropriate transcription and translation sequences for high level protein expression in a biological system.
- a second gene or polynucleotide coding for the XTEN is genetically fused to the nucleotides encoding the N- and/or C-terminus of the GP gene by cloning it into the construct adjacent and in frame with the gene(s) coding for the GP.
- This second step can occur through a ligation or multimerization step.
- the gene constructs that are created can alternatively be the complement of the respective genes that encode the respective fusion proteins.
- the gene encoding for the XTEN can be made in one or more steps, either fully synthetically or by synthesis combined with enzymatic processes, such as restriction enzyme-mediated cloning, PCR and overlap extension, including methods more fully described in the Examples.
- the methods disclosed herein can be used, for example, to ligate short sequences of polynucleotides encoding XTEN into longer XTEN genes of a desired length and sequence.
- the method ligates two or more codon- optimized oligonucleotides encoding XTEN motif or segment sequences of about 9 to 14 amino acids, or about 12 to 20 amino acids, or about 18 to 36 amino acids, or about 48 to about 144 amino acids, or about 144 to about 288 or longer, or any combination of the foregoing ranges of motif or segment lengths.
- the disclosed method can be used to multimerize XTEN-encoding sequences into longer sequences of a desired length; e.g., a gene encoding 36 amino acids of XTEN can be dimerized into a gene encoding 72 amino acids, then 144, then 288, etc.
- XTEN polypeptides can be constructed such that the XTEN-encoding gene has low or virtually no repetitiveness through design of the codons selected for the motifs of the shortest unit used, which can reduce recombination and increase stability of the encoding gene in the transformed host.
- Genes encoding XTEN with non-repetitive sequences can be assembled from oligonucleotides using standard techniques of gene synthesis. The gene design can be performed using algorithms that optimize codon usage and amino acid composition.
- a library of relatively short XTEN-encoding polynucleotide constructs is created and then assembled, as illustrated in FIGS. 4 and 5.
- This can be a pure codon library such that each library member has the same amino acid sequence but many different coding sequences are possible.
- Such libraries can be assembled from partially randomized oligonucleotides and used to generate large libraries of XTEN segments comprising the sequence motifs. The randomization scheme can be optimized to control amino acid choices for each position as well as codon usage. Exemplary methods to achieve the foregoing are disclosed in the Examples. a. Polynucleotide libraries
- the invention provides libraries of polynucleotides that encode XTEN sequences that can be used to assemble genes that encode XTEN of a desired length and sequence.
- the XTEN-encoding library constructs comprise polynucleotides that encode polypeptide segments of a fixed length.
- a library of oligonucleotides that encode motifs of 9-14 amino acid residues can be assembled.
- libraries of oligonucleotides that encode motifs of 12 amino acids are assembled.
- the XTEN-encoding sequence segments can be dimerized or multimerized into longer encoding sequences. Dimerization or multimerization can be performed by ligation, overlap extension, PCR assembly or similar cloning techniques known in the art. This process of can be repeated multiple times until the resulting XTEN-encoding sequences have reached the organization of sequence and desired length, providing the XTEN-encoding genes.
- a library of polynucleotides that encodes e.g., 12 amino acid motifs can be dimerized and/or ligated into a library of polynucleotides that encode 36 amino acids.
- Libraries encoding motifs of different lengths; e.g., 9-14 amino acid motifs leading to libraries encoding 27 to 42 amino acids are contemplated by the invention.
- the library of polynucleotides that encode 27 to 42 amino acids, and preferably 36 amino acids can be serially dimerized into a library containing successively longer lengths of polynucleotides that encode XTEN sequences of a desired length for incorporation into the gene encoding the GPXTEN fusion protein, as disclosed herein.
- libraries can be assembled of polynucleotides that encode amino acids that are limited to specific sequence XTEN families; e.g., AD, AE, AF, AG, AM, or AQ sequences of Table 1.
- libraries can comprises sequences that encode two or more of the motif family sequences from Table 1. The names and sequences of representative, non- limiting polynucleotide sequences of libraries that encode 36mers are presented in Tables 10-13, and the methods used to create them are described more fully in the Examples.
- libraries that encode XTEN can be constructed from segments of polynucleotide codons linked in a randomized sequence that encode amino acids wherein at least about 80%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 97%, or at least about 98%, or at least about 99% of the codons are selected from the group consisting of condons for glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) amino acids.
- G glycine
- A alanine
- S serine
- T threonine
- E glutamate
- P proline
- the libraries can be used, in turn, for serial dimerization or ligation to achieve polynucleotide sequence libraries that encode XTEN sequences, for example, of 48, 72, 144, 288, 576, 864, 912, 923, 1318 amino acids, or up to a total length of about 3000 amino acids, as well as intermediate lengths, in which the encoded XTEN can have one or more of the properties disclosed herein, when expressed as a component of a GPXTEN fusion protein.
- the polynucleotide library sequences may also include additional bases used as "sequencing islands," described more fully below.
- FIG. 5 is a schematic flowchart of representative, non- limiting steps in the assembly of a XTEN polynucleotide construct and a GPXTEN polynucleotide construct in the embodiments of the invention.
- Individual oligonucleotides 501 can be annealed into sequence motifs 502 such as a 12 amino acid motif ("12-mer"), which is subsequently ligated with an oligo containing Bbsl, and Kpnl restriction sites 503. Additional sequence motifs from a library are annealed to the 12-mer until the desired length of the XTEN gene 504 is achieved.
- the XTEN gene is cloned into a staffer vector.
- the vector can optionally encode a Flag sequence 506 followed by a staffer sequence that is flanked by Bsal, Bbsl, and Kpnl sites 507 and, in this case, a single GP gene (encoding Ex4 in this example) 508, resulting in the gene encoding a GPXTEN comprising a single GP 500.
- a flag sequence 506 followed by a staffer sequence that is flanked by Bsal, Bbsl, and Kpnl sites 507 and, in this case, a single GP gene (encoding Ex4 in this example) 508, resulting in the gene encoding a GPXTEN comprising a single GP 500.
- a reporter protein Non- limiting examples of suitable reporter genes are green fluorescent protein, luciferace, alkaline phosphatase, and beta-galactosidase.
- One aspect of the invention is to provide polynucleotide sequences encoding the components of the fusion protein wherein the creation of the sequence has undergone codon optimization.
- codon optimization with the goal of improving expression of the polypeptide compositions and to improve the genetic stability of the encoding gene in the production hosts.
- codon optimization is of particular importance for XTEN sequences that are rich in glycine or that have very repetitive amino acid sequences. Codon optimization can be performed using computer programs (Gustafsson, C, et al. (2004) Trends Biotechnol, 22: 346-53), some of which minimize ribosomal pausing (Coda Genomics Inc.).
- codon libraries When designing XTEN sequences one can consider a number of properties. One can minimize the repetitiveness in the encoding DNA sequences. In addition, one can avoid or minimize the use of codons that are rarely used by the production host (e.g. the AGG and AGA arginine codons and one leucine codon in E. col ⁇ ). In the case of E. coli, two glycine codons, GGA and GGG, are rarely used in highly expressed proteins.
- codon optimization of the gene encoding XTEN sequences can be very desirable.
- DNA sequences that have a high level of glycine tend to have a high GC content that can lead to instability or low expression levels.
- codons such that the GC-content of XTEN-encoding sequence is suitable for the production organism that will be used to manufacture the XTEN.
- the full-length XTEN-encoding gene may comprise one or more sequencing islands.
- sequencing islands are short-stretch sequences that are distinct from the XTEN library construct sequences and that include a restriction site not present or expected to be present in the full-length XTEN- encoding gene.
- a sequencing island is the sequence
- a sequencing island is the sequence
- codon libraries where all members of the library encode the same amino acid sequence but where codon usage for the respective amino acids in the sequence is varied. Such libraries can be screened for highly expressing and genetically stable members that are particularly suitable for the large-scale production of XTEN-containing products.
- the initial library of short XTEN sequences can allow some variation in amino acid sequence. For instance one can randomize some codons such that a number of hydrophilic amino acids can occur in a particular position.
- the method provides that it can be genetically fused to the nucleotides encoding the N- and/or the C-terminus of the GP gene(s) by cloning it into the construct adjacent and in frame with the gene coding for GP or, optionally, adjacent to a spacer sequence.
- the invention provides various permutations of the foregoing, depending on the GPXTEN to be encoded.
- a gene encoding a GPXTEN fusion protein comprising a GP and two XTEN such as embodied by formula VI, as depicted above, the gene would have polynucleotides encoding GP, encoding two XTEN, which can be identical or different in composition and sequence length.
- the GP polynucleotides would encode exendin-4 and the polynucleotides encoding the N-terminus XTEN would encode AE912 and the polynucleotides encoding the C-terminus XTEN would encode AE 144.
- the step of cloning the GP genes into the XTEN construct can occur through a ligation or multimerization step.
- the constructs encoding GPXTEN fusion proteins can be designed in different configurations of the components XTEN 202, GP 203, and spacer sequences 204.
- the construct comprises polynucleotide sequences complementary to, or those that encode a monomelic polypeptide of components in the following order (5' to 3') GP 203 and XTEN 202, or the reverse order.
- FIG. 2A the construct comprises polynucleotide sequences complementary to, or those that encode a monomelic polypeptide of components in the following order (5' to 3') GP 203 and XTEN 202, or the reverse order.
- the construct comprises polynucleotide sequences complementary to, or those that encode a monomelic polypeptide of components in the following order (5' to 3') GP 203, spacer sequence 204, and XTEN 202, or the reverse order.
- the construct 201 encodes a monomeric GPXTEN comprising polynucleotide sequences complementary to, or those that encode components in the following order (5' to 3'): two molecules of GP 203 and XTEN 202, or the reverse order.
- FIG. 2C the construct 201 encodes a monomeric GPXTEN comprising polynucleotide sequences complementary to, or those that encode components in the following order (5' to 3'): two molecules of GP 203 and XTEN 202, or the reverse order.
- the construct comprises polynucleotide sequences complementary to, or those that encode a monomeric polypeptide of components in the following order (5' to 3'): two molecules of GP 203, spacer sequence 204, and XTEN 202, or the reverse order.
- the construct comprises polynucleotide sequences complementary to, or those that encode a monomeric polypeptide of components in the following order (5' to 3'): GP 203, spacer sequence 204, a second molecule of GP 203, and XTEN 202, or the reverse order.
- FIG. 2D the construct comprises polynucleotide sequences complementary to, or those that encode a monomeric polypeptide of components in the following order (5' to 3'): two molecules of GP 203, spacer sequence 204, and XTEN 202, or the reverse order.
- the construct comprises polynucleotide sequences complementary to, or those that encode a monomeric polypeptide of components in the following order (5' to 3'): GP 203, XTEN 202, GP 203, and a second XTEN 202, or the reverse sequence.
- the spacer polynucleotides can optionally comprise sequences encoding cleavage sequences. As will be apparent to those of skill in the art, other permutations of the foregoing are possible.
- the invention also encompasses polynucleotides comprising XTEN-encoding polynucleotide variants that have a high percentage of sequence identity to (a) a polynucleotide sequence from Table 9, or (b) sequences that are complementary to the polynucleotides of (a).
- a polynucleotide with a high percentage of sequence identity is one that has at least about an 80% nucleic acid sequence identity, alternatively at least about 81%, alternatively at least about 82%, alternatively at least about 83%, alternatively at least about 84%, alternatively at least about 85%, alternatively at least about 86%, alternatively at least about 87%, alternatively at least about 88%, alternatively at least about 89%, alternatively at least about 90%, alternatively at least about 91% , alternatively at least about 92%, alternatively at least about 93%, alternatively at least about 94%, alternatively at least about 95%, alternatively at least about 96%, alternatively at least about 97%, alternatively at least about 98%, and alternatively at least about 99% nucleic acid sequence identity to (a) or (b) of the foregoing, or that can hybridize with the target polynucleotide or its complement under stringent conditions.
- Homology, sequence similarity or sequence identity of nucleotide or amino acid sequences may also be determined conventionally by using known software or computer programs such as the BestFit or Gap pairwise comparison programs (GCG Wisconsin Package, Genetics Computer Group, 575 Science Drive, Madison, Wis. 53711). BestFit uses the local homology algorithm of Smith and Waterman (Advances in Applied Mathematics. 1981. 2: 482-489), to find the best segment of identity or similarity between two sequences. Gap performs global alignments: all of one sequence with all of another similar sequence using the method of Needleman and Wunsch, (Journal of Molecular Biology. 1970. 48:443-453). When using a sequence alignment program such as BestFit, to determine the degree of sequence homology, similarity or identity, the default setting may be used, or an appropriate scoring matrix may be selected to optimize identity, similarity or homology scores.
- BestFit Gap pairwise comparison programs
- BestFit uses the local homology algorithm of Smith and Waterman (Advances in Applied Mathematics. 1981
- nucleic acid sequences that are “complementary” are those that are capable of base-pairing according to the standard Watson-Crick complementarity rules.
- complementary sequences means nucleic acid sequences that are substantially complementary, as may be assessed by the same nucleotide comparison set forth above, or as defined as being capable of hybridizing to the polynucleotides that encode the GPXTEN sequences under stringent conditions, such as those described herein.
- the resulting polynucleotides encoding the GPXTEN chimeric fusion proteins can then be individually cloned into an expression vector.
- the nucleic acid sequence may be inserted into the vector by a variety of procedures. In general, DNA is inserted into an appropriate restriction endonuc lease site(s) using techniques known in the art.
- Vector components generally include, but are not limited to, one or more of a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence. Construction of suitable vectors containing one or more of these components employs standard ligation techniques which are known to the skilled artisan. Such techniques are well known in the art and well described in the scientific and patent literature.
- the vector may, for example, be in the form of a plasmid, cosmid, viral particle, or phage.
- the invention provides for the use of plasmid vectors containing replication and control sequences that are compatible with and recognized by the host cell, and are operably linked to the GPXTEN gene for controlled expression of the GPXTEN fusion proteins.
- the vector ordinarily carries a replication site, as well as sequences that encode proteins that are capable of providing phenotypic selection in transformed cells.
- E. coli may be transformed using pBR322, a plasmid derived from an E. coli species (Mandel et al., J MoI. Biol., 53: 154 (1970)).
- Plasmid pBR322 contains genes for ampicillin and tetracycline resistance and thus provides easy means for selection.
- vector sequences are well known for a variety of bacteria, yeast, and viruses.
- Useful expression vectors that can be used include, for example, segments of chromosomal, non-chromosomal and synthetic DNA sequences.
- "Expression vector” refers to a DNA construct containing a DNA sequence that is operably linked to a suitable control sequence capable of effecting the expression of the DNA encoding the fusion protein in a suitable host.
- control sequences include a promoter to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites, and sequences that control termination of transcription and translation.
- Suitable vectors include, but are not limited to, derivatives of SV40 and pcDNA and known bacterial plasmids such as col EI, pCRl, pBR322, pMal-C2, pET, pGEX as described by Smith, et al., Gene 57:31-40 (1988), pMB9 and derivatives thereof, plasmids such as RP4, phage DNAs such as the numerous derivatives of phage I such as NM98 9, as well as other phage DNA such as M 13 and filamentous single stranded phage DNA; yeast plasmids such as the 2 micron plasmid or derivatives of the 2m plasmid, as well as centomeric and integrative yeast shuttle vectors; vectors useful in eukaryotic cells such as vectors useful in insect or mammalian cells; vectors derived from combinations of plasmids and phage DNAs, such as plasmids that have been modified to employ phage DNA or the expression
- Promoters suitable for use in expression vectors with prokaryotic hosts include the ⁇ -lactamase and lactose promoter systems [Chang et al., Nature, 275:615 (1978); Goeddel et al., Nature, 281:544 (1979)], alkaline phosphatase, a tryptophan (tip) promoter system [Goeddel, Nucleic Acids Res., 8:4057 (1980); EP 36,776], and hybrid promoters such as the tac promoter [deBoer et al., Proc. Natl. Acad. Sci. USA, 80:21-25 (1983)], all would be operably linked to the DNA encoding GPXTEN polypeptides. Promoters for use in bacterial systems can also contain a Shine-Dalgarno (S. D.) sequence, operably linked to the DNA encoding GPXTEN polypeptides.
