WO2010075280A2 - Coumarin-based compounds - Google Patents
Coumarin-based compounds Download PDFInfo
- Publication number
- WO2010075280A2 WO2010075280A2 PCT/US2009/068989 US2009068989W WO2010075280A2 WO 2010075280 A2 WO2010075280 A2 WO 2010075280A2 US 2009068989 W US2009068989 W US 2009068989W WO 2010075280 A2 WO2010075280 A2 WO 2010075280A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- compound
- pharmaceutically acceptable
- acceptable salt
- independently
- effective amount
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- PPUVPPBZGWJZFI-UHFFFAOYSA-N OC(c(cccc1)c1O1)=C(C(c2cc(C(F)(F)F)ccc2)C(C(Oc2ccccc22)=O)=C2O)C1=O Chemical compound OC(c(cccc1)c1O1)=C(C(c2cc(C(F)(F)F)ccc2)C(C(Oc2ccccc22)=O)=C2O)C1=O PPUVPPBZGWJZFI-UHFFFAOYSA-N 0.000 description 2
- 0 **C(C(C(Nc1c2cc(*)cc1)=O)=C2O)C(C(Nc1ccc(*)cc11)=O)=C1O Chemical compound **C(C(C(Nc1c2cc(*)cc1)=O)=C2O)C(C(Nc1ccc(*)cc11)=O)=C1O 0.000 description 1
- UAHPMYAVIHVWNT-TTWWKFCBSA-N C/C=C/C=C/C(C(C(Oc1c2cccc1)=O)=C2O)C(C(Oc1ccccc11)=O)=C1O Chemical compound C/C=C/C=C/C(C(C(Oc1c2cccc1)=O)=C2O)C(C(Oc1ccccc11)=O)=C1O UAHPMYAVIHVWNT-TTWWKFCBSA-N 0.000 description 1
- RUVINXPYWBROJD-ONEGZZNKSA-N C/C=C/c(cc1)ccc1OC Chemical compound C/C=C/c(cc1)ccc1OC RUVINXPYWBROJD-ONEGZZNKSA-N 0.000 description 1
- ZZYYWKRNEREKCX-UHFFFAOYSA-N CCc1ccc(C(C(C(Oc2c3cccc2)=O)=C3O)C(C(Oc2ccccc22)=O)=C2O)cc1 Chemical compound CCc1ccc(C(C(C(Oc2c3cccc2)=O)=C3O)C(C(Oc2ccccc22)=O)=C2O)cc1 ZZYYWKRNEREKCX-UHFFFAOYSA-N 0.000 description 1
- AAXFRIWZEUWOQK-UHFFFAOYSA-N CNOC([In](C)=N)=O Chemical compound CNOC([In](C)=N)=O AAXFRIWZEUWOQK-UHFFFAOYSA-N 0.000 description 1
- YLAYIRUCODAPLS-UHFFFAOYSA-N Cc(cc1)cc(C(O)=C2C(c(cc3)ccc3OC)C(C(Oc3ccc(C)cc33)=O)=C3O)c1OC2=O Chemical compound Cc(cc1)cc(C(O)=C2C(c(cc3)ccc3OC)C(C(Oc3ccc(C)cc33)=O)=C3O)c1OC2=O YLAYIRUCODAPLS-UHFFFAOYSA-N 0.000 description 1
- YXFVVABEGXRONW-UHFFFAOYSA-N Cc1ccccc1 Chemical compound Cc1ccccc1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 1
- XEXPFPFJCOWETQ-UHFFFAOYSA-N OC(c(cccc1)c1O1)=C(C(c2cc(F)cc(F)c2)C(C(Oc2ccccc22)=O)=C2O)C1=O Chemical compound OC(c(cccc1)c1O1)=C(C(c2cc(F)cc(F)c2)C(C(Oc2ccccc22)=O)=C2O)C1=O XEXPFPFJCOWETQ-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D493/00—Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system
- C07D493/02—Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system in which the condensed system contains two hetero rings
- C07D493/04—Ortho-condensed systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/60—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D213/62—Oxygen or sulfur atoms
- C07D213/69—Two or more oxygen atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D215/00—Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems
- C07D215/02—Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen atoms or carbon atoms directly attached to the ring nitrogen atom
- C07D215/16—Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen atoms or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D215/20—Oxygen atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D215/00—Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems
- C07D215/02—Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen atoms or carbon atoms directly attached to the ring nitrogen atom
- C07D215/16—Heterocyclic compounds containing quinoline or hydrogenated quinoline ring systems having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen atoms or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D215/20—Oxygen atoms
- C07D215/22—Oxygen atoms attached in position 2 or 4
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D309/00—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings
- C07D309/34—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members
- C07D309/36—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members with oxygen atoms directly attached to ring carbon atoms
- C07D309/38—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members with oxygen atoms directly attached to ring carbon atoms one oxygen atom in position 2 or 4, e.g. pyrones
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D311/00—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings
- C07D311/02—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings ortho- or peri-condensed with carbocyclic rings or ring systems
- C07D311/04—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring
- C07D311/42—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms in positions 2 and 4
- C07D311/56—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms in positions 2 and 4 without hydrogen atoms in position 3
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D335/00—Heterocyclic compounds containing six-membered rings having one sulfur atom as the only ring hetero atom
- C07D335/04—Heterocyclic compounds containing six-membered rings having one sulfur atom as the only ring hetero atom condensed with carbocyclic rings or ring systems
- C07D335/06—Benzothiopyrans; Hydrogenated benzothiopyrans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D491/00—Heterocyclic compounds containing in the condensed ring system both one or more rings having oxygen atoms as the only ring hetero atoms and one or more rings having nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D451/00 - C07D459/00, C07D463/00, C07D477/00 or C07D489/00
- C07D491/02—Heterocyclic compounds containing in the condensed ring system both one or more rings having oxygen atoms as the only ring hetero atoms and one or more rings having nitrogen atoms as the only ring hetero atoms, not provided for by groups C07D451/00 - C07D459/00, C07D463/00, C07D477/00 or C07D489/00 in which the condensed system contains two hetero rings
- C07D491/04—Ortho-condensed systems
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D495/00—Heterocyclic compounds containing in the condensed system at least one hetero ring having sulfur atoms as the only ring hetero atoms
- C07D495/02—Heterocyclic compounds containing in the condensed system at least one hetero ring having sulfur atoms as the only ring hetero atoms in which the condensed system contains two hetero rings
- C07D495/04—Ortho-condensed systems
Definitions
- the invention relates to Coumarin-Based Compounds, pharmaceutical compositions thereof, and methods of treatment of disease therewith.
- AD Alzheimer's disease
- a ⁇ is formed from amyloid precursor protein (APP).
- APP is a ubiquitous membrane-spanning (type 1) glycoprotein, of which three major isoforms (APP695, APP751, and APP770) are known, that undergoes a variety of proteolytic processing events (Selkoe, 1998, Trends Cell Biol. 8:447-453).
- Beta-secretase first cleaves APP within the extracellular domain to create soluble APP-beta and beta-CTF (C -terminal fragment), which is then further processed by ⁇ -secretase to release A ⁇ and ⁇ -CTF.
- beta-CTF has widely been used to monitor ⁇ -secretase activity in cell based and in vitro assays.
- the cleavage site of APP by ⁇ -secretase appears to be situated within a transmembrane domain, and variability in the site of ⁇ -secretase mediated proteolysis results in A ⁇ of varying chain lengths comprising heterogeneous C-termini, e.g. A ⁇ (1-38, "A ⁇ 38”), A ⁇ (1-40, “A ⁇ 40”) and A ⁇ (1-42, "A ⁇ 42”).
- a ⁇ (1-38, "A ⁇ 38”
- a ⁇ (1-40, "A ⁇ 40” A ⁇ (1-40, "A ⁇ 40”
- a ⁇ 1-42, "A ⁇ 42”
- a ⁇ 42 is more prone to aggregation than A ⁇ 40 and is the major component of amyloid plaque (Jarrett, et al, 1993, Biochemistry 32:4693-4697; Kuo, et al, 1996, J. Biol. Chem. 271 :4077-4081).
- APP can be sequentially cleaved by alpha-secretase and ⁇ - secretase to produce soluble APP-alpha, P3 and ⁇ -CTF.
- Alpha-secretase cleavage precludes the formation of A ⁇ peptides.
- ⁇ -Secretase is a macromolecular aspartyl protease composed of at least four proteins: presenilin (PS), nicastrin (NCT), PEN-2 and APH-I (De Strooper, 2003, Neuron 38:9-12).
- PS presenilin
- NCT nicastrin
- PEN-2 PEN-2
- APH-I De Strooper, 2003, Neuron 38:9-12.
- CD147 and TMP21 have been found to be associated with the ⁇ - secretase complex (Chen, et al, 2006, Nature 440:1208-1212; Zhou et al, 2005, Proc. Natl. Acad. Sci. USA, 102:7499-7504).
- PS is believed to contain the active site of ⁇ -secretase (Esler et al, 2000, Nat. Cell.
- a PS-dependent protease can process any single-pass transmembrane (TM) protein regardless of its primary sequence as long as the TM protein extracellular domain is smaller than 300 amino acids. Moreover, the size of the extracellular domain appears to determine the efficiency of substrate cleavage (Struhl and Adachi, 2000, MoI Cell 6:625- 636).
- ⁇ -secretase activity might not only have implications in the treatment of AD, but may also have benefit in treatment of all diseases in which ⁇ -secretase plays a role.
- Cancer also affects a significant number of people. It is currently believed that the Notch signaling pathway is implicated in cancer biology. The Notch signaling pathway involves cell-cell communication, and aberrant Notch signaling has been observed in cancer cells. Such aberrant Notch signaling has been linked to tumor formation. ⁇ -Secretase inhibitors have been found to prevent the generation of the active domain of Notch molecules, thereby suppressing Notch signaling.
- the invention provides compounds of the following Formula I
- R 2 is C 1 -Cs alkylene or C 2 -Cs alkenylene; and t is an integer from 2 to 5.
- the invention provides compounds of the following
- the invention provides compounds of the following
- the invention provides compounds of the following
- each X is independently O or S; and each R 1 is independently halo, C 1 -Cs alkoxy, cyano, amino, hydroxy, or C 1 -Cs alkyl.
- each R 1 is independently halo, C 1 -Cs alkoxy, cyano, amino, hydroxy, or C 1 -Cs alkyl.
- each R 1 is independently chloro, bromo, fluoro, iodo, C 1 -Cs alkoxy, cyano, amino, hydroxy, or C 1 -Cs alkyl.
- the invention provides compounds of the following
- each X is independently O, NH or S;
- R 1 is C 1 -C 8 alkoxy
- R 10 is halo.
- the invention provides compounds of the following
- R 2 is C 1 -Cs alkylene or C 2 -Cs alkenylene; each R is independently halo or C 1 -Cs alkyl; t is an integer from 1 to 5; and each v is independently an integer from 1 to 4.
- the invention provides compounds of the following
- the invention provides compounds of the following
- each R 1 is independently halo, cyano, amino, hydroxy, or C 2 -Cs alkyl; each R 3 is independently halo or C 1 -Cs alkyl; t is an integer from 1 to 5; and each v is independently 3 or 4.
- the invention provides compounds of the following
- each R 1 is independently fluoro, iodo, cyano, or C 2 -Cs alkyl; each R 3 is independently halo or C 1 -Cs alkyl; g is an integer from 1 to 5; and each v is independently 1 or 2.
- the invention provides compounds of the following
- R 2 is C 1 -Cs alkylene or C 2 -Cs alkenylene; each R is independently halo or C 1 -Cs alkyl;
- R 4 is hydrogen, meta-(trihalomethyl)phenyl, para-ethylphenyl, or para-(C4-Cs alkyl)phenyl; u is 0 or 1 ; and each v is independently an integer from 0 to 4. In some embodiments, R 4 of Formula XI is not hydrogen.
- the invention provides compounds of the following
- R 2 is C 1 -Cs alkylene or C 2 -Cs alkenylene; each R is independently halo or C 1 -Cs alkyl;
- R 4 is hydrogen, meta-(trihalomethyl)phenyl or para-(C4-Cs alkyl)phenyl; u is 0 or 1 ; and each v is independently an integer from 0 to 4. In some embodiments, R 4 of Formula XII is not hydrogen.