- S. D. Shine-Dalgarno
- the invention contemplates use of other expression systems including, for example, a baculovirus expression system with both non- fusion transfer vectors, such as, but not limited to pVL941 (BamHI cloning site, available from Summers, et al., Virology 84:390-402 (1978)), pVL1393 (BamHI, Smal, Xbal, EcoRI, IVotl, Xmalll, BgIII and Pstl cloning sites; Invitrogen), pVL1392 (BgIII, Pstl, Notl, Xmalll, EcoRI, Xball, Smal and BamHI cloning site; Summers, et al., Virology 84:390- 402 (1978) and Invitrogen) and pBlueBacIII (BamHI, BgIII, Pstl, Ncol and Hindi II cloning site, with blue/white recombinant screening, Invitrog
- Mammalian expression vectors can comprise an origin of replication, a suitable promoter and enhancer, and also any necessary ribosome binding sites, polyadenylation site, splice donor and acceptor sites, transcriptional termination sequences, and 5' flanking nontranscribed sequences. DNA sequences derived from the SV40 splice, and polyadenylation sites may be used to provide the required nontranscribed genetic elements.
- Mammalian expression vectors contemplated for use in the invention include vectors with inducible promoters, such as the dihydrofolate reductase promoters, any expression vector with a DHFR expression cassette or a DHFR/methotrexate co-amplification vector such as pED (Pstl, Sail, Sbal, Smal and EcoRI cloning sites, with the vector expressing both the cloned gene and DHFR; Randal J. Kaufman, 1991, Randal J. Kaufman, Current Protocols in Molecular Biology, 16,12 (1991)).
- inducible promoters such as the dihydrofolate reductase promoters
- any expression vector with a DHFR expression cassette or a DHFR/methotrexate co-amplification vector such as pED (Pstl, Sail, Sbal, Smal and EcoRI cloning sites, with the vector expressing both the cloned gene and DHFR; Randal J. Kaufman,
- glutamine synthetase/methionine sulfoximine co-amplification vector such as pEE14 (Hindlll, Xball, Smal, Sbal, EcoRI and Sell cloning sites in which the vector expresses glutamine synthetase and the cloned gene; Celltech).
- a vector that directs episomal expression under the control of the Epstein Barr Virus (EBV) or nuclear antigen (EBNA) can be used such as pREP4 (BamHI r SfH, Xhol, Notl, Nhel, Hindi II, Nhel, PvuII and Kpnl cloning sites, constitutive RSV-LTR promoter, hygromycin selectable marker; Invitrogen), pCEP4 (BamHI, SfH, Xhol, Notl, Nhel, Hindlll, Nhel, PvuII and Kpnl cloning sites, constitutive hCMV immediate early gene promoter, hygromycin selectable marker; Invitrogen), pMEP4 (.Kpnl, Pvul, Nhel, Hindlll, Notl, Xhol, Sfil, BamHI cloning sites, inducible methallothionein H a gene promoter, hygromycin selectable marker, In
- Selectable mammalian expression vectors for use in the invention include, but are not limited to, pRc/CMV (Hind 111, BstXI, Notl, Sbal and Apal cloning sites, G418 selection, Invitrogen), pRc/RSV (Hind II, Spel, BstXI, Notl, Xbal cloning sites, G418 selection, Invitrogen) and the like.
- Vaccinia virus mammalian expression vectors see, for example, Randall J. Kaufman, Current Protocols in Molecular Biology 16.12 (Frederick M. Ausubel, et al., eds.
- pSCl 1 Smal cloning site, TK- and beta-gal selection
- pMJ601 Sal 1, Sma 1, A fll, Narl, BspMlI, BamHI, Apal, Nhel, SacII, Kpnl and Hindlll cloning sites
- TK- and -gal selection pTKgptFIS (EcoRI, Pstl, SaIII, Accl, Hindll, Sbal, BamHI and Hpa cloning sites, TK or XPRT selection) and the like.
- Yeast expression systems that can also be used in the present invention include, but are not limited to, the non- fusion pYES2 vector (XJbal, Sphl, Shol, NotI, GstXI, EcoRI, BstXI, BamHI, Sad, Kpnl and Hindlll cloning sites, Invitrogen), the fusion pYESHisA, B, C (Xball, Sphl, Shol, NotI, BstXI, EcoRI, BamHI, Sad, Kpnl and Hindi II cloning sites, N-terminal peptide purified with ProBond resin and cleaved with enterokinase; Invitrogen), pRS vectors and the like.
- the non- fusion pYES2 vector XJbal, Sphl, Shol, NotI, GstXI, EcoRI, BstXI, BamHI, Sad, Kpnl and Hindlll cloning sites
- the expression vector containing the chimeric GPXTEN fusion protein-encoding polynucleotide molecule may include drug selection markers. Such markers aid in cloning and in the selection or identification of vectors containing chimeric DNA molecules. For example, genes that confer resistance to neomycin, puromycin, hygromycin, dihydrofolate reductase (DHFR) inhibitor, guanine phosphoribosyl transferase (GPT), zeocin, and histidinol are useful selectable markers.
- drug selection markers aid in cloning and in the selection or identification of vectors containing chimeric DNA molecules. For example, genes that confer resistance to neomycin, puromycin, hygromycin, dihydrofolate reductase (DHFR) inhibitor, guanine phosphoribosyl transferase (GPT), zeocin, and histidinol are useful selectable markers.
- enzymes such as herpes simplex virus thymidine kinase (tk) or chloramphenicol acetyltransferase (CAT) may be employed.
- Immunologic markers also can be employed. Any known selectable marker may be employed so long as it is capable of being expressed simultaneously with the nucleic acid encoding a gene product. Further examples of selectable markers are well known to one of skill in the art and include reporters such as enhanced green fluorescent protein (EGFP), beta-galactosidase ( ⁇ -gal) or chloramphenicol acetyltransferase (CAT).
- EGFP enhanced green fluorescent protein
- ⁇ -gal beta-galactosidase
- CAT chloramphenicol acetyltransferase
- the polynucleotide encoding a GPXTEN fusion protein composition can be fused C-terminally to an N-terminal signal sequence appropriate for the expression host system.
- Signal sequences are typically proteolytically removed from the protein during the translocation and secretion process, generating a defined N-terminus.
- a wide variety of signal sequences have been described for most expression systems, including bacterial, yeast, insect, and mammalian systems. A non-limiting list of preferred examples for each expression system follows herein.
- Preferred signal sequences are OmpA, PhoA, and DsbA for E. coli expression.
- Signal peptides preferred for yeast expression are ppL-alpha, DEX4, invertase signal peptide, acid phosphatase signal peptide, CPY, or INUl.
- the preferred signal sequences are sexta adipokinetic hormone precursor, CPl, CP2, CP3, CP4, TPA, PAP, or gp67.
- the preferred signal sequences are IL2L, SV40, IgG kappa and IgG lambda.
- a leader sequence potentially comprising a well-expressed, independent protein domain, can be fused to the N-terminus of the GPXTEN sequence, separated by a protease cleavage site. While any leader peptide sequence which does not inhibit cleavage at the designed proteolytic site can be used, sequences in preferred embodiments will comprise stable, well-expressed sequences such that expression and folding of the overall composition is not significantly adversely affected, and preferably expression, solubility, and/or folding efficiency are significantly improved. A wide variety of suitable leader sequences have been described in the literature.
- a non- limiting list of suitable sequences includes maltose binding protein, cellulose binding domain, glutathione S-transferase, 6xHis tag, FLAG tag, hemaglutinin tag, and green fluorescent protein.
- the leader sequence can also be further improved by codon optimization, especially in the second codon position following the ATG start codon, by methods well described in the literature and hereinabove.
- Various in vitro enzymatic methods for cleaving proteins at specific sites are known. Such methods include use of enterokinase (DDDK), Factor Xa (IDGR), thrombin (LVPRGS), PreScissionTM (LEVLFQGP), TEV protease (EQLYFQG), 3C protease (ETLFQGP), Sortase A (LPETG), Granzyme B (D/X, N/X, M/N or S/X), inteins, SUMO, DAPase (TAGZymeTM), Aeromonas aminopeptidase, Aminopeptidase M, and carboxypeptidases A and B. Additional methods are disclosed in Arnau, et al., Protein Expression and Purification 48: 1-13 (2006).
- the invention provides polynucleotide constructs and methods of making constructs (e.g., as described in the Examples) comprising an optimized polynucleotide sequence encoding at least about 20 to about 60 amino acids with XTEN characteristics can be included at the N-terminus of the XTEN- encoding sequence to promote the initiation of translation to allow for expression of XTEN fusions at the N- terminus of proteins without the presence of a helper domain.
- the sequence does not require subsequent cleavage of a helper domain, thereby reducing the number of steps to manufacture XTEN-containing compositions.
- the optimized N- terminal sequence has attributes of an unstructured protein, but may include nucleotide bases encoding amino acids selected for their ability to promote initiation of translation and enhanced expression.
- the optimized polynucleotide encodes an XTEN sequence with at least about 90% sequence identity to AE912. In another embodiment of the foregoing, the optimized polynucleotide encodes an XTEN sequence with at least about 90% sequence identity to AM923. In another embodiment of the foregoing, the optimized polynucleotide encodes an XTEN sequence with at least about 90% sequence identity to AE624.
- the optimized polynucleotide encodes an XTEN sequence with at least about 90% sequence identity to AE48. In another embodiment of the foregoing, the optimized polynucleotide encodes an XTEN sequence with at least about 90% sequence identity to AM48. In one embodiment, the optimized polynucleotide NTS comprises a sequence that exhibits at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, sequence identity to a sequence or its complement selected from AE 48: 5'-
- AM 48 5'- ATGGCTGAACCTGCTGGCTCTCCAACCTCCACTGAGGAAGGTGCATCCCCGGGCACCAGCTCTA CCGGTTCTCCAGGTAGCTCTACCCCGTCTGGTGCTACCGGCTCTCCAGGTAGCTCTACCCCGTCT GGTGCTACTGGCTCTCCA-3 '
- the protease site of the leader sequence construct is chosen such that it is recognized by an in vivo protease.
- the protein is purified from the expression system while retaining the leader by avoiding contact with an appropriate protease.
- the full-length construct is then injected into a patient. Upon injection, the construct comes into contact with the protease specific for the cleavage site and is cleaved by the protease.
- the uncleaved protein is substantially less active than the cleaved form, this method has the beneficial effect of allowing higher initial doses while avoiding toxicity, as the active form is generated slowly in vivo.
- in vivo proteases which are useful for this application include tissue kallikrein, plasma kallikrein, trypsin, pepsin, chymotrypsin, thrombin, and matrix metalloproteinases, or the proteases of Table 8.
- tissue kallikrein plasma kallikrein
- trypsin trypsin
- pepsin trypsin
- chymotrypsin thrombin
- matrix metalloproteinases or the proteases of Table 8.
- the vectors containing the DNA segments of interest can be transferred into the host cell by well-known methods, depending on the type of cellular host. For example, calcium chloride transfection is commonly utilized for prokaryotic cells, whereas calcium phosphate treatment, lipofection, or electroporation may be used for other cellular hosts. Other methods used to transform mammalian cells include the use of polybrene, protoplast fusion, liposomes, electroporation, and microinjection. See, generally, Sambrook, et al., supra. [00269] The transformation may occur with or without the utilization of a carrier, such as an expression vector. Then, the transformed host cell is cultured under conditions suitable for expression of the chimeric DNA molecule encoding of GPXTEN.
- a carrier such as an expression vector
- the present invention also provides a host cell for expressing the monomeric fusion protein compositions disclosed herein.
- suitable eukaryotic host cells include, but are not limited to mammalian cells, such as VERO cells, HELA cells such as ATCC No. CCL2, CHO cell lines, COS cells, WB 8 cells, BHK cells , HepG2 cells, 3T3 cells, A549 cells, PC 12 cells, K562 cells, 293 cells, Sf9 cells and CvI cells.
- suitable non-mammalian eukaryotic cells include eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for encoding vectors.
- Saccharomyces cerevisiae is a commonly used lower eukaryotic host microorganism. Others include Schizosaccharomyces pombe (Beach and Nurse, Nature, 290: 140 [1981]; EP 139,383 published 2 May 1985); Kluyveromyces hosts (U.S. Pat. No. 4,943,529; Fleer et al., Bio/Technology, 9:968-975 (1991)) such as, e.g., K. lactis (MW98-8C, CBS683, CBS4574; Louvencourt et al., J. Bacterid., 737 [1983]), K.fragilis (ATCC 12,424), K.
- Methylotropic yeasts are suitable herein and include, but are not limited to, yeast capable of growth on methanol selected from the genera consisting of Hansenula, Candida, Kloeckera, Pichia, Saccharomyces, Torulopsis , and Rhodotorula .
- yeast capable of growth on methanol selected from the genera consisting of Hansenula, Candida, Kloeckera, Pichia, Saccharomyces, Torulopsis , and Rhodotorula .
- a list of specific species that are exemplary of this class of yeasts may be found in C. Anthony, The Biochemistry of Methylotrophs, 269 (1982).
- suitable cells include, but are not limited to, prokaryotic host cells strains such as Escherichia coli, (e.g., strain DH5-a), Bacillus subtilis, Salmonella typhimurium, or strains of the genera of Pseudomonas, Streptomyces and Staphylococcus.
- prokaryotic host cells strains such as Escherichia coli, (e.g., strain DH5-a), Bacillus subtilis, Salmonella typhimurium, or strains of the genera of Pseudomonas, Streptomyces and Staphylococcus.
- Non- limiting examples of suitable prokaryotes include those from the genera: Actinoplanes ; Archaeoglobus ; Bdellovibrio; Borrelia; Chloroflexus; Enterococcus; Escherichia; Lactobacillus; Listeria; Oceanobacillus; Paracoccus; Pseudomonas; Staphylococcus; Streptococcus; Streptomyces; Thermoplasma; and Vibrio.
- Non-limiting examples of specific strains include: Archaeoglobus fulgidus; Bdellovibrio bacteriovorus; Borrelia burgdorferi; Chloroflexus aurantiacus; Enterococcus faecalis; Enterococcus faecium; Lactobacillus johnsonii; Lactobacillus plantarum; Lactococcus lactis; Listeria innocua; Listeria monocytogenes; Oceanobacillus iheyensis; Paracoccus zeaxanthinifaciens; Pseudomonas mevalonii; Staphylococcus aureus; Staphylococcus epidermidis; Staphylococcus haemolyticus; Streptococcus agalactiae; Streptomyces griseolosporeus; Streptococcus mutans; Streptococcus pneumoniae; Streptococcus pyogene
- Host cells containing the polynucleotides of interest can be cultured in conventional nutrient media (e.g., Ham's nutrient mixture) modified as appropriate for activating promoters, selecting transformants or amplifying genes.
- the culture conditions such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
- Cells are typically harvested by centrifugation, disrupted by physical or chemical means, and the resulting crude extract retained for further purification. For compositions secreted by the host cells, supernatant from centrifugation is separated and retained for further purification.
- Microbial cells employed in expression of proteins can be disrupted by any convenient method, including freeze -thaw cycling, sonication, mechanical disruption, or use of cell lysing agents, all of which are well known to those skilled in the art.
- Embodiments that involve cell lysis may entail use of a buffer that contains protease inhibitors that limit degradation after expression of the chimeric DNA molecule. Suitable protease inhibitors include, but are not limited to leupeptin, pepstatin or aprotinin. The supernatant then may be precipitated in successively increasing concentrations of saturated ammonium sulfate.
- Gene expression may be measured in a sample directly, for example, by conventional Southern blotting, Northern blotting to quantitate the transcription of mRNA [Thomas, Proc. Natl. Acad. Sci. USA, 77:5201-5205 (1980)], dot blotting (DNA analysis), or in situ hybridization, using an appropriately labeled probe, based on the sequences provided herein.
- antibodies may be employed that can recognize specific duplexes, including DNA duplexes, RNA duplexes, and DNA-RNA hybrid duplexes or DNA-protein duplexes. The antibodies in turn may be labeled and the assay may be carried out where the duplex is bound to a surface, so that upon the formation of duplex on the surface, the presence of antibody bound to the duplex can be detected.
- Gene expression may be measured by immunological of fluorescent methods, such as immunohistochemical staining of cells or tissue sections and assay of cell culture or body fluids or the detection of selectable markers, to quantitate directly the expression of gene product.
- Antibodies useful for immunohistochemical staining and/or assay of sample fluids may be either monoclonal or polyclonal, and may be prepared in any mammal. Conveniently, the antibodies may be prepared against a native sequence GP polypeptide or against a synthetic peptide based on the DNA sequences provided herein or against exogenous sequence fused to GP and encoding a specific antibody epitope.
- selectable markers are well known to one of skill in the art and include reporters such as enhanced green fluorescent protein (EGFP), beta-galactosidase ( ⁇ -gal) or chloramphenicol acetyltransferase (CAT).
- Expressed GPXTEN polypeptide product(s) may be purified via methods known in the art or by methods disclosed herein. Procedures such as gel filtration, affinity purification, salt fractionation, ion exchange chromatography, size exclusion chromatography, hydroxyapatite adsorption chromatography, hydrophobic interaction chromatography and gel electrophoresis may be used; each tailored to recover and purify the fusion protein produced by the respective host cells. Some expressed GPXTEN may require refolding during isolation and purification. Methods of purification are described in Robert K. Scopes, Protein Purification: Principles and Practice, Charles R. Castor (ed.), Springer-Verlag 1994, and Sambrook, et al., supra.
- Multi-step purification separations are also described in Baron, et al., Crit. Rev. Biotechnol. 10: 179-90 (1990) and Below, et al., J. Chromatogr. A. 679:67-83 (1994).
- the present invention provides pharmaceutical compositions comprising GPXTEN.
- the pharmaceutical composition comprises the GPXTEN fusion protein and at least one pharmaceutically acceptable carrier.
- GPXTEN polypeptides of the present invention can be formulated according to known methods to prepare pharmaceutically useful compositions, whereby the polypeptide is combined in admixture with a pharmaceutically acceptable carrier vehicle, such as aqueous solutions or buffers, pharmaceutically acceptable suspensions and emulsions.
- a pharmaceutically acceptable carrier vehicle such as aqueous solutions or buffers, pharmaceutically acceptable suspensions and emulsions.
- non-aqueous solvents include propyl ethylene glycol, polyethylene glycol and vegetable oils.
- Therapeutic formulations are prepared for storage by mixing the active ingredient having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers, as described in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980), in the form of lyophilized formulations or aqueous solutions.
- the pharmaceutical compositions can be administered orally, intranasally, parenterally or by inhalation therapy, and may take the form of tablets, lozenges, granules, capsules, pills, ampoules, suppositories or aerosol form. They may also take the form of suspensions, solutions and emulsions of the active ingredient in aqueous or nonaqueous diluents, syrups, granulates or powders.
- the pharmaceutical compositions can also contain other pharmaceutically active compounds or a plurality of compounds of the invention.
- compositions may be administered for therapy by any suitable route including oral, rectal, nasal, topical (including transdermal, aerosol, buccal and sublingual), vaginal, parenteral (including subcutaneous, subcutaneous by infusion pump, intramuscular, intravenous and intradermal), intravitreal, and pulmonary. It will also be appreciated that the preferred route will vary with the condition and age of the recipient, and the disease being treated.
- the pharmaceutical composition is administered subcutaneously.
- the composition may be supplied as a lyophilized powder to be reconstituted prior to administration.
- the composition may also be supplied in a liquid form, which can be administered directly to a patient.
- the composition is supplied as a liquid in a pre-filled syringe such that a patient can easily self-administer the composition.
- Extended release formulations useful in the present invention may be oral formulations comprising a matrix and a coating composition.
- suitable matrix materials may include waxes (e.g., camauba, bees wax, paraffin wax, ceresine, shellac wax, fatty acids, and fatty alcohols), oils, hardened oils or fats (e.g., hardened rapeseed oil, castor oil, beef tallow, palm oil, and soya bean oil), and polymers (e.g., hydroxypropyl cellulose, polyvinylpyrrolidone, hydroxypropyl methyl cellulose, and polyethylene glycol).
- waxes e.g., camauba, bees wax, paraffin wax, ceresine, shellac wax, fatty acids, and fatty alcohols
- oils hardened oils or fats (e.g., hardened rapeseed oil, castor oil, beef tallow, palm oil, and soya bean oil)
- polymers e.g.,
- the coating composition may comprise an insoluble matrix polymer and/or a water soluble material.
- Water soluble materials can be polymers such as polyethylene glycol, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, polyvinylpyrrolidone, polyvinyl alcohol, or monomelic materials such as sugars (e.g., lactose, sucrose, fructose, mannitol and the like), salts (e.g., sodium chloride, potassium chloride and the like), organic acids (e.g., fumaric acid, succinic acid, lactic acid, and tartaric acid), and mixtures thereof.
- an enteric polymer may be incorporated into the coating composition.
- Suitable enteric polymers include hydroxypropyl methyl cellulose, acetate succinate, hydroxypropyl methyl cellulose, phthalate, polyvinyl acetate phthalate, cellulose acetate phthalate, cellulose acetate trimellitate, shellac, zein, and polymethacrylates containing carboxyl groups.
- the coating composition may be plasticised by adding suitable plasticisers such as, for example, diethyl phthalate, citrate esters, polyethylene glycol, glycerol, acetylated glycerides, acetylated citrate esters, dibutylsebacate, and castor oil.
- the coating composition may also include a filler, which can be an insoluble material such as silicon dioxide, titanium dioxide, talc, kaolin, alumina, starch, powdered cellulose, MCC, or polacrilin potassium.
- a filler which can be an insoluble material such as silicon dioxide, titanium dioxide, talc, kaolin, alumina, starch, powdered cellulose, MCC, or polacrilin potassium.
- the coating composition may be applied as a solution or latex in organic solvents or aqueous solvents or mixtures thereof. Solvents such as water, lower alcohol, lower chlorinated hydrocarbons, ketones, or mixtures thereof may be used.
- the compositions of the invention may be formulated using a variety of excipients. Suitable excipients include microcrystalline cellulose (e.g.
- Avicel PH 102, Avicel PHlOl polymethacrylate, poly(ethyl acrylate, methyl methacrylate, trimethylammonioethyl methacrylate chloride) (such as Eudragit RS-30D), hydroxypropyl methylcellulose (Methocel KlOOM, Premium CR Methocel KlOOM, Methocel E5, Opadry®), magnesium stearate, talc, triethyl citrate, aqueous ethylcellulose dispersion (Surelease®), and protamine sulfate.
- Polymethacrylate poly(ethyl acrylate, methyl methacrylate, trimethylammonioethyl methacrylate chloride) (such as Eudragit RS-30D), hydroxypropyl methylcellulose (Methocel KlOOM, Premium CR Methocel KlOOM, Methocel E5, Opadry®), magnesium stearate, talc,
- the slow release agent may also comprise a carrier, which can comprise, for example, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents.
- Pharmaceutically acceptable salts can also be used in these slow release agents, for example, mineral salts such as hydrochlorides, hydrobromides, phosphates, or sulfates, as well as the salts of organic acids such as acetates, proprionates, malonates, or benzoates.
- the composition may also contain liquids, such as water, saline, glycerol, and ethanol, as well as substances such as wetting agents, emulsifying agents, or pH buffering agents. Liposomes may also be used as a carrier.
- compositions of the present invention are encapsulated in liposomes, which have demonstrated utility in delivering beneficial active agents in a controlled manner over prolonged periods of time.
- Liposomes are closed bilayer membranes containing an entrapped aqueous volume. Liposomes may also be unilamellar vesicles possessing a single membrane bilayer or multilamellar vesicles with multiple membrane bilayers, each separated from the next by an aqueous layer.
- the structure of the resulting membrane bilayer is such that the hydrophobic (non-polar) tails of the lipid are oriented toward the center of the bilayer while the hydrophilic (polar) heads orient towards the aqueous phase.
- the liposome may be coated with a flexible water soluble polymer that avoids uptake by the organs of the mononuclear phagocyte system, primarily the liver and spleen.
- Suitable hydrophilic polymers for surrounding the liposomes include, without limitation, PEG, polyvinylpyrrolidone, polyvinylmethylether, polymethyloxazoline, polyethyloxazoline, polyhydroxypropyloxazoline, polyhydroxypropylmethacrylamide, polymethacrylamide, polydimethylacrylamide, polyhydroxypropylmethacrylate, polyhydroxethylacrylate, hydroxymethylcellulose hydroxyethylcellulose, polyethyleneglycol, polyaspartamide and hydrophilic peptide sequences as described in U.S. Pat. Nos. 6,316,024; 6,126,966; 6,056,973; 6,043,094, the contents of which are incorporated by reference in their entirety.
- Liposomes may be comprised of any lipid or lipid combination known in the art.
- the vesicle-forming lipids may be naturally-occurring or synthetic lipids, including phospholipids, such as phosphatidylcholine, phosphatidylethanolamine, phosphatidic acid, phosphatidylserine, phasphatidylglycerol, phosphatidylinositol, and sphingomyelin as disclosed in U.S. Pat. Nos. 6,056,973 and 5,874,104.
- the vesicle- forming lipids may also be glycolipids, cerebrosides, or cationic lipids, such as 1,2- dioleyloxy-3-(trimethylamino) propane (DOTAP); N-[l-(2,3,-ditetradecyloxy)propyl]-N,N-dimethyl-N- hydroxyethylammonium bromide (DMRIE); N-[I [(2,3,-dioleyloxy)propyl]-N,N-dimethyl-N-hydroxy ethylammonium bromide (DORIE); N-[l-(2,3-dioleyloxy)propyl]-N,N,N-trimethylammonium chloride (DOTMA); 3 [N-(N',N'-dimethylaminoethane) carbamoly] cholesterol (DC-Choi); or dimethyldioctadecylammonium (DDAB) also as disclosed in U.S. Pat. No. 6,
- a desired property is that the formulation be supplied in a form that can pass through a 25, 28, 30, 31, 32 gauge needle for intravenous, intramuscular, intraarticular, or subcutaneous administration.
- transdermal formulations can be performed using methods also known in the art, including those described generally in, e.g., U.S. Pat. Nos. 5,186,938 and 6,183,770, 4,861,800, 6,743,211, 6,945,952, 4,284,444, and WO 89/09051, incorporated herein by reference in their entireties.
- a transdermal patch is a particularly useful embodiment with polypeptides having absorption problems. Patches can be made to control the release of skin-permeable active ingredients over a 12 hour, 24 hour, 3 day, and 7 day period. In one example, a 2-fold daily excess of a polypeptide of the present invention is placed in a nonvolatile fluid.
- compositions of the invention are provided in the form of a viscous, non-volatile liquid.
- the penetration through skin of specific formulations may be measures by standard methods in the art (for example, Franz et al., J. Invest. Derm. 64: 194-195 (1975)).
- suitable patches are passive transfer skin patches, iontophoretic skin patches, or patches with microneedles such as Nicoderm.
- the composition may be delivered via intranasal, buccal, or sublingual routes to the brain to enable transfer of the active agents through the olfactory passages into the CNS and reducing the systemic administration. Devices commonly used for this route of administration are included in U.S. Pat. No. 6,715,485.
- compositions delivered via this route may enable increased CNS dosing or reduced total body burden reducing systemic toxicity risks associated with certain drugs.
- Preparation of a pharmaceutical composition for delivery in a subdermally implantable device can be performed using methods known in the art, such as those described in, e.g., U.S. Pat. Nos. 3,992,518; 5,660,848; and 5,756,115.
- Osmotic pumps may be used as slow release agents in the form of tablets, pills, capsules or implantable devices. Osmotic pumps are well known in the art and readily available to one of ordinary skill in the art from companies experienced in providing osmotic pumps for extended release drug delivery.
- Syringe pumps may also be used as slow release agents.
- Such devices are described in U.S. Pat. Nos. 4,976,696; 4,933,185; 5,017,378; 6,309,370; 6,254,573; 4,435,173; 4,398,908; 6,572,585; 5,298,022; 5,176,502; 5,492,534; 5,318,540; and 4,988,337, the contents of which are incorporated herein by reference.
- One skilled in the art considering both the disclosure of this invention and the disclosures of these other patents could produce a syringe pump for the extended release of the compositions of the present invention.
- the invention provides a kit to facilitate the use of the GPXTEN polypeptides.
- the kit comprises the pharmaceutical composition provided herein, a label identifying the pharmaceutical composition, and an instruction for storage, reconstitution and/or administration of the pharmaceutical compositions to a subjectln some embodiment, the kit comprises, preferablly: (a) an amount of a GPXTEN fusion protein composition sufficient to treat a disease, condition or disorder upon administration to a subject in need thereof; and (b) an amount of a pharmaceutically acceptable carrier; together in a formulation ready for injection or for reconstitution with sterile water, buffer, or dextrose; together with a label identifying the GPXTEN drug and storage and handling conditions, and a sheet of the approved indications for the drug, instructions for the reconstitution and/or administration of the GPXTEN drug for the use for the prevention and/or treatment of a approved indication, appropriate dosage and safety information, and information identifying the lot and expiration of the drug.
- the kit can comprise
- a staffer vector pCW0359 was constructed based on a pET vector and that includes a T7 promoter.
- pCW0359 encodes a cellulose binding domain (CBD) and a TEV protease recognition site followed by a staffer sequence that is flanked by Bsal, Bbsl, and Kpnl sites.
- the Bsal and Bbsl sites were inserted such that they generate compatible overhangs after digestion.
- the staffer sequence is followed by a truncated version of the GFP gene and a His tag.
- the staffer sequence contains stop codons and thus E.
- the staffer vector pCW0359 was digested with Bsal and Kpnl to remove the staffer segment and the resulting vector fragment was isolated by agarose gel purification.
- the sequences were designated XTEN AD36, reflecting the AD family of motifs. Its segments have the amino acid sequence [X] 3 where X is a 12mer peptide with the sequences: GESPGGSSGSES, GSEGSSGPGESS, GSSESGSSEGGP, or GSGGEPSESGSS.