- the invention provides compounds of the following
- R 7 is hydrogen, C 4 -Cs alkenyl or each R 8 is independently halo, C 1 -Cs alkoxy, cyano, amino, hydroxy, or C 2 -Cs alkyl; each v is independently an integer from 0 to 4; and w is an integer from 1 to 5.
- R 7 of formula XIII is not hydrogen.
- the invention provides compounds of the following
- the invention provides compounds of the following
- the invention provides a compound of the following
- the invention provides compounds of the following
- Formula XVII and pharmaceutically acceptable salts thereof wherein: X is independently O, NH, or S; each R 1 is independently halo, cyano, amino, or C 2 -Cs alkyl; each R is independently halo or C 1 -Cs alkyl; t is an integer from 3 to 5; and v is an integer from 0 to 4.
- the invention provides compounds of the following
- the invention provides compounds of the following
- X is O, NH, or S; each R 1 is independently halo, C 1 -Cs alkoxy, cyano, amino, hydroxy, or C 2 -Cs alkyl; each R is independently halo or C 1 -Cs alkyl; t is an integer from 1 to 5; and v is an integer from 0 to 4.
- the invention provides compounds of the following
- the invention provides compounds of the following
- the invention provides compounds of the following
- each R 1 is independently halo, C 1 -Cs alkoxy, cyano, amino, hydroxy, or C 2 -Cs alkyl;
- R 2 is C 1 -Cs alkylene or C 2 -Cs alkenylene; each R is independently halo or C 1 -Cs alkyl; t is an integer from 2 to 5; and each v is independently an integer from 1 to 2.
- each R 1 is independently halo, C 1 -Cs alkoxy, cyano, amino, hydroxy, or C 2 -Cs alkyl; each R 3 is independently halo or C 2 -Cs alkyl; t is an integer from 2 to 5; and each v is independently an integer from 1 to 2.
- the invention provides compounds of the following
- each R 1 is independently fluoro, bromo, iodo, cyano, amino, or C 2 -Cs alkyl; each R 3 is independently halo or C 1 -Cs alkyl; g is an integer from 2 to 5; and each v is independently an integer from 1 to 2.
- the invention provides compositions comprising an effective amount of a compound of Formula I to XXVI or a pharmaceutically acceptable salt thereof and a pharmaceutically acceptable carrier or vehicle. [0038] In another embodiment, the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of Formulas I to XXVI, set forth above, or a pharmaceutically acceptable salt thereof. [0039] In another embodiment, the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of the following Formula A
- each X is independently O, NH, or S;
- R is C 1 -C 8 alkylene or C 2 -Cs alkenylene;
- u is 0 or 1 ; and
- R 11 is hydrogen;
- each R 12 is independently fluoro, bromo, iodo, cyano, C 4 -Cs alkoxy, amino, hydroxy, C 1 -Cs alkyl, NHAc, or trihalomethyl and / is 1;
- each R 13 is independently iodo, C 2 -Cs alkoxy, amino, hydroxy, cyano, C 1 -Cs alkyl, NHAc, or trihalomethyl and m is an integer from 2 to 5; , wherein R 14 is bromo, iodo, fluoro, C 3 -Cs alkoxy, amino, hydroxy, cyano, C 1 -Cs alkyl, NHAc, or trihalomethyl; C 1 -C 8 alkyl or C 3 -Cs cycloalkyl; or
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of the following Formula B
- each X is independently O, NH, or S;
- R is C 1 -C 8 alkylene or C 2 -Cs alkenylene;
- u is 0 or 1 ;
- each R 3 is independently halo or C 1 -Cs alkyl;
- each v is independently an integer from 1 to 4; and
- R 11 is hydrogen;
- each R 12 is independently bromo, fluoro, iodo, C 4 -Cs alkoxy, amino, C 2 -Cs alkyl, NHAc, or trihalomethyl and / is 1;
- each R 13 is independently chloro, iodo, fluoro, C 2 -Cs alkoxy, amino, hydroxy, cyano, C 1 -Cs alkyl, NHAc, or trihalomethyl and m is an integer from 2 to 5;
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of the following Formula C
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of the following Formula D
- X is O, NH, or S; each R 1 is independently halo, C 1 -Cs alkoxy, amino, hydroxy, cyano, C 1 -Cs alkyl, NHAc, or trihalomethyl; each R is independently halo or C 1 -Cs alkyl;
- R .9 is hydrogen or each R , 10 is independently halogen, C 1 -Cs alkoxy, cyano, amino, hydroxy, or C 2 -Cs alkyl;
- Q 1 is NH or O
- each t is independently an integer from 1 to 5; v is an integer from 0 to 4; and y is 0 or 1 ; and z is an integer from 0 to 5.
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of the following Formula E
- R is C 1 -C 8 alkylene or C 1 -Cs alkenylene; each R 3 is independently halogen or C 1 -Cs alkyl; t is an integer from 1 to 5; each v is independently an integer from 0 to 2; and u is 0 or 1.
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of the following Formula F
- R is C 1 -C 8 alkylene or C 2 -Cs alkenylene; each R is independently halogen or C 1 -Cs alkyl; each v is independently an integer from 0 to 2; u is 0 or 1 ; and R , 11 is hydrogen;
- each R 12 is independently halo, C 1 -Cs alkoxy, amino, hydroxy, cyano, C 1 -Cs alkyl, NHAc, or trihalomethyl and / is 1, 2, 4, or 5; or
- each R 13 is independently fluoro, chloro, bromo, iodo, C 1 -C 8 alkoxy, amino, hydroxy, cyano, C 1 -Cs alkyl, NHAc, or trihalomethyl and m is 3.
- R 11 of Formula F is not hydrogen.
- the invention provides methods for treating or preventing a neurodegenerative disease, comprising administering to a subject an effective amount of a compound of Formula I to XXVI or A to F, set forth above, or a pharmaceutically acceptable salt thereof.