- the insert was obtained by annealing the following pairs of phosphorylated synthetic oligonucleotide pairs:
- AD lrev ACCTGAYTCRGAACCGCTRGARCCACCHGGAGATTC
- AD2rev ACCTGARGAYTCRCCHGGACCRGAAGAACCTTCGCT
- AD3for AGGTTCYTCYGAAAGCGGTTCTTCYGARGGYGGTCC
- AD3rev ACCTGGACCRCCYTCRGAAGAACCGCTTTCRGARGA
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Endocrinology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Diabetes (AREA)
- Toxicology (AREA)
- Biomedical Technology (AREA)
- Cardiology (AREA)
- Wood Science & Technology (AREA)
- Urology & Nephrology (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Physical Education & Sports Medicine (AREA)
- Heart & Thoracic Surgery (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Vascular Medicine (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Rheumatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP10786730.1A EP2440228B8 (en) | 2009-06-08 | 2010-06-08 | Glucose-regulating polypeptides and methods of making and using same |
| JP2012515082A JP5839597B2 (ja) | 2009-06-08 | 2010-06-08 | グルコース調節ポリペプチド並びにその作成及び使用方法 |
| ES10786730T ES2705249T3 (es) | 2009-06-08 | 2010-06-08 | Polipéptidos reguladores de glucosa y métodos para su producción y uso |
| NZ596778A NZ596778A (en) | 2009-06-08 | 2010-06-08 | Glucose-regulating polypeptides and methods of making and using same |
| CN201080035271.0A CN102481331B (zh) | 2009-06-08 | 2010-06-08 | 葡萄糖调节多肽及其制备和使用方法 |
| AU2010258898A AU2010258898B8 (en) | 2009-06-08 | 2010-06-08 | Glucose-regulating polypeptides and methods of making and using same |
| DK10786730.1T DK2440228T3 (en) | 2009-06-08 | 2010-06-08 | Glucose regulating polypeptides and methods for their preparation and use |
| CA2764108A CA2764108A1 (en) | 2009-06-08 | 2010-06-08 | Glucose-regulating polypeptides and methods of making and using same |
| ZA2012/00122A ZA201200122B (en) | 2009-06-08 | 2012-01-06 | Glucose-regulating polypeptides and methods of making and using same |
Applications Claiming Priority (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US26819309P | 2009-06-08 | 2009-06-08 | |
| US61/268,193 | 2009-06-08 | ||
| US23683609P | 2009-08-25 | 2009-08-25 | |
| US61/236,836 | 2009-08-25 | ||
| US28095509P | 2009-11-10 | 2009-11-10 | |
| US61/280,955 | 2009-11-10 | ||
| USPCT/US2010/023106 | 2010-02-03 | ||
| PCT/US2010/023106 WO2010091122A1 (en) | 2009-02-03 | 2010-02-03 | Extended recombinant polypeptides and compositions comprising same |
| US12/699,761 US8673860B2 (en) | 2009-02-03 | 2010-02-03 | Extended recombinant polypeptides and compositions comprising same |
| US12/699,761 | 2010-02-03 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2010144508A1 true WO2010144508A1 (en) | 2010-12-16 |
Family
ID=43309202
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2010/037855 Ceased WO2010144508A1 (en) | 2009-06-08 | 2010-06-08 | Glucose-regulating polypeptides and methods of making and using same |
Country Status (12)
| Country | Link |
|---|---|
| US (3) | US8957021B2 (https=) |
| EP (1) | EP2440228B8 (https=) |
| JP (1) | JP5839597B2 (https=) |
| CN (1) | CN102481331B (https=) |
| AU (1) | AU2010258898B8 (https=) |
| CA (1) | CA2764108A1 (https=) |
| DK (1) | DK2440228T3 (https=) |
| ES (1) | ES2705249T3 (https=) |
| NZ (1) | NZ596778A (https=) |
| PT (1) | PT2440228T (https=) |
| WO (1) | WO2010144508A1 (https=) |
| ZA (1) | ZA201200122B (https=) |
Cited By (60)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013024052A1 (en) * | 2011-08-12 | 2013-02-21 | Ascendis Pharma A/S | Carrier-linked treprostinil prodrugs |
| WO2013024049A1 (en) * | 2011-08-12 | 2013-02-21 | Ascendis Pharma A/S | Protein carrier-linked prodrugs |
| EP2393828A4 (en) * | 2009-02-03 | 2013-06-26 | Amunix Operating Inc | EXTENDED RECOMBINANT POLYPEPTIDES AND COMPOSITIONS THEREWITH |
| WO2013123457A1 (en) | 2012-02-15 | 2013-08-22 | Biogen Idec Ma Inc. | Recombinant factor viii proteins |
| WO2013185114A2 (en) | 2012-06-08 | 2013-12-12 | Biogen Idec Ma Inc. | Chimeric clotting factors |
| US8703717B2 (en) | 2009-02-03 | 2014-04-22 | Amunix Operating Inc. | Growth hormone polypeptides and methods of making and using same |
| US8716448B2 (en) | 2009-02-03 | 2014-05-06 | Amunix Operating Inc. | Coagulation factor VII compositions and methods of making and using same |
| WO2014127215A1 (en) | 2013-02-15 | 2014-08-21 | Biogen Idec Ma Inc. | Optimized factor viii gene |
| EP2552967A4 (en) * | 2010-04-02 | 2014-10-08 | Amunix Operating Inc | BINDING FUSION PROTEINS, BINDING FUSION PROTEIN MEDICINAL CONJUGATES, XTEN MEDICAMENT CONJUGATES, AND METHOD FOR THEIR PREPARATION AND USE |
| WO2015023891A2 (en) | 2013-08-14 | 2015-02-19 | Biogen Idec Ma Inc. | Factor viii-xten fusions and uses thereof |
| WO2015023894A1 (en) | 2013-08-14 | 2015-02-19 | Biogen Idec Ma Inc. | Recombinant factor viii proteins |
| WO2015106052A1 (en) | 2014-01-10 | 2015-07-16 | Biogen Ma Inc. | Factor viii chimeric proteins and uses thereof |
| US9249211B2 (en) | 2010-04-02 | 2016-02-02 | Amunix Operating Inc. | Binding fusion proteins, binding fusion protein-drug conjugates, XTEN-drug conjugates and methods of making and using same |
| WO2016046301A1 (en) | 2014-09-26 | 2016-03-31 | Bayer Pharma Aktiengesellschaft | Stabilized adrenomedullin derivatives and use thereof |
| WO2016061286A2 (en) | 2014-10-14 | 2016-04-21 | Halozyme, Inc. | Compositions of adenosine deaminase-2 (ada2), variants thereof and methods of using same |
| WO2016065301A1 (en) | 2014-10-23 | 2016-04-28 | Biogen Ma Inc. | Anti-gpiib/iiia antibodies and uses thereof |
| WO2016070050A1 (en) | 2014-10-31 | 2016-05-06 | Biogen Ma Inc. | ANTI-GLYCOPROTEIN IIb/IIIa ANTIBODIES |
| US9486507B2 (en) | 2011-06-10 | 2016-11-08 | Biogen Ma Inc. | Pro-coagulant compounds and methods of use thereof |
| US9540430B2 (en) | 2009-06-08 | 2017-01-10 | Amunix Operating Inc. | Glucose-regulating polypeptides and methods of making and using same |
| WO2017136358A1 (en) | 2016-02-01 | 2017-08-10 | Bioverativ Therapeutics Inc. | Optimized factor viii genes |
| US9849188B2 (en) | 2009-06-08 | 2017-12-26 | Amunix Operating Inc. | Growth hormone polypeptides and methods of making and using same |
| US9938331B2 (en) | 2005-09-27 | 2018-04-10 | Amunix Operating Inc. | Biologically active proteins having increased in vivo and/or in vitro stability |
| WO2018102760A1 (en) | 2016-12-02 | 2018-06-07 | Bioverativ Therapeutics Inc. | Methods of inducing immune tolerance to clotting factors |
| WO2018102743A1 (en) | 2016-12-02 | 2018-06-07 | Bioverativ Therapeutics Inc. | Methods of treating hemophilic arthropathy using chimeric clotting factors |
| WO2018144623A1 (en) | 2017-01-31 | 2018-08-09 | Bioverativ Therapeutics Inc. | Factor ix fusion proteins and methods of making and using same |
| US10138291B2 (en) | 2012-07-11 | 2018-11-27 | Bioverativ Therapeutics Inc. | Factor VIII complex with XTEN and von Willebrand Factor protein, and uses thereof |
| US10172953B2 (en) | 2012-02-27 | 2019-01-08 | Amunix Operating Inc. | XTEN conjugate compositions and methods of making same |
| WO2019032898A1 (en) | 2017-08-09 | 2019-02-14 | Bioverativ Therapeutics Inc. | NUCLEIC ACID MOLECULES AND USES THEREOF |
| US10287564B2 (en) | 2012-06-08 | 2019-05-14 | Bioverativ Therapeutics Inc. | Procoagulant compounds |
| WO2019152692A1 (en) | 2018-02-01 | 2019-08-08 | Bioverativ Therapeutics, Inc. | Use of lentiviral vectors expressing factor viii |
| US10421798B2 (en) | 2012-02-15 | 2019-09-24 | Bioverativ Therapeutics Inc. | Factor VIII compositions and methods of making and using same |
| WO2019191295A1 (en) | 2018-03-28 | 2019-10-03 | Bristol-Myers Squibb Company | Interleukin-2/interleukin-2 receptor alpha fusion proteins and methods of use |
| WO2019222682A1 (en) | 2018-05-18 | 2019-11-21 | Bioverativ Therapeutics Inc. | Methods of treating hemophilia a |
| WO2020010117A2 (en) | 2018-07-03 | 2020-01-09 | Bristol-Myers Squibb Company | Fgf21 formulations |
| WO2020033863A1 (en) | 2018-08-09 | 2020-02-13 | Bioverativ Therapeutics Inc. | Nucleic acid molecules and uses thereof for non-viral gene therapy |
| US10584147B2 (en) | 2013-11-08 | 2020-03-10 | Biovertiv Therapeutics Inc. | Procoagulant fusion compound |
| WO2020092202A2 (en) | 2018-10-29 | 2020-05-07 | Biogen Ma Inc. | Humanized and stabilized fc5 variants for enhancement of blood brain barrier transport |
| WO2020118069A2 (en) | 2018-12-06 | 2020-06-11 | Bioverativ Therapeutics Inc. | Use of lentiviral vectors expressing factor ix |
| US10745680B2 (en) | 2015-08-03 | 2020-08-18 | Bioverativ Therapeutics Inc. | Factor IX fusion proteins and methods of making and using same |
| WO2020254197A1 (en) | 2019-06-18 | 2020-12-24 | Bayer Aktiengesellschaft | Adrenomedullin-analogues for long-term stabilization and their use |
| US10947269B2 (en) | 2013-08-08 | 2021-03-16 | Bioverativ Therapeutics Inc. | Purification of chimeric FVIII molecules |
| WO2021067389A1 (en) | 2019-09-30 | 2021-04-08 | Bioverativ Therapeutics Inc. | Lentiviral vector formulations |
| US11008561B2 (en) | 2014-06-30 | 2021-05-18 | Bioverativ Therapeutics Inc. | Optimized factor IX gene |
| WO2021097186A1 (en) | 2019-11-13 | 2021-05-20 | Amunix Pharmaceuticals, Inc. | Barcoded xten polypeptides and compositions thereof, and methods for making and using the same |
| WO2021262963A1 (en) | 2020-06-24 | 2021-12-30 | Bioverativ Therapeutics Inc. | Methods for the removal of free factor viii from preparations of lentiviral vectors modified to express said protein |
| US11370827B2 (en) | 2012-01-12 | 2022-06-28 | Bioverativ Therapeutics Inc. | Chimeric factor VIII polypeptides and uses thereof |
| EP4129327A1 (en) | 2015-08-28 | 2023-02-08 | Amunix Pharmaceuticals, Inc. | Chimeric polypeptide assembly and methods of making and using the same |
| WO2023028440A2 (en) | 2021-08-23 | 2023-03-02 | Bioverativ Therapeutics Inc. | Baculovirus expression system |
| WO2023028456A1 (en) | 2021-08-23 | 2023-03-02 | Bioverativ Therapeutics Inc. | Optimized factor viii genes |
| WO2023056331A1 (en) | 2021-09-30 | 2023-04-06 | Bioverativ Therapeutics Inc. | Nucleic acids encoding factor viii polypeptides with reduced immunogenicity |
| EP4172179A1 (en) | 2020-06-25 | 2023-05-03 | Amunix Pharmaceuticals, Inc. | Her-2 targeted bispecific compositions and methods for making and using the same |
| US11642398B2 (en) | 2013-03-15 | 2023-05-09 | Bioverativ Therapeutics Inc. | Factor IX polypeptide formulations |
| EP4368194A2 (en) | 2013-06-28 | 2024-05-15 | Bioverativ Therapeutics Inc. | Thrombin cleavable linker with xten and its uses thereof |
| US12060424B2 (en) | 2017-12-21 | 2024-08-13 | Amunix Pharmaceuticals, Inc. | Release segments and binding compositions comprising same |
| WO2024168279A2 (en) | 2023-02-10 | 2024-08-15 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) and methods for making and using the same |
| WO2024220397A1 (en) | 2023-04-17 | 2024-10-24 | Amunix Pharmaceuticals, Inc. | Compositions targeting epidermal growth factor receptor and methods for making and using the same |
| WO2024245946A1 (en) * | 2023-05-26 | 2024-12-05 | Gubra A/S | Secretin-derived glp1r selective agonists |
| WO2025122957A1 (en) | 2023-12-08 | 2025-06-12 | Amunix Pharmaceuticals, Inc. | Protease activatable cytokines and methods for making and using the same |
| WO2026024863A2 (en) | 2024-07-24 | 2026-01-29 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) in combination with androgen receptor antagonists |
| US12617839B2 (en) | 2021-11-05 | 2026-05-05 | Bioverativ Therapeutics Inc. | Factor VIII chimeric proteins and uses thereof |
Families Citing this family (26)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SI3456340T1 (sl) | 2007-01-08 | 2022-08-31 | The Trustees Of The University Of Pennsylvania | Antagonisti receptorja za GLP-1 za uporabo pri zdravljenju prirojenega hiperinsulinizma |
| US20130017997A1 (en) * | 2010-08-19 | 2013-01-17 | Amunix Operating Inc. | Factor VIII Compositions and Methods of Making and Using Same |
| WO2013059213A1 (en) | 2011-10-18 | 2013-04-25 | Amidebio, Llc | Chemically and thermodynamically stable insulin analogues and improved methods for their production |
| WO2013120022A2 (en) * | 2012-02-08 | 2013-08-15 | Seneb Biosciences, Inc. | Treatment of hypoglycemia |
| JP5967631B2 (ja) | 2012-04-27 | 2016-08-10 | 学校法人日本大学 | 上皮及び内皮損傷の治療剤 |
| WO2014172488A2 (en) | 2013-04-17 | 2014-10-23 | AmideBio LLC | Chemically and thermodynamically stable insulin analogues and improved methods for their production |
| US11311519B2 (en) | 2014-05-01 | 2022-04-26 | Eiger Biopharmaceuticals, Inc. | Treatment of hepatitis delta virus infection |
| CA2947587C (en) * | 2014-05-02 | 2022-10-18 | The Research Foundation For The State University Of New York | Islet amyloid polypeptides with improved solubility |
| DE102014112212A1 (de) * | 2014-08-26 | 2016-03-03 | Akesion Gmbh | Rekombinante Fusionsproteine zur Vorbeugung oder Behandlung von Adhäsionen bei Geweben oder Organen |
| LT3297653T (lt) | 2015-05-22 | 2022-01-10 | The Board Of Trustees Of The Leland Stanford Junior University | Postbariatrinės hipoglikemijos gydymas glp-1 antagonistais |
| CN105524147B (zh) * | 2015-10-15 | 2020-06-09 | 中国药科大学 | 重组聚多肽及其应用 |
| CN114835793A (zh) * | 2015-11-16 | 2022-08-02 | Ubi蛋白公司 | 用于延长蛋白质半衰期的方法 |
| CN108697768B (zh) | 2015-12-23 | 2022-07-22 | 约翰霍普金斯大学 | 长效glp-1r激动剂作为神经系统病状和神经退行性病状的治疗方法 |
| CN113456820B (zh) * | 2015-12-29 | 2023-09-08 | 派格生物医药(苏州)股份有限公司 | 包含glp-1受体激动剂和胰高血糖素受体激动剂的组合物及其用途 |