- a compound of Formula I to XXVI, A to F, or a pharmaceutically acceptable salt thereof is useful for treating or preventing a neurodegenerative disease or cancer (each being a "Condition").
- Figure 1 This figure provides results of a cell-based assay demonstrating the decrease in A ⁇ 42 (triangles) secretion observed when cells stably transfected with APP were incubated in increasing amounts of compound 37. Secreted amounts of A ⁇ 38 (squares) and A ⁇ 40 (circles) remained relatively constant.
- the three ⁇ -amyloid-detection in vitro assays were modified from our previously reported assay (21) using a biotinylated substrate that eliminated the requirement of anti- ⁇ -amyloid biotinylated antibody. Ruthenylated antibodies that detected the -40, -42, or -38 cleavage site were incorporated to detect proteolysis indicative of ⁇ - secretase activity.
- In vitro Notch assay utilized a recombinant transmembrane portion of the Notch peptide and anti-Notchl SM320 antibody in conjunction with ruthenylated anti-rabbit secondary antibodies. Electrochemiluminescence was quantified on an Analyzer (BioVeris). The selectivity ratio for A ⁇ 42 inhibition over A ⁇ 40 and Notch are indicated in the two far right columns.
- FIG. 3 Cellular evaluation of the coumarin-dimer CS-I and its selective inhibition of A ⁇ 42. Compounds were incubated with the APPsw-N2A mouse neuroblastoma cells for 24 hours and media were analyzed by biotinylated 4G8 and ruthenylated antibodies specific for each respective cleavage product, (a) CS-I preferentially abrogates A ⁇ 42 production with no effect on A ⁇ 40 or A ⁇ 38. (b) The GSI Compound E exhibits no inhibitory selectivity for inhibition of ⁇ -amyloid peptides, (c) The GSM indomethacin reduces A ⁇ 42 production, potently increases A ⁇ 38, and has little effect on A ⁇ 40.
- FIG. 4 Kinetic analysis of allosteric GSIs and evaluation of their effect on the ⁇ -secretase active site architecture, (a) Kinetic analysis of CSl was performed using our modified version of a previously reported in vitro ⁇ -secretase activity assay. The inhibition kinetics were analyzed by using a non-linear curve fit with the Michaelis-Menten equation. Upper right inset: we replotted slopes against the inhibitor concentrations after performing double reciprocal conversion, (b) Schematic representation of the allosteric binding of the di-coumarin compounds to ⁇ -secretase. This binding ultimately causes an alteration at the active site of ⁇ -secretase.
- Black rectangle represents the coumarin-dimer compound
- CS-I has little to no effect on the ability of JC-8 and L505 to label the active site at the Sl' and S3' sites, respectively.
- CS-I blocks photoincorporation of the benzophenone group of the L646 and GY-4 compounds that label the S2 and Sl subsites, respectively,
- FIG. 5 Di-coumarin binding alters the active site of ⁇ -secretase and preferentially alters A ⁇ 42 cleavage
- -C 1 -Cs alkyl refers to a straight chain or branched non-cyclic hydrocarbon having from 1 to 8 carbon atoms, wherein one of the hydrocarbon's hydrogen atoms has been replaced by a single bond.
- Representative straight chain -C 1 -Cs alkyls include -methyl, -ethyl, -n-propyl, -n-butyl, -n-pentyl, n-heptyl, n-hexyl, and n-octyl.
- Representative branched -C 1 -Cs alkyls include -isopropyl, -sec-butyl, - isobutyl, -tert-butyl, -isopentyl, -neopentyl, 1-methylbutyl, 2-methylbutyl, 3-methylbutyl, 1,1-dimethylpropyl and 1 ,2-dimethylpropy 1.
- -C 3 -C 8 cycloalkyl refers to a cyclic hydrocarbon having from 3 to 8 carbon atoms, wherein one of the hydrocarbon's hydrogen atoms has been replaced by a single bond.
- Representative -C3-C8 cycloalkyls include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl.
- halo refers to -F, -Cl, -Br or -I.
- the term "subject,” as used herein unless otherwise defined, is a mammal, e.g., a human, mouse, rat, guinea pig, dog, cat, horse, cow, pig, or non-human primate, such as a monkey, chimpanzee, or baboon. In one embodiment, the subject is a human.
- pharmaceutically acceptable salt as used herein unless otherwise defined, is a salt of an acidic or basic group on the Coumarin-Based Compounds.
- Illustrative salts of a basic group include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucaronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, camphorsulfonate, and pamoate (i.e., 1,1 '-methylene -bis-(2-hydroxy-3-naphthoate)) salts.
- pamoate
- Suitable bases include, but are not limited to, hydroxides of alkali metals such as sodium, potassium, and lithium; hydroxides of alkaline earth metal such as calcium and magnesium; hydroxides of other metals, such as aluminum and zinc; ammonia, and organic amines, such as unsubstituted or hydroxy-substituted mono-, di-, or tri-alkylamines, dicyclohexylamine; tributyl amine; pyridine; N-methyl, N-ethylamine; diethylamine; triethylamine; mono-, bis-, or tris-(2-OH- lower alkylamines), such as mono-; bis-, or tris-(2- hydroxyethyl)amine, 2-hydroxy-tert-
- Compound is an amount that is effective for treating or preventing a Condition.
- An "effective amount” when used in connection with another anti-cancer agent is an amount that is effective for treating or preventing cancer alone or in combination with a Coumarin-Based Compound.
- An “effective amount” when used in connection with another anti-neurodegenerative disease agent is an amount that is effective for treating or preventing a neurodegenerative disease alone or in combination with a Coumarin-Based Compound.
- “In combination with” includes administration within the same composition and via separate compositions; in the latter instance, the other anti-neurodegenerative disease agent is effective for treating or preventing a neurodegenerative disease during a time when the Coumarin-Based Compound exerts its prophylactic or therapeutic effect, or vice versa, and the other anti-cancer agent is effective for treating or preventing cancer during a time when the Coumarin-Based Compound exerts its prophylactic or therapeutic effect, or vice versa.
- APP amphide precursor protein
- the term APP refers to an integral membrane protein that is expressed in tissues and concentrated in the synapses of neurons.
- APP is meant to encompass all isoforms and forms of APP, both wild-type and synthetic.
- Exemplary APP isoforms include, but are not limited to, APP695 (SEQ ID NO:1), the 695 amino acid splice variant of APP (see GenBank accession no. Y00264 and Kang, et ah, 1987, Nature 325:733-736), APP 751 (SEQ ID NO:2), the 751 amino acid splice variant of APP (see Ponte, et ah, 1988, Nature 331 :525-527), and APP770 (SEQ ID NO:3), the 770 amino acid splice variant of APP (see Kitaguchi, et al, 1988, Nature 331 :530-532).
- isoforms of APP include APP714, L-APP752, L-APP733, L-APP696, L-APP677, APP563 and APP365.
- Use of the term APP herein is meant to include all isoforms containing mutations found in familial AD and other amyloidosis conditions.
- these mutations include, but are not limited to, the Swedish double mutation (Lys670Asn, Met671 Leu); the London mutation (Val717Ile); the Indiana mutation (Val717Leu); naturally occurring mutations including Val717Phe, Val717Gly, Ala713Thr, and Ala713Val; the Austrian mutation (Thr714Ile); the Egyptian mutation (Thr714Ala); the French mutation (Val715Met); the German mutation (Val715Ala); the Florida mutation (Ile716Val); the Australian mutation (Leu723Pro); the Flemish mutation (Ala692Gly); the Dutch mutation (Glu693Gln); the Arctic mutation (Glu693Gly); the Italian mutation (Glu693Lys); the Iowa mutation (Asp694Asn); and the amyloidosis-Dutch type mutation (Glu693Gln).
- APP (All numbering herein is relative to the APP770 form).
- Use of the term APP herein further includes proteins containing one or more additions, deletions, insertions, or substitutions relative to the isoforms described above, and APP proteins from humans and other species. Unless a specific isoform is specified, APP when used herein generally refers to any and all isoforms of APP, with or without mutations, from any species.
- beta-CTF amyloid-beta
- soluble beta-APP beta-CTF
- Beta-CTF is an approximately 100 amino acid fragment, wherein the N-terminus of beta-CTF defines the N- terminus of A ⁇ .
- SEQ ID NO:5 An example of a naturally occurring beta-CTF sequence, i.e., the beta-CTF of APP695, is provided in SEQ ID NO:5.
- Derivatives of the beta-CTF portion of APP provided in SEQ ID NO:5 are well known in the art (see, e.g., Lichtenthaler, et al., 1997 ',
- Such derivatives can themselves provide a beta-CTF domain or can serve as a starting point for creating additional derivatives.
- Examples of naturally occurring derivatives of SEQ ID NO:5 are provided by SEQ ID NOs:12-17. Subsequent ⁇ -secretase cleavage of beta-CTF generates the
- a ⁇ ranges in size from, e.g. ,
- a ⁇ 40 40 and 42 amino acids in length
- ⁇ -secretase refers to an enzyme(s) with the ability to cleave at the ⁇ -secretase site of a protein having a ⁇ -secretase cleavage site, e.g., APP.
- ⁇ -secretase includes all recombinant forms, mutations, and other variants of ⁇ - secretase so long as these maintain a functional capability to catalyze the cleavage of molecules or substrates bearing ⁇ -secretase cleavage sites.
- yielderly human refers to a human 65 years or older.
- human adult refers to a human that is 18 years or older.
- human child refers to a human that is 1 year to 18 years old.
- the term “human toddler” refers to a human that is 1 year to 3 years old.
- the term “human infant” refers to a newborn to 1 year old year human.
- the invention provides compounds of the following Formula I
- R of Compound 1-11 or 12 is cis. In another embodiment, R of Compound 1-11 or 12 is trans.
- the invention provides compounds of the following
- X is O. In some embodiments, R 1 is halo. In other embodiments, X is O, and R 1 is halo. In some embodiments, X is O, and R 1 is fluoro.
- the compounds of Formula II have the Formula Ha, set forth below.
- the compounds of Formula Ha are those where R la , R lb ,
- R lc , R ld , or R le is halo.
- the compounds of Formula Ha are those where
- R lb , R lc , R ld , and R le are independently halo.
- the invention provides compounds of the following
- X is O.
- R 1 is halo or hydroxy.
- X is O and R 1 is halo or hydroxy. In other embodiments, X is O and R 1 is chloro, fluoro, or hydroxy. In other embodiments, X is O, and R 1 is fluoro. In some embodiments, X is NH, and R 1 is fluoro. In other embodiments, X is S, and R 1 is fluoro.
- the compounds of Formula III have the Formula Ilia, set forth below. In some embodiments, the compounds of Formula Ilia are those where R la and R le are H and R lb through R ld are independently halo. In other embodiments, the compounds of Formula Ilia are those where R la and R le are H and R lb through R ld are fluoro.
- the invention provides compounds of the following
- X is O. In some embodiments, R 1 is halo. In other embodiments, X is O, and R 1 is halo. In some embodiments, X is O, and R 1 is fluoro.
- the compounds of Formula IV have the Formula IVa, set forth below. In some embodiments, the compounds of Formula IVa are those where R la or R lb is independently halo. In other embodiments, the compounds of Formula IVa are those where R la and R lb are independently halo. In other embodiments, the compounds of Formula IVa are those where R la and R lb are fluoro.
- Illustrative examples of the compounds of Formula IVa include those set forth below in Table 4. Table 4. Illustrative examples of the compounds of Formula IVa
- the invention provides compounds of the following
- R 1 is as provided above in the summary of the invention for the compounds or pharmaceutically acceptable salts of Formula
- R 1 is chloro, bromo, fluoro, iodo, methoxy, cyano, amino, or methyl. In some embodiments, R 1 is chloro, bromo, iodo, methoxy, cyano, amino, or methyl.
- the compounds of Formula V have the Formula Va, set forth below.
- the compounds of Formula Va are those where R la or R lb is independently chloro, bromo, iodo, methoxy, cyano, amino, or methyl.
- the compounds of Formula Va are those where R la and R lb are chloro, bromo, or iodo.
- the invention provides compounds of the following
- X is O.
- R 1 is methoxy, ethoxy, isopropoxy, or t-butoxy.