| US10653753B2 (en) | 2016-03-04 | 2020-05-19 | Eiger Biopharmaceuticals, Inc. | Treatment of hyperinsulinemic hypoglycemia with exendin-4 derivatives |
| KR102433503B1 (ko) * | 2016-05-24 | 2022-08-18 | 노보 노르디스크 에이/에스 | Mic-1 화합물 및 이것의 사용 |
| US10738338B2 (en) | 2016-10-18 | 2020-08-11 | The Research Foundation for the State University | Method and composition for biocatalytic protein-oligonucleotide conjugation and protein-oligonucleotide conjugate |
| LT3541366T (lt) | 2016-11-21 | 2025-03-10 | Amylyx Pharmaceuticals, Inc. | Eksendino (9-39) buferiniai preparatai |
| WO2018144671A1 (en) * | 2017-02-01 | 2018-08-09 | The Research Foundation For The State University Of New York | Mutant islet amyloid polypeptides with improved solubility and methods for using the same |
| US10540366B2 (en) | 2017-03-09 | 2020-01-21 | Bank Of America Corporation | Transforming data structures and data objects for migrating data between databases having different schemas |
| CA3097812A1 (en) * | 2018-04-25 | 2019-10-31 | Janssen Pharmaceutica Nv | Thioether cyclic peptide amylin receptor modulators |
| CN114729060B (zh) | 2020-09-30 | 2022-11-25 | 北京质肽生物医药科技有限公司 | 多肽缀合物和使用方法 |
| EP4323413A4 (en) | 2022-03-30 | 2025-10-15 | Beijing Ql Biopharmaceutical Co Ltd | LIQUID PHARMACEUTICAL COMPOSITIONS OF POLYPEPTIDE CONJUGATES AND METHODS OF USE THEREOF |
| WO2024102733A2 (en) * | 2022-11-07 | 2024-05-16 | Ubiquitx | Sequence-based framework to design peptide-guided degraders |
| WO2025098416A1 (zh) * | 2023-11-06 | 2025-05-15 | 甘李药业股份有限公司 | 用于减肥的glp-1化合物 |
| CN118955627B (zh) * | 2024-10-17 | 2025-02-07 | 山东华涛食品有限公司 | 一种混合型抑制α-葡萄糖苷酶活性的甘薯肽组合物 |
Citations (71)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3992518A (en) | 1974-10-24 | 1976-11-16 | G. D. Searle & Co. | Method for making a microsealed delivery device |
| US4088864A (en) | 1974-11-18 | 1978-05-09 | Alza Corporation | Process for forming outlet passageways in pills using a laser |
| US4200098A (en) | 1978-10-23 | 1980-04-29 | Alza Corporation | Osmotic system with distribution zone for dispensing beneficial agent |
| US4284444A (en) | 1977-08-01 | 1981-08-18 | Herculite Protective Fabrics Corporation | Activated polymer materials and process for making same |
| EP0036776A2 (en) | 1980-03-24 | 1981-09-30 | Genentech, Inc. | A method of creating an expression plasmid |
| US4398908A (en) | 1980-11-28 | 1983-08-16 | Siposs George G | Insulin delivery system |
| US4435173A (en) | 1982-03-05 | 1984-03-06 | Delta Medical Industries | Variable rate syringe pump for insulin delivery |
| EP0139383A1 (en) | 1983-08-16 | 1985-05-02 | Zymogenetics, Inc. | Method for expressing foreign genes in schizosaccharomyces pombe and the use in therapeutic formulations of the products, DNA constructs and transformant strains of schizosaccharomyces pombe usable in such method and their preparation |
| EP0183070A2 (en) | 1984-10-30 | 1986-06-04 | Phillips Petroleum Company | Transformation of yeasts of the genus pichia |
| US4684479A (en) | 1985-08-14 | 1987-08-04 | Arrigo Joseph S D | Surfactant mixtures, stable gas-in-liquid emulsions, and methods for the production of such emulsions from said mixtures |
| EP0244234A2 (en) | 1986-04-30 | 1987-11-04 | Alko Group Ltd. | Transformation of trichoderma |
| US4826763A (en) | 1985-01-22 | 1989-05-02 | Novo Industri A/S | Process for preparing glucagon or fragments or derivatives thereof in yeast |
| US4861800A (en) | 1987-08-18 | 1989-08-29 | Buyske Donald A | Method for administering the drug deprenyl so as to minimize the danger of side effects |
| WO1989009051A1 (en) | 1988-03-29 | 1989-10-05 | Sandoz Ag | Deprenyl for systemic transdermal administration |
| US4933185A (en) | 1986-09-24 | 1990-06-12 | Massachusetts Institute Of Technology | System for controlled release of biologically active compounds |
| US4943529A (en) | 1982-05-19 | 1990-07-24 | Gist-Brocades Nv | Kluyveromyces as a host strain |
| EP0394538A1 (en) | 1989-04-28 | 1990-10-31 | Rhein Biotech Gesellschaft Für Neue Biotechnologische Prozesse Und Produkte Mbh | A yeast cell of the genus schwanniomyces |
| US4976696A (en) | 1987-08-10 | 1990-12-11 | Becton, Dickinson And Company | Syringe pump and the like for delivering medication |
| EP0402226A1 (en) | 1989-06-06 | 1990-12-12 | Institut National De La Recherche Agronomique | Transformation vectors for yeast yarrowia |
| WO1991000357A1 (fr) | 1989-06-30 | 1991-01-10 | Cayla | Nouvelle souche et ses mutants de champignons filamenteux, procede de production de proteines recombinantes a l'aide de ladite souche et souches et proteines obtenues selon ce procede |
| US4988337A (en) | 1988-08-10 | 1991-01-29 | Terumo Kabushiki Kaisha | Syringe pump apparatus |
| US5017378A (en) | 1989-05-01 | 1991-05-21 | The University Of Virginia Alumni Patents Foundation | Intraorgan injection of biologically active compounds contained in slow-release microcapsules or microspheres |
| US5118666A (en) | 1986-05-05 | 1992-06-02 | The General Hospital Corporation | Insulinotropic hormone |
| US5176502A (en) | 1990-04-25 | 1993-01-05 | Becton, Dickinson And Company | Syringe pump and the like for delivering medication |
| US5186938A (en) | 1984-07-24 | 1993-02-16 | Key Pharmaceuticals, Inc. | Adhesive transdermal dosage layer |
| US5215680A (en) | 1990-07-10 | 1993-06-01 | Cavitation-Control Technology, Inc. | Method for the production of medical-grade lipid-coated microbubbles, paramagnetic labeling of such microbubbles and therapeutic uses of microbubbles |
| US5234906A (en) | 1991-01-10 | 1993-08-10 | Amylin Pharmaceuticals, Inc. | Hyperglycemic compositions |
| US5298022A (en) | 1989-05-29 | 1994-03-29 | Amplifon Spa | Wearable artificial pancreas |
| US5318540A (en) | 1990-04-02 | 1994-06-07 | Pharmetrix Corporation | Controlled release infusion device |
| US5364934A (en) | 1991-02-01 | 1994-11-15 | Genentech, Inc. | Plasma carboxypeptidase |
| US5424286A (en) | 1993-05-24 | 1995-06-13 | Eng; John | Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same |
| US5492534A (en) | 1990-04-02 | 1996-02-20 | Pharmetrix Corporation | Controlled release portable pump |
| US5534617A (en) | 1988-10-28 | 1996-07-09 | Genentech, Inc. | Human growth hormone variants having greater affinity for human growth hormone receptor at site 1 |
| US5573776A (en) | 1992-12-02 | 1996-11-12 | Alza Corporation | Oral osmotic device with hydrogel driving member |
| US5660848A (en) | 1994-11-02 | 1997-08-26 | The Population Council, Center For Biomedical Research | Subdermally implantable device |
| US5686411A (en) | 1991-03-08 | 1997-11-11 | Amylin Pharmaceuticals, Inc. | Amylin agonist peptides and uses therefor |
| WO1998052976A1 (en) | 1997-05-21 | 1998-11-26 | Biovation Limited | Method for the production of non-immunogenic proteins |
| US5874104A (en) | 1986-08-21 | 1999-02-23 | Nexstar Pharmaceuticals, Inc. | Treatment of systemic fungal infections with phospholipid particles encapsulating polyene antibiotics |
| US5916588A (en) | 1984-04-12 | 1999-06-29 | The Liposome Company, Inc. | Peptide-containing liposomes, immunogenic liposomes and methods of preparation and use |
| US5965156A (en) | 1987-11-12 | 1999-10-12 | Nexstar Pharmaceuticals, Inc. | Amphotericin B liposome preparation |
| WO2000003317A1 (en) | 1998-07-13 | 2000-01-20 | Metron Designs Ltd. | High resolution pulse width setting from relatively low frequency clocks |
| US6043094A (en) | 1996-10-11 | 2000-03-28 | Sequus Pharmaceuticals, Inc. | Therapeutic liposome composition and method |
| US6056973A (en) | 1996-10-11 | 2000-05-02 | Sequus Pharmaceuticals, Inc. | Therapeutic liposome composition and method of preparation |
| US6110498A (en) | 1996-10-25 | 2000-08-29 | Shire Laboratories, Inc. | Osmotic drug delivery system |
| US6126966A (en) | 1996-08-23 | 2000-10-03 | Sequus Pharmaceuticals, Inc. | Liposomes containing a cisplatin compound |
| US6183770B1 (en) | 1999-04-15 | 2001-02-06 | Acutek International | Carrier patch for the delivery of agents to the skin |
| US6254573B1 (en) | 1998-02-05 | 2001-07-03 | Biosense, Inc. | Intracardiac drug delivery device utilizing spring-loaded mechanism |
| US6294191B1 (en) | 1996-10-15 | 2001-09-25 | The Liposome Company, Inc. | N-acyl phosphatidylethanolamine-mediated liposomal drug delivery |
| US6294201B1 (en) | 1997-10-12 | 2001-09-25 | Bayer Aktiengesellschaft | Osmotic medicament releasing system |
| US6352716B1 (en) | 1984-04-12 | 2002-03-05 | The Liposome Company Inc. | Steroidal liposomes |
| US6352721B1 (en) | 2000-01-14 | 2002-03-05 | Osmotica Corp. | Combined diffusion/osmotic pumping drug delivery system |
| US6361796B1 (en) | 1996-10-25 | 2002-03-26 | Shire Laboratories, Inc. | Soluble form osmotic dose delivery system |
| US6406713B1 (en) | 1987-03-05 | 2002-06-18 | The Liposome Company, Inc. | Methods of preparing low-toxicity drug-lipid complexes |
| US6406632B1 (en) | 1998-04-03 | 2002-06-18 | Symyx Technologies, Inc. | Rapid characterization of polymers |
| WO2002079232A2 (en) | 2001-03-30 | 2002-10-10 | Merck Patent Gmbh | Reducing the immunogenicity of fusion proteins |
| US6534090B2 (en) | 2001-02-02 | 2003-03-18 | Sun Pharmaceutical Advanced Research Centre Limited | Oral osmotic controlled drug delivery system for a sparingly soluble drug |
| US6572585B2 (en) | 2001-07-12 | 2003-06-03 | Soo Bong Choi | Remote-controlled portable automatic syringe device |
| US20030228309A1 (en) | 2000-11-08 | 2003-12-11 | Theodora Salcedo | Antibodies that immunospecifically bind to TRAIL receptors |
| US6713086B2 (en) | 1998-12-18 | 2004-03-30 | Abbott Laboratories | Controlled release formulation of divalproex sodium |
| US6715485B1 (en) | 1999-03-03 | 2004-04-06 | Optinose As | Nasal delivery device |
| US6743211B1 (en) | 1999-11-23 | 2004-06-01 | Georgia Tech Research Corporation | Devices and methods for enhanced microneedle penetration of biological barriers |
| US6759057B1 (en) | 1986-06-12 | 2004-07-06 | The Liposome Company, Inc. | Methods and compositions using liposome-encapsulated non-steroidal anti-inflammatory drugs |
| US6838093B2 (en) | 2001-06-01 | 2005-01-04 | Shire Laboratories, Inc. | System for osmotic delivery of pharmaceutically active agents |
| US6890918B2 (en) | 2001-04-30 | 2005-05-10 | Shire Laboratories, Inc. | Pharmaceutical compositions including ACE/NEP inhibitors and bioavailability enhancers |
| US6945952B2 (en) | 2002-06-25 | 2005-09-20 | Theraject, Inc. | Solid solution perforator for drug delivery and other applications |
| US20060293232A1 (en) * | 2004-02-11 | 2006-12-28 | Amylin Pharmaceuticals, Inc. | Hybrid polypeptides with selectable properties |
| US20070161087A1 (en) * | 2003-05-29 | 2007-07-12 | Wolfgang Glaesner | Glp-1 fusion proteins |
| WO2007103455A2 (en) * | 2006-03-06 | 2007-09-13 | Amunix, Inc. | Genetic packages and uses thereof |
| US20070212703A1 (en) * | 2005-09-27 | 2007-09-13 | Stemmer Willem P | Proteinaceous pharmaceuticals and uses thereof |
| US7294513B2 (en) | 2002-07-24 | 2007-11-13 | Wyatt Technology Corporation | Method and apparatus for characterizing solutions of small particles |
| US20100239554A1 (en) * | 2009-02-03 | 2010-09-23 | Amunix Inc. a Delaware Corporation | Extended recombinant polypeptides and compositions comprising same |
Family Cites Families (50)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5270176A (en) * | 1987-11-20 | 1993-12-14 | Hoechst Aktiengesellschaft | Method for the selective cleavage of fusion proteins with lysostaphin |
| US5599907A (en) * | 1989-05-10 | 1997-02-04 | Somatogen, Inc. | Production and use of multimeric hemoglobins |
| US5554730A (en) * | 1993-03-09 | 1996-09-10 | Middlesex Sciences, Inc. | Method and kit for making a polysaccharide-protein conjugate |
| US7846455B2 (en) * | 1996-07-15 | 2010-12-07 | The United States Of America As Represented By The Department Of Health And Human Services | Attenuated chimeric respiratory syncytial virus |
| CN1304058C (zh) | 1996-03-12 | 2007-03-14 | Pg-Txl有限公司 | 水溶性紫杉醇产品 |
| US6441025B2 (en) * | 1996-03-12 | 2002-08-27 | Pg-Txl Company, L.P. | Water soluble paclitaxel derivatives |
| US6294170B1 (en) * | 1997-08-08 | 2001-09-25 | Amgen Inc. | Composition and method for treating inflammatory diseases |
| AT405516B (de) * | 1997-02-27 | 1999-09-27 | Immuno Ag | Faktor x-analoge mit modifizierter proteasespaltstelle |
| US7090976B2 (en) * | 1999-11-10 | 2006-08-15 | Rigel Pharmaceuticals, Inc. | Methods and compositions comprising Renilla GFP |
| US20030190740A1 (en) * | 1998-10-13 | 2003-10-09 | The University Of Georgia Research Foundation, Inc | Stabilized bioactive peptides and methods of identification, synthesis, and use |
| US7666400B2 (en) * | 2005-04-06 | 2010-02-23 | Ibc Pharmaceuticals, Inc. | PEGylation by the dock and lock (DNL) technique |
| US20030109428A1 (en) * | 1999-12-01 | 2003-06-12 | John Bertin | Novel molecules of the card-related protein family and uses thereof |
| US20050287153A1 (en) * | 2002-06-28 | 2005-12-29 | Genentech, Inc. | Serum albumin binding peptides for tumor targeting |
| EP2213743A1 (en) * | 2000-04-12 | 2010-08-04 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US20030049689A1 (en) * | 2000-12-14 | 2003-03-13 | Cynthia Edwards | Multifunctional polypeptides |
| US20020169125A1 (en) | 2001-03-21 | 2002-11-14 | Cell Therapeutics, Inc. | Recombinant production of polyanionic polymers and uses thereof |
| US20040259780A1 (en) * | 2001-07-30 | 2004-12-23 | Glasebrook Andrew Lawrence | Method for treating diabetes and obesity |