- X is O, and R 1 is methoxy, ethoxy, isopropoxy, or t-butoxy.
- the compounds of Formula VI have the Formula Via, set forth below.
- the compounds of Formula Via are those where R la is methoxy or ethoxy.
- the compounds of Formula Via are those where R la is methoxy or ethoxy, and R 10 is fluoro.
- Illustrative examples of the compounds of Formula Via include those set forth below in Table 6. Table 6. Illustrative examples of the compounds of Formula Via
- the invention provides compounds of the following
- R , 1c c , or R , Id is halo.
- the compounds of Formula Vila are those where R lb , R lc , and R ld are independently halo.
- the compounds of Formula Vila are those where R la and R le are H and R lb , R lc , or R ld is halo.
- R 2 of Compound 1-147 or 148 is cis. In another embodiment, R of Compound 1-147 or 148 is trans.
- the invention provides compounds of the following
- R 1 is halo.
- R 3 is fluoro or methyl. In other embodiments, R 1 is halo and R 3 is fluoro or methyl.
- the compounds of Formula VIII have the Formula
- the compounds of Formula Villa are those where R la and R le are H. In some embodiments, the compounds of Formula Villa are those where R lb , R lc , or R ld is independently halo. In some embodiments, the compounds of
- Formula Villa are those where R lb , R lc , and R ld are independently halo. In other embodiments, the compounds of Formula Villa are those where R la and R le are H, and R lb ,
- R lc , or R ld is independently halo.
- the invention provides compounds of the following
- R 1 , R 3 , t, and v are as provided above in the summary of the invention for the compounds or pharmaceutically acceptable salts of
- R 1 is halo.
- R 3 is fluoro or methyl. In other embodiments, R 1 is halo and R 3 is fluoro or methyl.
- the compounds of Formula IX have the Formula IXa, set forth below.
- the compounds of Formula IXa are those where R la and R le are H.
- the compounds of Formula IXa are those where R lb ,
- R lc , or R ld is independently halo.
- the compounds of Formula IXa are those where R lb , R lc , and R ld are independently halo.
- the compounds of Formula IXa are those where R la and R le are H and R lb , R lc , or R ld is independently halo.
- Illustrative examples of the compounds of Formula IXa include those set forth below in Table 9.
- the invention provides compounds of the following
- R 1 , R 3 , g, and v are as provided above in the summary of the invention for the compounds or pharmaceutically acceptable salts of Formula X.
- R 1 is fluoro, iodo, cyano, or ethyl.
- R 3 is fluoro or methyl.
- R 1 is fluoro, iodo, cyano, or ethyl and R 3 is fluoro or methyl.
- the compounds of Formula X have the Formula Xa, set forth below.
- the compounds of Formula Xa are those where R la , R le , and R 3a are H.
- the compounds of Formula Xa are those where R lb , R lc , or R ld is fluoro or iodo.
- the compounds of Formula Xa are those where R lb , R lc , and R ld are fluoro.
- the compounds of Formula Xa are those where R la , R le , and R 3a are H and R lb , R lc , or R ld is fluoro or iodo.
- R la , R le , and R 3a are H and R lb , R lc , or R ld is fluoro or iodo.
- Illustrative examples of the compounds of Formula Xa include those set forth below in Table 10.
- the invention provides compounds of the following
- R 4 is meta-(trihalomethyl)phenyl or para-ethylphenyl.
- the compounds of Formula XI have the Formula XIa, set forth below.
- the compounds of Formula XIa are those where R 4 is meta-(trihalomethyl)phenyl or para-ethylphenyl.
- the compounds of Formula XIa are those where R 3a is H, fluoro, or methyl.
- R 2 of compound 218-226, 236-243, or 244 is cis. In another embodiment, R 2 of compound 218-226, 236-243, or 244 is trans.
- the invention provides compounds of the following
- R 4 is meta-(trihalomethyl)phenyl or para-butylphenyl.
- the compounds of Formula XII have the Formula XIIa, set forth below.
- the compounds of Formula XIIa are those where R 4 is meta-(trihalomethyl)phenyl or para-butylphenyl.
- the compounds of Formula XIIa are those where R 3a is H, fluoro, or methyl.
- R 2 of Compound 251-255 or 256 is cis. In another embodiment, R 2 of Compound 251-255 or 256 is trans.
- the invention provides compounds of the following
- R 7 is where each R 8 is independently halo, C 1 -Cs alkoxy, cyano, amino, hydroxy, or C 2 -Cs alkyl and w is an integer from 1 to 5.
- X is O.
- R is methoxy, fluoro, hydroxy, or ethyl.
- R 3 is fluoro or methyl.
- X is
- O and R 8 is methoxy, fluoro, hydroxy, or ethyl.
- X is O and R 3 is fluoro or methyl.
- X is O, R is fluoro or methyl, and R is methoxy, fluoro, hydroxy, or ethyl.
- X is O; R is methoxy, fluoro, hydroxy, or ethyl; and v is 0.
- the compounds of Formula XIII have the Formula
- the compounds of Formula XIIIa are those where R 3a is H, fluoro, or methyl. In some embodiments, the compounds of Formula XIIIa
- R , 3a a is H, fluoro, or
- R 7a of Compound 258-261, 263-266, 268-271, 273-276, 278-281, 283-286, 288-291, 293-296, or 298-301 is trans.
- the invention provides compounds of the following
- X is O. In some embodiments, R 1 is halo or amino. In some embodiments, R 3 is fluoro or ethyl. In other embodiments, X is O and R 1 is halo or amino. In other embodiments, X is O and R is fluoro or ethyl. In other embodiments, X is
- R 3 is fluoro or ethyl and R 1 is halo or amino.
- R 1 is methoxy, ethoxy, propoxy, butoxy, pentoxy, hexoxy, heptoxy or octoxy.
- the compounds of Formula XIV have the Formula
- the compounds of Formula XIVa are those where R la and R lb are independently H, halo, or amino. In some embodiments, the compounds of Formula XIVa
- XIVa are those where R 3a is fluoro or ethyl. In other embodiments, the compounds of
- Formula XIVa are those where R la and R lb are independently H, halo, or amino and R 3a is fluoro or ethyl.
- the invention provides compounds of the following
- X is O.
- R 1 is fluoro, amino, or ethoxy.
- R 3 is fluoro or methyl.
- X is O and R 1 is fluoro, amino or ethoxy.
- X is O and R 1 is fluoro, amino or ethoxy, and v is 0.
- the compounds of Formula XV have the Formula XVa, set forth below.
- the compounds of Formula XVa are those where R la and R lb are independently fluoro, amino, ethoxy, propoxy, butoxy, pentoxy, hexoxy, heptoxy or octoxy.
- the compounds of Formula XVa are those where R la is not methoxy.
- the compounds of Formula XVa are those where R lb is not methoxy.
- the compounds of Formula XVa are those where R la and R lb are fluoro.
- the compounds of Formula XVa are those where R 3a is H, fluoro, or methyl. In other embodiments, the compounds of Formula XVa are those where R la and R lb are independently fluoro, amino, ethoxy, propoxy, butoxy, pentoxy, hexoxy, heptoxy or octoxy and R 3a is H, fluoro, or methyl.
- the invention provides compounds of the following
- X is O. In some embodiments, R 1 is halo. In some embodiments, R 3 is fluoro or methyl. In other embodiments, R 1 is halo and R 3 is fluoro or methyl. In other embodiments, X is O, R 1 is halo, and v is 0.
- the compounds of Formula XVI have the Formula
- the compounds of Formula XVIa are those where R la is H and R lb , R lc , and R ld are independently halo. In some embodiments, the compounds of Formula XVIa are those where R la , R lb , R lc , and R ld are independently halo.
- the compounds of Formula XVIa are those where R la , R lb , R lc , and
- R ld are fluoro.
- the invention provides compounds of the following
- X is O. In some embodiments R 1 is halo. In some embodiments, R 3 is fluoro or methyl. In other embodiments, X is O and R 1 is halo. In other embodiments, X is O, R 1 is halo, and R 3 is fluoro or methyl.
- the compounds of Formula XVII have the Formula
- the compounds of Formula XVIIa are those where R la , R lb , and R lc are independently halo. In some embodiments, the compounds of
- Formula XVIIa are those where R la , R lb , and R lc are fluoro. In some embodiments, the compounds of Formula XVIIa are those where R 3a is H, fluoro, or methyl.
- the invention provides compounds of the following
- X is O. In some embodiments, Q 1 is NH. In some embodiments, R 1 is halo. In some embodiments, R 3 is methyl. In some embodiments, R 9 is halo. In other embodiments, X is O and Q 1 is NH. In other embodiments, X is O, Q 1 is NH, and R 1 is halo. In other embodiments, X is O, Q 1 is NH, R 1 is halo, R 3 is methyl, and R 9 is halo. In other embodiments, X is O, Q 1 is NH, R 1 is halo, R 9 is halo, and v is 0.
- the compounds of Formula XVIII have the Formula
- the compounds of Formula XVIIIa are those where R la , R lb , R lc , R 9a , and R 9b are independently halo. In some embodiments, the compounds of Formula XVIIIa are those where R la , R lb , R lc , R 9a , and R 9b are independently fluoro. In some embodiments, the compounds of Formula XVIIIa are those where R 3a is H or methyl.
- the invention provides compounds of the following
- X is O. In some embodiments, R 1 is halo. In some embodiments, R 3 is methyl. In other embodiments, X is O and R 1 is halo. In other embodiments, X is O and R 3 is methyl. In other embodiments, X is O, R 1 is halo, and R 3 is methyl. In some embodiments, X is O, R 1 is halo, and v is 0.
- the compounds of Formula XIX have the Formula
- the compounds of Formula XIXa are those where R la and R lb are independently halo. In some embodiments, the compounds of Formula XIXa are those where R la and R lb are fluoro. In some embodiments, the compounds of Formula XIXa are those where R 3a is H or methyl. In other embodiments, the compounds of Formula XIXa are those where R la and R lb are fluoro and R 3a is H or methyl.
- the invention provides compounds of the following
- the compounds of Formula XX have the Formula XXa, set forth below.
- the compounds of Formula XXa are those where R la is H and R lb and R lc are independently halo.
- the compounds of Formula XXa are those where R la , R lb , and R lc are independently halo.
- Illustrative examples of the compounds of Formula XXa include those set forth below in Table 20. Table 20. Illustrative examples of the compounds of Formula XXa
- R 2 of compound 584-614 or 615 is cis. In another embodiment, R of compound 584-614 or 615 is trans.
- the invention provides compounds of the following
- X is O. In some embodiments, R 1 is halo. In some embodiments, R 3 is ethyl. In other embodiments, X is O and R 1 is halo. In other embodiments, X is O and R 3 is ethyl. In other embodiments, X is O, R 1 is halo, and R 3 is ethyl.
- the compounds of Formula XXI have the Formula
- the compounds of Formula XXIa are those where R la is H and R lb and R lc are independently halo. In some embodiments, the compounds of Formula XXIa are those where R la , R lb , and R lc are independently halo. In some embodiments, the compounds of Formula XXIa are those where R a is H or ethyl. In other embodiments, the compounds of Formula XXIa are those where R la is H, R lb and R lc are independently halo, and R a is H or ethyl.
- the invention provides compounds of the following
- X is O. In some embodiments, R 1 is halo. In some embodiments, R 3 is ethyl. In other embodiments, X is O and R 1 is halo. In other embodiments, X is O and R 3 is ethyl. In other embodiments, X is O, R 1 is halo, and R 3 is ethyl.
- the compounds of Formula XXIIa are those where where where R la is H and R lb and R lc are independently halo or methyl. In some embodiments, the compounds of Formula XXIIa are those where R la , R lb , and R lc are independently halo or methyl. In some embodiments, the compounds of Formula XXIIa are those where R 3a is H or ethyl. In other embodiments, the compounds of Formula XXIIa are those where R . la a . is H, R , 1b and R , 1c c are independently halo or methyl, and R 3a a is H or ethyl.