| US7125843B2 (en) * | 2001-10-19 | 2006-10-24 | Neose Technologies, Inc. | Glycoconjugates including more than one peptide |
| US20080167238A1 (en) * | 2001-12-21 | 2008-07-10 | Human Genome Sciences, Inc. | Albumin Fusion Proteins |
| WO2005017149A1 (en) * | 2003-06-03 | 2005-02-24 | Cell Genesys, Inc. | Compositions and methods for enhanced expression of recombinant polypeptides from a single vector using a peptide cleavage site |
| US20050152979A1 (en) | 2003-09-05 | 2005-07-14 | Cell Therapeutics, Inc. | Hydrophobic drug compositions containing reconstitution enhancer |
| BR122019021416A2 (https=) * | 2003-09-19 | 2019-12-21 | ||
| US20050123997A1 (en) * | 2003-10-30 | 2005-06-09 | Lollar John S. | Modified fVIII having reduced immunogenicity through mutagenesis of A2 and C2 epitopes |
| US20050143303A1 (en) | 2003-12-26 | 2005-06-30 | Nastech Pharmaceutical Company Inc. | Intranasal administration of glucose-regulating peptides |
| MXPA06008126A (es) * | 2004-01-14 | 2008-02-14 | Univ Ohio | Metodos para la produccion de peptidos/proteinas en plantas y peptidos/proteinas producidos de este modo. |
| HUE027902T2 (en) * | 2004-02-09 | 2016-11-28 | Human Genome Sciences Inc Corp Service Company | Albumin fusion proteins |
| JP2008507288A (ja) | 2004-07-23 | 2008-03-13 | アクセルロン ファーマ インコーポレーテッド | ActRII受容体ポリペプチド、方法、および組成物 |
| WO2006036834A2 (en) * | 2004-09-24 | 2006-04-06 | Amgen Inc. | MODIFIED Fc MOLECULES |
| BRPI0606934A2 (pt) | 2005-01-25 | 2017-07-11 | Cell Therapeutics Inc | Conjugado de proteína biologicamente ativa, composição, molécula de dna quimérica, vetor, célula, e, métodos para preparar conjugado de proteína biologicamente ativa, e para determinar se um dado conjugado de proteína exibe uma meia-vida de plasma modificada comparada com a meia-vida intrínseca do polipeptídeo biologicamente ativo não conjungado |
| US8263545B2 (en) * | 2005-02-11 | 2012-09-11 | Amylin Pharmaceuticals, Inc. | GIP analog and hybrid polypeptides with selectable properties |
| US7855279B2 (en) | 2005-09-27 | 2010-12-21 | Amunix Operating, Inc. | Unstructured recombinant polymers and uses thereof |
| US7846445B2 (en) * | 2005-09-27 | 2010-12-07 | Amunix Operating, Inc. | Methods for production of unstructured recombinant polymers and uses thereof |
| WO2007073486A2 (en) | 2005-12-20 | 2007-06-28 | Duke University | Methods and compositions for delivering active agents with enhanced pharmacological properties |
| EP1816201A1 (en) | 2006-02-06 | 2007-08-08 | CSL Behring GmbH | Modified coagulation factor VIIa with extended half-life |
| AU2007245190B2 (en) * | 2006-03-31 | 2011-07-21 | Takeda Pharmaceutical Company Limited | Pegylated factor VIII |
| US7939632B2 (en) * | 2006-06-14 | 2011-05-10 | Csl Behring Gmbh | Proteolytically cleavable fusion proteins with high molar specific activity |
| EP1867660A1 (en) * | 2006-06-14 | 2007-12-19 | CSL Behring GmbH | Proteolytically cleavable fusion protein comprising a blood coagulation factor |
| CN101511868B (zh) | 2006-07-24 | 2013-03-06 | 比奥雷克西斯制药公司 | 毒蜥外泌肽融合蛋白 |
| WO2008049711A1 (en) | 2006-10-27 | 2008-05-02 | Novo Nordisk A/S | Peptide extended insulins |
| CA2673459C (en) | 2006-12-22 | 2016-09-13 | Stefan Schulte | Modified coagulation factors with prolonged in vivo half-life |
| EP2114458B1 (en) * | 2006-12-27 | 2014-02-26 | Nektar Therapeutics | Von willebrand factor- and factor viii-polymer conjugates having a releasable linkage |
| SI2173890T1 (sl) | 2007-06-21 | 2011-06-30 | Univ Muenchen Tech | Biološko aktivni proteini, ki imajo povečano in vivo in/ali in vitro stabilnost |
| JP2010536341A (ja) * | 2007-08-15 | 2010-12-02 | アムニクス, インコーポレイテッド | 生物学的に活性なポリペプチドの特性を改変するための組成物および方法 |
| CN102131516B (zh) | 2008-06-27 | 2016-03-16 | 杜克大学 | 包含弹性蛋白样肽的治疗剂 |
| WO2010144508A1 (en) | 2009-06-08 | 2010-12-16 | Amunix Operating Inc. | Glucose-regulating polypeptides and methods of making and using same |
| KR101813727B1 (ko) | 2009-06-08 | 2018-01-02 | 아뮤닉스 오퍼레이팅 인코포레이티드 | 성장 호르몬 폴리펩타이드 및 이를 제조하고 사용하는 방법 |
| CA2771999A1 (en) * | 2009-08-24 | 2011-03-10 | Amunix Operating Inc. | Coagulation factor vii compositions and methods of making and using same |
| WO2011084808A2 (en) * | 2009-12-21 | 2011-07-14 | Amunix Operating Inc. | Bifunctional polypeptide compositions and methods for treatment of metabolic and cardiovascular diseases |
| US8557961B2 (en) * | 2010-04-02 | 2013-10-15 | Amunix Operating Inc. | Alpha 1-antitrypsin compositions and methods of making and using same |
| ES2993140T3 (en) * | 2010-04-02 | 2024-12-23 | Amunix Pharmaceuticals Inc | Binding fusion proteins, binding fusion protein-drug conjugates, xten-drug conjugates and methods of making and using same |
-
2010
- 2010-06-08 WO PCT/US2010/037855 patent/WO2010144508A1/en not_active Ceased
- 2010-06-08 JP JP2012515082A patent/JP5839597B2/ja active Active
- 2010-06-08 CN CN201080035271.0A patent/CN102481331B/zh active Active
- 2010-06-08 NZ NZ596778A patent/NZ596778A/xx unknown
- 2010-06-08 PT PT10786730T patent/PT2440228T/pt unknown
- 2010-06-08 US US12/796,650 patent/US8957021B2/en active Active
- 2010-06-08 CA CA2764108A patent/CA2764108A1/en not_active Abandoned
- 2010-06-08 AU AU2010258898A patent/AU2010258898B8/en active Active
- 2010-06-08 EP EP10786730.1A patent/EP2440228B8/en active Active
- 2010-06-08 ES ES10786730T patent/ES2705249T3/es active Active
- 2010-06-08 DK DK10786730.1T patent/DK2440228T3/en active
-
2012
- 2012-01-06 ZA ZA2012/00122A patent/ZA201200122B/en unknown
-
2014
- 2014-12-05 US US14/562,406 patent/US9540430B2/en active Active
-
2016
- 2016-11-30 US US15/365,792 patent/US10000543B2/en active Active
Patent Citations (78)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3992518A (en) | 1974-10-24 | 1976-11-16 | G. D. Searle & Co. | Method for making a microsealed delivery device |
| US4088864A (en) | 1974-11-18 | 1978-05-09 | Alza Corporation | Process for forming outlet passageways in pills using a laser |
| US4284444A (en) | 1977-08-01 | 1981-08-18 | Herculite Protective Fabrics Corporation | Activated polymer materials and process for making same |
| US4200098A (en) | 1978-10-23 | 1980-04-29 | Alza Corporation | Osmotic system with distribution zone for dispensing beneficial agent |
| EP0036776A2 (en) | 1980-03-24 | 1981-09-30 | Genentech, Inc. | A method of creating an expression plasmid |
| US4398908A (en) | 1980-11-28 | 1983-08-16 | Siposs George G | Insulin delivery system |
| US4435173A (en) | 1982-03-05 | 1984-03-06 | Delta Medical Industries | Variable rate syringe pump for insulin delivery |
| US4943529A (en) | 1982-05-19 | 1990-07-24 | Gist-Brocades Nv | Kluyveromyces as a host strain |
| EP0139383A1 (en) | 1983-08-16 | 1985-05-02 | Zymogenetics, Inc. | Method for expressing foreign genes in schizosaccharomyces pombe and the use in therapeutic formulations of the products, DNA constructs and transformant strains of schizosaccharomyces pombe usable in such method and their preparation |
| US5916588A (en) | 1984-04-12 | 1999-06-29 | The Liposome Company, Inc. | Peptide-containing liposomes, immunogenic liposomes and methods of preparation and use |
| US6352716B1 (en) | 1984-04-12 | 2002-03-05 | The Liposome Company Inc. | Steroidal liposomes |
| US5186938A (en) | 1984-07-24 | 1993-02-16 | Key Pharmaceuticals, Inc. | Adhesive transdermal dosage layer |
| EP0183070A2 (en) | 1984-10-30 | 1986-06-04 | Phillips Petroleum Company | Transformation of yeasts of the genus pichia |
| US4826763A (en) | 1985-01-22 | 1989-05-02 | Novo Industri A/S | Process for preparing glucagon or fragments or derivatives thereof in yeast |
| US4684479A (en) | 1985-08-14 | 1987-08-04 | Arrigo Joseph S D | Surfactant mixtures, stable gas-in-liquid emulsions, and methods for the production of such emulsions from said mixtures |
| EP0244234A2 (en) | 1986-04-30 | 1987-11-04 | Alko Group Ltd. | Transformation of trichoderma |
| US5118666A (en) | 1986-05-05 | 1992-06-02 | The General Hospital Corporation | Insulinotropic hormone |
| US6759057B1 (en) | 1986-06-12 | 2004-07-06 | The Liposome Company, Inc. | Methods and compositions using liposome-encapsulated non-steroidal anti-inflammatory drugs |
| US5874104A (en) | 1986-08-21 | 1999-02-23 | Nexstar Pharmaceuticals, Inc. | Treatment of systemic fungal infections with phospholipid particles encapsulating polyene antibiotics |
| US4933185A (en) | 1986-09-24 | 1990-06-12 | Massachusetts Institute Of Technology | System for controlled release of biologically active compounds |
| US6406713B1 (en) | 1987-03-05 | 2002-06-18 | The Liposome Company, Inc. | Methods of preparing low-toxicity drug-lipid complexes |
| US4976696A (en) | 1987-08-10 | 1990-12-11 | Becton, Dickinson And Company | Syringe pump and the like for delivering medication |
| US4861800A (en) | 1987-08-18 | 1989-08-29 | Buyske Donald A | Method for administering the drug deprenyl so as to minimize the danger of side effects |
| US5965156A (en) | 1987-11-12 | 1999-10-12 | Nexstar Pharmaceuticals, Inc. | Amphotericin B liposome preparation |
| WO1989009051A1 (en) | 1988-03-29 | 1989-10-05 | Sandoz Ag | Deprenyl for systemic transdermal administration |
| US4988337A (en) | 1988-08-10 | 1991-01-29 | Terumo Kabushiki Kaisha | Syringe pump apparatus |
| US5534617A (en) | 1988-10-28 | 1996-07-09 | Genentech, Inc. | Human growth hormone variants having greater affinity for human growth hormone receptor at site 1 |
| EP0394538A1 (en) | 1989-04-28 | 1990-10-31 | Rhein Biotech Gesellschaft Für Neue Biotechnologische Prozesse Und Produkte Mbh | A yeast cell of the genus schwanniomyces |
| US5017378A (en) | 1989-05-01 | 1991-05-21 | The University Of Virginia Alumni Patents Foundation | Intraorgan injection of biologically active compounds contained in slow-release microcapsules or microspheres |
| US5298022A (en) | 1989-05-29 | 1994-03-29 | Amplifon Spa | Wearable artificial pancreas |
| EP0402226A1 (en) | 1989-06-06 | 1990-12-12 | Institut National De La Recherche Agronomique | Transformation vectors for yeast yarrowia |
| WO1991000357A1 (fr) | 1989-06-30 | 1991-01-10 | Cayla | Nouvelle souche et ses mutants de champignons filamenteux, procede de production de proteines recombinantes a l'aide de ladite souche et souches et proteines obtenues selon ce procede |
| US5492534A (en) | 1990-04-02 | 1996-02-20 | Pharmetrix Corporation | Controlled release portable pump |
| US5318540A (en) | 1990-04-02 | 1994-06-07 | Pharmetrix Corporation | Controlled release infusion device |
| US5176502A (en) | 1990-04-25 | 1993-01-05 | Becton, Dickinson And Company | Syringe pump and the like for delivering medication |
| US5215680A (en) | 1990-07-10 | 1993-06-01 | Cavitation-Control Technology, Inc. | Method for the production of medical-grade lipid-coated microbubbles, paramagnetic labeling of such microbubbles and therapeutic uses of microbubbles |
| US5234906A (en) | 1991-01-10 | 1993-08-10 | Amylin Pharmaceuticals, Inc. | Hyperglycemic compositions |
| US5364934A (en) | 1991-02-01 | 1994-11-15 | Genentech, Inc. | Plasma carboxypeptidase |
| US7271238B2 (en) | 1991-03-08 | 2007-09-18 | Amylin Pharmaceuticals, Inc. | Amylin agonist peptides and uses therefor |
| US5686411A (en) | 1991-03-08 | 1997-11-11 | Amylin Pharmaceuticals, Inc. | Amylin agonist peptides and uses therefor |
| US5573776A (en) | 1992-12-02 | 1996-11-12 | Alza Corporation | Oral osmotic device with hydrogel driving member |
| US5424286A (en) | 1993-05-24 | 1995-06-13 | Eng; John | Exendin-3 and exendin-4 polypeptides, and pharmaceutical compositions comprising same |
| US5756115A (en) | 1994-11-02 | 1998-05-26 | The Population Coucil, Center For Biomedical Research | Contraceptive method using a subdermally implantable device |
| US5660848A (en) | 1994-11-02 | 1997-08-26 | The Population Council, Center For Biomedical Research | Subdermally implantable device |
| US6126966A (en) | 1996-08-23 | 2000-10-03 | Sequus Pharmaceuticals, Inc. | Liposomes containing a cisplatin compound |
| US6043094A (en) | 1996-10-11 | 2000-03-28 | Sequus Pharmaceuticals, Inc. | Therapeutic liposome composition and method |
| US6316024B1 (en) | 1996-10-11 | 2001-11-13 | Sequus Pharmaceuticals, Inc. | Therapeutic liposome composition and method of preparation |
| US6056973A (en) | 1996-10-11 | 2000-05-02 | Sequus Pharmaceuticals, Inc. | Therapeutic liposome composition and method of preparation |
| US6294191B1 (en) | 1996-10-15 | 2001-09-25 | The Liposome Company, Inc. | N-acyl phosphatidylethanolamine-mediated liposomal drug delivery |
| US6361796B1 (en) | 1996-10-25 | 2002-03-26 | Shire Laboratories, Inc. | Soluble form osmotic dose delivery system |
| US6814979B2 (en) | 1996-10-25 | 2004-11-09 | Shire Laboratories, Inc. | Osmotic drug delivery system |
| US6284276B1 (en) | 1996-10-25 | 2001-09-04 | Shire Laboratories, Inc. | Soluble form osmotic dose delivery system |
| US6514532B2 (en) | 1996-10-25 | 2003-02-04 | Shire Laboratories, Inc. | Soluble form osmotic dose delivery system |
| US6110498A (en) | 1996-10-25 | 2000-08-29 | Shire Laboratories, Inc. | Osmotic drug delivery system |
| WO1998052976A1 (en) | 1997-05-21 | 1998-11-26 | Biovation Limited | Method for the production of non-immunogenic proteins |
| US6294201B1 (en) | 1997-10-12 | 2001-09-25 | Bayer Aktiengesellschaft | Osmotic medicament releasing system |
| US6309370B1 (en) | 1998-02-05 | 2001-10-30 | Biosense, Inc. | Intracardiac drug delivery |
| US6254573B1 (en) | 1998-02-05 | 2001-07-03 | Biosense, Inc. | Intracardiac drug delivery device utilizing spring-loaded mechanism |