- the invention provides compounds of the following
- X is O. In some embodiments, R 1 is halo. In some embodiments, R 3 is fluoro or methyl. In other embodiments, X is O and R 1 is halo. In other embodiments, X is O and R 3 is fluoro or methyl. In other embodiments, X is O, R 1 is halo, and R 3 is fluoro or methyl.
- the compounds of Formula XXIII have the Formula
- the compounds of Formula XXIIIa are those where R la , R lb , and R lc are independently halo. In some embodiments, the compounds of Formula XXIIIa are those where R la , R lb , and R lc are fluoro. In some embodiments, the compounds of Formula XXIIIa are those where R 3a is fluoro or methyl. In other embodiments, the compounds of Formula XXIIIa are those where R la , R lb , and R lc are independently halo and R 3a is fluoro or methyl.
- the invention provides compounds of the following
- the compounds of Formula XXIVa are those where R la is H and R lb and R lc are independently halo. In some embodiments, the compounds of Formula XXIVa are those where R la , R lb , and R lc are independently halo. In some embodiments, the compounds of Formula XXIVa are those where R 3a is methyl and R 3b is H. In some embodiments, the compounds of Formula XXIVa are those where R 3a and R 3b are methyl. In other embodiments, the compounds of Formula XXIVa are those where R la is H, R lb and R lc are independently halo, and R 3a and R 3b are methyl.
- R of Compound 684-698 or 699 is cis. In another embodiment, R 2 of Compound 684-698 or 699 is trans.
- the invention provides compounds of the following
- R 1 , R 3 , t, and v are as provided above in the summary of the invention for the compounds or pharmaceutically acceptable salts of Formula XXV.
- R 1 is halo. In some embodiments, R 1 is fluoro, chloro, bromo, or iodo. In some embodiments, R 3 is ethyl, propyl, or butyl. In other embodiments, R 1 is halo and R 3 is ethyl.
- the compounds of Formula XXV have the Formula
- the compounds of Formula XXVa are those where R la is H and R lb and R lc are independently halo. In some embodiments, the compounds of Formula XXVa are those where R la , R lb , and R lc are independently halo. In some embodiments, the compounds of Formula XXVa are those where R 3a is ethyl and R 3b is H. In some embodiments, the compounds of Formula XXVa are those where R 3a and R 3b are ethyl. In other embodiments, the compounds of Formula XXVa are those where R la is H, R lb and R lc are independently halo, and R 3a and R 3b are ethyl.
- Illustrative examples of the compounds of Formula XXVa include those set forth below in Table 25. Table 25. Illustrative examples of the compounds of Formula XXVa [00178] In another embodiment, the invention provides compounds of the following
- R 1 , R 3 , g, and v are as provided above in the summary of the invention for the compounds or pharmaceutically acceptable salts of Formula XXVI.
- R 1 is halo. In some embodiments, R 3 is methyl. In other embodiments, R 1 is halo and R 3 is methyl.
- the compounds of Formula XXVI have the Formula
- the compounds of Formula XXIVa are those where R la is H and R lb and R lc are independently fluoro, bromo, or iodo. In some embodiments, the compounds of Formula XXVIa are those where R la , R lb , and R lc are independently fluoro, bromo, or iodo. In some embodiments, the compounds of Formula XXVIa are those where R 3a is methyl and R 3b is H. In some embodiments, the compounds of Formula XXVIa are those where R 3a and R 3b are methyl. In some embodiments, the compounds of Formula XXIVa are those where R la is H, R lb and R lc are independently fluoro, bromo, or iodo, and R 3a and R 3b are methyl.
- Illustrative examples of the compounds of Formula XXVIa include those set forth below in Table 26. Table 26. Illustrative examples of the compounds of Formula XXVIa
- each R is independently a substituent as described above, for instance, in Formulas I to VI, VII, IX to XI, and XIII, m is an integer from 0 to 4, and n is an integer from 0 to 5.
- a solution of a compound of Formula i (2 mole equivalents) in a solvent is prepared.
- a compound of Formula ii (1 mole equivalent) is then added to the solution, and the resultant mixture is refluxed for a period of time sufficient to provide a compound of Formula iii.
- the compound of Formula iii can be isolated from the reaction mixture and purified.
- the compound of Formula iii may be isolated from the reaction mixture by any method known to one of skill in the art. Such methods include, but are not limited to, filtration, chromatography or solvent extraction.
- the isolated compound of Formula iii may optionally be purified by any method known to one of skill in the art. Such methods include, but are not limited to, crystallization.
- a Coumarin-Based Compound is useful for treatment or prevention of a Condition as set forth below.
- the Coumarin-Based Compounds are useful for treating or preventing cancer.
- the invention provides methods for treating or preventing cancer, comprising administering an effective amount of a Coumarin-Based Compound to a subject.
- the subject is in need of treatment or prevention of the cancer.
- the methods further comprise administering an effective amount of another anticancer agent.
- cancers that the Coumarin-Based Compounds disclosed herein are useful for treating or preventing include, but are not limited to, the cancers disclosed below in Table 27 and metastases thereof.
- the cancer is lung cancer, breast cancer, colorectal cancer, prostate cancer, a leukemia, a lymphoma, non-Hodgkin's lymphoma, skin cancer, a brain cancer, a cancer of the central nervous system, ovarian cancer, uterine cancer, stomach cancer, pancreatic cancer, esophageal cancer, kidney cancer, liver cancer, or a head and neck cancer.
- the cancer is metastatic cancer.
- the cancer is brain cancer or melanoma.
- the brain cancer is metastatic brain cancer or a glioma.
- the glioma is pilocytic astrocytoma, astrocytoma, anaplastic astrocytoma or glioblastoma multiforme.
- the cancer is homologous-recombination deficient, such as BRCA-I or BRC A-2 deficient, or is deficient in one or more proteins of the Fanconi family.
- the deficiency is caused by a genetic mutation.
- the phenotype resulting from the deficiency is caused by abnormally low expression of BRCA-I or BRCA-2 protein.
- the phenotype resulting from the deficiency is caused by abnormally low expression of one or more proteins of the Fanconi family.
- the cancer is leukemia, such as but not limited to, acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemias, such as, myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia leukemias and myelodysplastic syndrome; chronic leukemia, such as but not