| US6406632B1 (en) | 1998-04-03 | 2002-06-18 | Symyx Technologies, Inc. | Rapid characterization of polymers |
| WO2000003317A1 (en) | 1998-07-13 | 2000-01-20 | Metron Designs Ltd. | High resolution pulse width setting from relatively low frequency clocks |
| US6713086B2 (en) | 1998-12-18 | 2004-03-30 | Abbott Laboratories | Controlled release formulation of divalproex sodium |
| US6715485B1 (en) | 1999-03-03 | 2004-04-06 | Optinose As | Nasal delivery device |
| US6183770B1 (en) | 1999-04-15 | 2001-02-06 | Acutek International | Carrier patch for the delivery of agents to the skin |
| US6743211B1 (en) | 1999-11-23 | 2004-06-01 | Georgia Tech Research Corporation | Devices and methods for enhanced microneedle penetration of biological barriers |
| US6352721B1 (en) | 2000-01-14 | 2002-03-05 | Osmotica Corp. | Combined diffusion/osmotic pumping drug delivery system |
| US20030228309A1 (en) | 2000-11-08 | 2003-12-11 | Theodora Salcedo | Antibodies that immunospecifically bind to TRAIL receptors |
| US6534090B2 (en) | 2001-02-02 | 2003-03-18 | Sun Pharmaceutical Advanced Research Centre Limited | Oral osmotic controlled drug delivery system for a sparingly soluble drug |
| WO2002079232A2 (en) | 2001-03-30 | 2002-10-10 | Merck Patent Gmbh | Reducing the immunogenicity of fusion proteins |
| US6890918B2 (en) | 2001-04-30 | 2005-05-10 | Shire Laboratories, Inc. | Pharmaceutical compositions including ACE/NEP inhibitors and bioavailability enhancers |
| US6838093B2 (en) | 2001-06-01 | 2005-01-04 | Shire Laboratories, Inc. | System for osmotic delivery of pharmaceutically active agents |
| US6572585B2 (en) | 2001-07-12 | 2003-06-03 | Soo Bong Choi | Remote-controlled portable automatic syringe device |
| US6945952B2 (en) | 2002-06-25 | 2005-09-20 | Theraject, Inc. | Solid solution perforator for drug delivery and other applications |
| US7294513B2 (en) | 2002-07-24 | 2007-11-13 | Wyatt Technology Corporation | Method and apparatus for characterizing solutions of small particles |
| US20070161087A1 (en) * | 2003-05-29 | 2007-07-12 | Wolfgang Glaesner | Glp-1 fusion proteins |
| US20060293232A1 (en) * | 2004-02-11 | 2006-12-28 | Amylin Pharmaceuticals, Inc. | Hybrid polypeptides with selectable properties |
| US20070212703A1 (en) * | 2005-09-27 | 2007-09-13 | Stemmer Willem P | Proteinaceous pharmaceuticals and uses thereof |
| WO2007103455A2 (en) * | 2006-03-06 | 2007-09-13 | Amunix, Inc. | Genetic packages and uses thereof |
| US20100239554A1 (en) * | 2009-02-03 | 2010-09-23 | Amunix Inc. a Delaware Corporation | Extended recombinant polypeptides and compositions comprising same |
Non-Patent Citations (69)
| Title |
|---|
| "Goodman & Gilman's The Pharmacological Basis of Therapeutics, 11th ed", 2005, MCGRAW-HILL |
| "Methods in Enzymology", ACADEMIC PRESS |
| "Uniprot", Database accession no. P08246 |
| "Uniprot", Database accession no. P39900 |
| AMAU ET AL., PROT EXPR AND PURIF, vol. 48, 2006, pages 1 - 13 |
| ARNAU ET AL., PROTEIN EXPRESSION AND PURIFICATION, vol. 48, 2006, pages 1 - 13 |
| BACHMANN MF ET AL., EUR J IMMUNOL., vol. 25, no. 12, 1995, pages 3445 - 3451 |
| BALLANCE ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 112, 1983, pages 284 - 289 |
| BARON ET AL., CRIT. REV. BIOTECHNOL., vol. 10, 1990, pages 179 - 90 |
| BEACH; NURSE, NATURE, vol. 290, 1981, pages 140 |
| BELOW ET AL., J. CHROMATOGR. A., vol. 679, 1994, pages 67 - 83 |
| BIOCONJUGATE CHEM., vol. 16, 2005, pages 377 - 382 |
| BOND, A., PROC (BAYL UNIV MED CENT), vol. 19, no. 3, - 2006, pages 281 - 284 |
| C. ANTHONY, THE BIOCHEMISTRY OF METHYLOTROPHS, vol. 269, 1982 |
| CALICETI: "Pharmacokinetic and biodistribution properties of poly(ethylene glycol)-protein conjugates", ADV DRUG DELIV REV, vol. 55, 2003, pages 1261 - 1277, XP003001867, DOI: doi:10.1016/S0169-409X(03)00108-X |
| CASE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 76, 1979, pages 5259 - 5263 |
| CHANG ET AL., NATURE, vol. 275, 1978, pages 615 |
| CHOU, P. Y. ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 222 - 45 |
| DEBOER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 80, 1983, pages 21 - 25 |
| DHALLUIN, C. ET AL., BIOCONJUG CHEM, vol. 16, 2005, pages 504 - 17 |
| EISTRUP C: "Glucagon produced by recombinant DNA technology: repeated dose toxicity studies, intravenous administration to CD rats and beagle dogs for four weeks", PHARMACOL TOXICOL, vol. 73, no. 2, August 1993 (1993-08-01), pages 103 - 108 |
| ENGELS ET AL., AGNEW. CHEM. INT. ED. ENGL., vol. 28, 1989, pages 716 - 734 |
| F. M. AUSUBEL, ET AL.: "Current protocols in molecular biology", 1987 |
| FLEER ET AL., BIO/TECHNOLOGY, vol. 9, 1991, pages 968 - 975 |
| FRANZ ET AL., J. INVEST. DERM., vol. 64, 1975, pages 194 - 195 |
| FRESHNEY, R.I.: "Culture of Animal Cells: A Manual of Basic Technique, 4th ed", 2000, JOHN WILEY & SONS |
| GARNIER J; GIBRAT JF; ROBSON B.: "GOR method for predicting protein secondary structure from amino acid sequence", METHODS ENZYMOL, vol. 266, 1996, pages 540 - 553 |
| GEORGE ET AL., PROTEIN ENGINEERING, vol. 15, 2003, pages 871 - 879 |
| GOEDDEL ET AL., NATURE, vol. 281, 1979, pages 544 |
| GOEDDEL, NUCLEIC ACIDS RES., vol. 8, 1980, pages 4057 |
| GOKE ET AL., J. BIOL. CHEM ., vol. 268, 1993, pages 19650 - 55 |
| GOKE ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 19650 - 55 |
| GOODMAN; GILMAN: "The Pharmacological Basis of Therapeutics", 2005, MCGRAW-HILL |
| GUSTAFSSON, C. ET AL., TRENDS BIOTECHNOL, vol. 22, 2004, pages 346 - 53 |
| HARLOW, E. AND LANE, D.: "Antibodies, a laboratory manual", 1988, COLD SPRING HARBOR LABORATORY |
| HOPP, TP ET AL., PROC NATL ACAD SCI U S A, vol. 78, 1981, pages 3824 |
| HSU, C. T. ET AL., CANCER RES, vol. 60, 2000, pages 3701 - 5 |
| JOHANSSON, J. ET AL., VACCINE, vol. 25, 2007, pages 1676 - 82 |
| KELLY; HYNES, EMBO J., vol. 4, 1985, pages 475 - 479 |
| KODA ET AL., LANCET, vol. 339, 1992, pages 1179 - 1180 |
| KOHN, J. E. ET AL.: "Random-coil behavior and the dimensions of chemically unfolded proteins.", PNAS., vol. 101, no. 34, 24 August 2004 (2004-08-24), pages 12491 - 12496, XP008157744 * |
| KUBETZKO, S. ET AL., MOL PHARMACOL, vol. 68, 2005, pages 1439 - 54 |
| LEVITT, M ET AL., J MOL BIOL, vol. 104, 1976, pages 59 |
| LOUVENCOURT ET AL., J. BACTERIOL., vol. 737, 1983 |
| M.J. MACPHERSON, B.D. HAMES AND G.R. TAYLOR: "PCR 2: a practical approach", 1995, OXFORD UNIVERSITY PRESS |
| MANDEL ET AL., J MOL. BIOL., vol. 53, 1970, pages 154 |
| NEEDLEMAN; WUNSCH, JOURNAL OF MOLECULAR BIOLOGY, vol. 48, 1970, pages 443 - 453 |
| OSOL A.: "Remington's Pharmaceutical Sciences, 16th ed.", 1980 |
| RANDAL J. KAUFMAN, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, vol. 16, 1991, pages 12 |
| RANDALL J. KAUFMAN ET AL.: "Current Protocols in Molecular Biology", vol. 16.12, 1991, WILEY |
| RAWLINGS N.D. ET AL., NUCLEIC ACIDS RES., vol. 36, 2008, pages D320 |
| REGULATORY PEPTIDES, vol. 98, 2001, pages 1 - 12 |
| ROBERT K. SCOPES: "Protein Purification: Principles and Practice", 1994, SPRINGER-VERLAG |
| SAMBROOK, J. ET AL.: "Molecular Cloning: A Laboratory Manual, 2nd ed.", vol. 1-3, 1989, COLD SPRING HARBOR PRESS |
| SAMBROOK, J. ET AL.: "Molecular Cloning: A Laboratory Manual, 3rd ed.", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| SMITH ET AL., GENE, vol. 57, 1988, pages 31 - 40 |
| SMITH; WATERMAN, ADVANCES IN APPLIED MATHEMATICS, vol. 2, 1981, pages 482 - 489 |
| SREEKRISHNA ET AL., J. BASIC MICROBIOL., vol. 28, 1988, pages 265 - 278 |
| STICKLER, M. ET AL., J IMMUNOL METHODS, vol. 281, 2003, pages 95 - 108 |
| STURNIOLO, T. ET AL., NAT BIOTECHNOL, vol. 17, 1999, pages 555 |
| STURNIOLO, T. ET AL., NAT BIOTECHNOL, vol. 17, 1999, pages 555 - 61 |
| STURNIOLO, T. ET AL., NATURE BIOTECHNOLOGY, vol. 17, 1999, pages 555 |
| SUMMERS ET AL., VIROLOGY, vol. 84, 1978, pages 390 - 402 |
| THOMAS, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 5201 - 5205 |
| TILBURN ET AL., GENE, vol. 26, 1983, pages 205 - 221 |
| VAN DEN BERG ET AL., BIO/TECHNOLOGY, vol. 8, 1990, pages 135 |
| WANG, B. L. ET AL., J SUBMICROSC CYTOL PATHOL, vol. 30, 1998, pages 503 - 9 |
| YANKAI, Z. ET AL., BIOCHEM BIOPHYS RES COMMUN, vol. 345, 2006, pages 1365 - 71 |
| YELTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 1470 - 1474 |
Cited By (118)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9938331B2 (en) | 2005-09-27 | 2018-04-10 | Amunix Operating Inc. | Biologically active proteins having increased in vivo and/or in vitro stability |
| US12071456B2 (en) | 2009-02-03 | 2024-08-27 | Amunix Pharmaceuticals, Inc. | Extended recombinant polypeptides and compositions comprising same |
| US9168312B2 (en) | 2009-02-03 | 2015-10-27 | Amunix Operating Inc. | Growth hormone polypeptides and methods of making and using same |
| EP3178835A1 (en) * | 2009-02-03 | 2017-06-14 | Amunix Operating Inc. | Extended recombinant polypeptides and compositions comprising same |
| US9926351B2 (en) | 2009-02-03 | 2018-03-27 | Amunix Operating Inc. | Extended recombinant polypeptides and compositions comprising same |
| US8673860B2 (en) | 2009-02-03 | 2014-03-18 | Amunix Operating Inc. | Extended recombinant polypeptides and compositions comprising same |
| US8703717B2 (en) | 2009-02-03 | 2014-04-22 | Amunix Operating Inc. | Growth hormone polypeptides and methods of making and using same |
| US8716448B2 (en) | 2009-02-03 | 2014-05-06 | Amunix Operating Inc. | Coagulation factor VII compositions and methods of making and using same |
| US9371369B2 (en) | 2009-02-03 | 2016-06-21 | Amunix Operating Inc. | Extended recombinant polypeptides and compositions comprising same |
| EP2393828A4 (en) * | 2009-02-03 | 2013-06-26 | Amunix Operating Inc | EXTENDED RECOMBINANT POLYPEPTIDES AND COMPOSITIONS THEREWITH |
| EP3581579A1 (en) * | 2009-02-03 | 2019-12-18 | Amunix Pharmaceuticals, Inc. | Extended recombinant polypeptides and compositions comprising same |
| US10961287B2 (en) | 2009-02-03 | 2021-03-30 | Amunix Pharmaceuticals, Inc | Extended recombinant polypeptides and compositions comprising same |
| US9849188B2 (en) | 2009-06-08 | 2017-12-26 | Amunix Operating Inc. | Growth hormone polypeptides and methods of making and using same |
| US10000543B2 (en) | 2009-06-08 | 2018-06-19 | Amunix Operating Inc. | Glucose-regulating polypeptides and methods of making and using same |
| US9540430B2 (en) | 2009-06-08 | 2017-01-10 | Amunix Operating Inc. | Glucose-regulating polypeptides and methods of making and using same |
| US9062299B2 (en) | 2009-08-24 | 2015-06-23 | Amunix Operating Inc. | Coagulation factor IX compositions and methods of making and using same |
| US9758776B2 (en) | 2009-08-24 | 2017-09-12 | Amunix Operating Inc. | Coagulation factor IX compositions and methods of making and using same |
| US9376672B2 (en) | 2009-08-24 | 2016-06-28 | Amunix Operating Inc. | Coagulation factor IX compositions and methods of making and using same |
| EP2552967A4 (en) * | 2010-04-02 | 2014-10-08 | Amunix Operating Inc | BINDING FUSION PROTEINS, BINDING FUSION PROTEIN MEDICINAL CONJUGATES, XTEN MEDICAMENT CONJUGATES, AND METHOD FOR THEIR PREPARATION AND USE |
| EP4450523A3 (en) * | 2010-04-02 | 2025-03-12 | Amunix Pharmaceuticals, Inc. | Binding fusion proteins, binding fusion protein-drug conjugates, xten-drug conjugates and methods of making and using same |
| US10870874B2 (en) | 2010-04-02 | 2020-12-22 | Amunix Pharmaceuticals, Inc. | Binding fusion proteins, binding fusion protein-drug conjugates, XTEN-drug conjugates and methods of making and using same |
| US9249211B2 (en) | 2010-04-02 | 2016-02-02 | Amunix Operating Inc. | Binding fusion proteins, binding fusion protein-drug conjugates, XTEN-drug conjugates and methods of making and using same |
| US9976166B2 (en) | 2010-04-02 | 2018-05-22 | Amunix Operating Inc. | Binding fusion proteins, binding fusion protein-drug conjugates, XTEN-drug conjugates and methods of making and using same |
| US9486507B2 (en) | 2011-06-10 | 2016-11-08 | Biogen Ma Inc. | Pro-coagulant compounds and methods of use thereof |
| WO2013024052A1 (en) * | 2011-08-12 | 2013-02-21 | Ascendis Pharma A/S | Carrier-linked treprostinil prodrugs |
| WO2013024049A1 (en) * | 2011-08-12 | 2013-02-21 | Ascendis Pharma A/S | Protein carrier-linked prodrugs |
| US9561287B2 (en) | 2011-08-12 | 2017-02-07 | Ascendis Pharma A/S | Carrier-linked treprostinil prodrugs |
| US10729778B2 (en) | 2011-08-12 | 2020-08-04 | Ascendis Pharma A/S | Carrier-linked treprostinil prodrugs |
| US11370827B2 (en) | 2012-01-12 | 2022-06-28 | Bioverativ Therapeutics Inc. | Chimeric factor VIII polypeptides and uses thereof |
| EP3549953A1 (en) | 2012-02-15 | 2019-10-09 | Bioverativ Therapeutics Inc. | Recombinant factor viii proteins |
| WO2013123457A1 (en) | 2012-02-15 | 2013-08-22 | Biogen Idec Ma Inc. | Recombinant factor viii proteins |
| US11685771B2 (en) | 2012-02-15 | 2023-06-27 | Bioverativ Therapeutics Inc. | Recombinant factor VIII proteins |
| US10421798B2 (en) | 2012-02-15 | 2019-09-24 | Bioverativ Therapeutics Inc. | Factor VIII compositions and methods of making and using same |
| US10370430B2 (en) | 2012-02-15 | 2019-08-06 | Bioverativ Therapeutics Inc. | Recombinant factor VIII proteins |
| US10172953B2 (en) | 2012-02-27 | 2019-01-08 | Amunix Operating Inc. | XTEN conjugate compositions and methods of making same |
| US10953073B2 (en) | 2012-02-27 | 2021-03-23 | Amunix Pharmaceuticals, Inc. | XTEN conjugate compositions and methods of making same |
| EP3693000A1 (en) | 2012-06-08 | 2020-08-12 | Bioverativ Therapeutics Inc. | Procoagulant compounds |
| US10202595B2 (en) | 2012-06-08 | 2019-02-12 | Bioverativ Therapeutics Inc. | Chimeric clotting factors |
| US11168316B2 (en) | 2012-06-08 | 2021-11-09 | Bioverativ Therapeutics, Inc. | Chimeric clotting factors |
| US10287564B2 (en) | 2012-06-08 | 2019-05-14 | Bioverativ Therapeutics Inc. | Procoagulant compounds |
| WO2013185114A2 (en) | 2012-06-08 | 2013-12-12 | Biogen Idec Ma Inc. | Chimeric clotting factors |
| US11261437B2 (en) | 2012-06-08 | 2022-03-01 | Bioverativ Therapeutics Inc. | Procoagulant compounds |
| EP4079316A1 (en) | 2012-06-08 | 2022-10-26 | Bioverativ Therapeutics Inc. | Procoagulant compounds |
| EP4269431A1 (en) | 2012-07-11 | 2023-11-01 | Bioverativ Therapeutics Inc. | Factor viii complex with xten and von willebrand factor protein, and uses thereof |
| US10138291B2 (en) | 2012-07-11 | 2018-11-27 | Bioverativ Therapeutics Inc. | Factor VIII complex with XTEN and von Willebrand Factor protein, and uses thereof |
| EP3674410A1 (en) | 2012-07-11 | 2020-07-01 | Bioverativ Therapeutics Inc. | Factor viii complex with xten and von willebrand factor protein, and uses thereof |
| US11091534B2 (en) | 2012-07-11 | 2021-08-17 | Bioverativ Therapeutics Inc. | Factor VIII complex with XTEN and von Willebrand Factor protein, and uses thereof |
| US11787851B2 (en) | 2013-02-15 | 2023-10-17 | Bioverativ Therapeutics Inc. | Optimized factor VIII gene |
| EP4223772A2 (en) | 2013-02-15 | 2023-08-09 | Bioverativ Therapeutics Inc. | Optimized factor viii gene |
| EP3889173A1 (en) | 2013-02-15 | 2021-10-06 | Bioverativ Therapeutics Inc. | Optimized factor viii gene |
| WO2014127215A1 (en) | 2013-02-15 | 2014-08-21 | Biogen Idec Ma Inc. | Optimized factor viii gene |
| US10370431B2 (en) | 2013-02-15 | 2019-08-06 | Bioverativ Therapeutics Inc. | Optimized factor VIII gene |
| US11642398B2 (en) | 2013-03-15 | 2023-05-09 | Bioverativ Therapeutics Inc. | Factor IX polypeptide formulations |
| EP4368194A2 (en) | 2013-06-28 | 2024-05-15 | Bioverativ Therapeutics Inc. | Thrombin cleavable linker with xten and its uses thereof |
| US12570691B2 (en) | 2013-08-08 | 2026-03-10 | Bioverativ Therapeutics Inc. | Purification of chimeric FVIII molecules |
| EP3875106A1 (en) | 2013-08-08 | 2021-09-08 | Bioverativ Therapeutics Inc. | Purification of chimeric fviii molecules |
| US10947269B2 (en) | 2013-08-08 | 2021-03-16 | Bioverativ Therapeutics Inc. | Purification of chimeric FVIII molecules |
| US10548953B2 (en) | 2013-08-14 | 2020-02-04 | Bioverativ Therapeutics Inc. | Factor VIII-XTEN fusions and uses thereof |
| WO2015023894A1 (en) | 2013-08-14 | 2015-02-19 | Biogen Idec Ma Inc. | Recombinant factor viii proteins |
| EP4108254A1 (en) | 2013-08-14 | 2022-12-28 | Bioverativ Therapeutics Inc. | Recombinant factor viii proteins |
| WO2015023891A2 (en) | 2013-08-14 | 2015-02-19 | Biogen Idec Ma Inc. | Factor viii-xten fusions and uses thereof |
| US10584147B2 (en) | 2013-11-08 | 2020-03-10 | Biovertiv Therapeutics Inc. | Procoagulant fusion compound |
| WO2015106052A1 (en) | 2014-01-10 | 2015-07-16 | Biogen Ma Inc. | Factor viii chimeric proteins and uses thereof |
| EP4176894A1 (en) | 2014-01-10 | 2023-05-10 | Bioverativ Therapeutics Inc. | Factor viii chimeric proteins and uses thereof |
| US11192936B2 (en) | 2014-01-10 | 2021-12-07 | Bioverativ Therapeutics Inc. | Factor VIII chimeric proteins and uses thereof |
| EP4389139A2 (en) | 2014-01-10 | 2024-06-26 | Bioverativ Therapeutics Inc. | Factor viii chimeric proteins and uses thereof |
| US11008561B2 (en) | 2014-06-30 | 2021-05-18 | Bioverativ Therapeutics Inc. | Optimized factor IX gene |
| US12275970B2 (en) | 2014-06-30 | 2025-04-15 | Bioverativ Therapeutics Inc. | Optimized factor IX gene |
| WO2016046301A1 (en) | 2014-09-26 | 2016-03-31 | Bayer Pharma Aktiengesellschaft | Stabilized adrenomedullin derivatives and use thereof |
| WO2016061286A2 (en) | 2014-10-14 | 2016-04-21 | Halozyme, Inc. | Compositions of adenosine deaminase-2 (ada2), variants thereof and methods of using same |
| US11584923B2 (en) | 2014-10-14 | 2023-02-21 | Halozyme, Inc. | Compositions of adenosine deaminase-2 (ADA2), variants thereof and methods of using same |
| US9969998B2 (en) | 2014-10-14 | 2018-05-15 | Halozyme, Inc. | Compositions of adenosine deaminase-2 (ADA2), variants thereof and methods of using same |
| WO2016065301A1 (en) | 2014-10-23 | 2016-04-28 | Biogen Ma Inc. | Anti-gpiib/iiia antibodies and uses thereof |
| WO2016070050A1 (en) | 2014-10-31 | 2016-05-06 | Biogen Ma Inc. | ANTI-GLYCOPROTEIN IIb/IIIa ANTIBODIES |
| US10745680B2 (en) | 2015-08-03 | 2020-08-18 | Bioverativ Therapeutics Inc. | Factor IX fusion proteins and methods of making and using same |
| US11713358B2 (en) | 2015-08-28 | 2023-08-01 | Amunix Pharmaceuticals, Inc. | Chimeric polypeptide assembly and methods of making and using the same |
| US11981744B2 (en) | 2015-08-28 | 2024-05-14 | Amunix Pharmaceuticals, Inc. | Chimeric polypeptide assembly and methods of making and using the same |
| EP4129327A1 (en) | 2015-08-28 | 2023-02-08 | Amunix Pharmaceuticals, Inc. | Chimeric polypeptide assembly and methods of making and using the same |
| US11753461B2 (en) | 2016-02-01 | 2023-09-12 | Bioverativ Therapeutics Inc. | Optimized factor VIII genes |
| WO2017136358A1 (en) | 2016-02-01 | 2017-08-10 | Bioverativ Therapeutics Inc. | Optimized factor viii genes |
| EP4137570A1 (en) | 2016-02-01 | 2023-02-22 | Bioverativ Therapeutics Inc. | Optimized factor viii genes |
| US12161696B2 (en) | 2016-12-02 | 2024-12-10 | Bioverativ Therapeutics Inc. | Methods of treating hemophilic arthropathy using chimeric clotting factors |
| WO2018102743A1 (en) | 2016-12-02 | 2018-06-07 | Bioverativ Therapeutics Inc. | Methods of treating hemophilic arthropathy using chimeric clotting factors |
| WO2018102760A1 (en) | 2016-12-02 | 2018-06-07 | Bioverativ Therapeutics Inc. | Methods of inducing immune tolerance to clotting factors |
| US12257288B2 (en) | 2016-12-02 | 2025-03-25 | Bioverativ Therapeutics Inc. | Methods of inducing immune tolerance to clotting factors |
| WO2018144623A1 (en) | 2017-01-31 | 2018-08-09 | Bioverativ Therapeutics Inc. | Factor ix fusion proteins and methods of making and using same |
| US12168776B2 (en) | 2017-08-09 | 2024-12-17 | Bioverativ Therapeutics Inc. | Nucleic acid molecules and uses thereof |
| WO2019032898A1 (en) | 2017-08-09 | 2019-02-14 | Bioverativ Therapeutics Inc. | NUCLEIC ACID MOLECULES AND USES THEREOF |
| US12060424B2 (en) | 2017-12-21 | 2024-08-13 | Amunix Pharmaceuticals, Inc. | Release segments and binding compositions comprising same |
| WO2019152692A1 (en) | 2018-02-01 | 2019-08-08 | Bioverativ Therapeutics, Inc. | Use of lentiviral vectors expressing factor viii |
| WO2019191295A1 (en) | 2018-03-28 | 2019-10-03 | Bristol-Myers Squibb Company | Interleukin-2/interleukin-2 receptor alpha fusion proteins and methods of use |
| US12030925B2 (en) | 2018-05-18 | 2024-07-09 | Bioverativ Therapeutics Inc. | Methods of treating hemophilia A |
| WO2019222682A1 (en) | 2018-05-18 | 2019-11-21 | Bioverativ Therapeutics Inc. | Methods of treating hemophilia a |
| EP4585260A2 (en) | 2018-05-18 | 2025-07-16 | Bioverativ Therapeutics Inc. | Methods of treating hemophilia a |
| US12226451B2 (en) | 2018-07-03 | 2025-02-18 | Bristol-Myers Squibb Company | FGF-21 formulations |
| WO2020010117A2 (en) | 2018-07-03 | 2020-01-09 | Bristol-Myers Squibb Company | Fgf21 formulations |
| WO2020033863A1 (en) | 2018-08-09 | 2020-02-13 | Bioverativ Therapeutics Inc. | Nucleic acid molecules and uses thereof for non-viral gene therapy |
| US12364774B2 (en) | 2018-08-09 | 2025-07-22 | Bioverativ Therapeutics Inc. | Nucleic acid molecules and uses thereof for non-viral gene therapy |
| WO2020092202A2 (en) | 2018-10-29 | 2020-05-07 | Biogen Ma Inc. | Humanized and stabilized fc5 variants for enhancement of blood brain barrier transport |
| WO2020118069A2 (en) | 2018-12-06 | 2020-06-11 | Bioverativ Therapeutics Inc. | Use of lentiviral vectors expressing factor ix |
| WO2020254197A1 (en) | 2019-06-18 | 2020-12-24 | Bayer Aktiengesellschaft | Adrenomedullin-analogues for long-term stabilization and their use |
| US12403164B2 (en) | 2019-09-30 | 2025-09-02 | Bioverativ Therapeutics Inc. | Lentiviral vector formulations |
| WO2021067389A1 (en) | 2019-09-30 | 2021-04-08 | Bioverativ Therapeutics Inc. | Lentiviral vector formulations |
| WO2021097186A1 (en) | 2019-11-13 | 2021-05-20 | Amunix Pharmaceuticals, Inc. | Barcoded xten polypeptides and compositions thereof, and methods for making and using the same |
| US12173307B2 (en) | 2020-06-24 | 2024-12-24 | Bioverativ Therapeutics Inc. | Methods for the purification of viral vectors |
| WO2021262963A1 (en) | 2020-06-24 | 2021-12-30 | Bioverativ Therapeutics Inc. | Methods for the removal of free factor viii from preparations of lentiviral vectors modified to express said protein |
| US12215156B2 (en) | 2020-06-25 | 2025-02-04 | Amunix Pharmaceuticals, Inc. | HER-2 targeted bispecific compositions and methods for making and using the same |
| EP4172179A1 (en) | 2020-06-25 | 2023-05-03 | Amunix Pharmaceuticals, Inc. | Her-2 targeted bispecific compositions and methods for making and using the same |
| US12617815B2 (en) | 2020-11-13 | 2026-05-05 | Amunix Pharmaceuticals, Inc. | Barcoded XTEN polypeptides and compositions thereof, and methods for making and using the same |
| WO2023028456A1 (en) | 2021-08-23 | 2023-03-02 | Bioverativ Therapeutics Inc. | Optimized factor viii genes |
| WO2023028440A2 (en) | 2021-08-23 | 2023-03-02 | Bioverativ Therapeutics Inc. | Baculovirus expression system |
| WO2023056331A1 (en) | 2021-09-30 | 2023-04-06 | Bioverativ Therapeutics Inc. | Nucleic acids encoding factor viii polypeptides with reduced immunogenicity |
| US12617839B2 (en) | 2021-11-05 | 2026-05-05 | Bioverativ Therapeutics Inc. | Factor VIII chimeric proteins and uses thereof |
| WO2024168279A2 (en) | 2023-02-10 | 2024-08-15 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) and methods for making and using the same |
| WO2024220397A1 (en) | 2023-04-17 | 2024-10-24 | Amunix Pharmaceuticals, Inc. | Compositions targeting epidermal growth factor receptor and methods for making and using the same |
| WO2024245946A1 (en) * | 2023-05-26 | 2024-12-05 | Gubra A/S | Secretin-derived glp1r selective agonists |
| WO2025122957A1 (en) | 2023-12-08 | 2025-06-12 | Amunix Pharmaceuticals, Inc. | Protease activatable cytokines and methods for making and using the same |
| WO2026024863A2 (en) | 2024-07-24 | 2026-01-29 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) in combination with androgen receptor antagonists |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2010258898A1 (en) | 2011-12-22 |
| AU2010258898B8 (en) | 2015-02-05 |
| US10000543B2 (en) | 2018-06-19 |
| EP2440228B1 (en) | 2018-09-26 |
| US9540430B2 (en) | 2017-01-10 |
| US20170158748A1 (en) | 2017-06-08 |
| EP2440228A4 (en) | 2013-06-26 |
| JP2012529297A (ja) | 2012-11-22 |
| EP2440228B8 (en) | 2023-02-22 |
| US20150274800A1 (en) | 2015-10-01 |
| ES2705249T3 (es) | 2019-03-22 |
| US8957021B2 (en) | 2015-02-17 |
| CA2764108A1 (en) | 2010-12-16 |
| US20100323956A1 (en) | 2010-12-23 |
| ZA201200122B (en) | 2013-03-27 |
| CN102481331B (zh) | 2017-09-22 |
| NZ596778A (en) | 2013-11-29 |
| CN102481331A (zh) | 2012-05-30 |
| DK2440228T3 (en) | 2018-12-17 |
| JP5839597B2 (ja) | 2016-01-06 |
| EP2440228A1 (en) | 2012-04-18 |
| AU2010258898B2 (en) | 2015-01-29 |
| PT2440228T (pt) | 2018-12-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DK2440228T3 (en) | Glucose regulating polypeptides and methods for their preparation and use | |
| US12071456B2 (en) | Extended recombinant polypeptides and compositions comprising same | |
| DK2440241T3 (en) | GROWTH HORMON POLYPEPTIDES AND PROCEDURES FOR PREPARING AND USING THEREOF | |
| WO2011028344A2 (en) | Interleukin-1 receptor antagonist compositions and methods of making and using same | |
| AU2014206217B2 (en) | Extended recombinant polypeptides and compositions comprising same | |
| AU2017200870B2 (en) | Extended recombinant polypeptides and compositions comprising same | |
| AU2015200260A1 (en) | Glucose-regulating polypeptides and methods of making and using same | |
| HK40018271A (en) | Extended recombinant polypeptides and compositions comprising same | |
| HK1168775B (en) | Glucose-regulating polypeptides and methods of making and using same | |
| HK1168775A (en) | Glucose-regulating polypeptides and methods of making and using same | |
| HK1238255B (en) | Extended recombinant polypeptides and compositions comprising same | |
| HK1238255A1 (en) | Extended recombinant polypeptides and compositions comprising same | |
| HK1161887B (en) | Extended recombinant polypeptides and compositions comprising same |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201080035271.0 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 10786730 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2764108 Country of ref document: CA Ref document number: 596778 Country of ref document: NZ Ref document number: 2010258898 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2012515082 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010786730 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2010258898 Country of ref document: AU Date of ref document: 20100608 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |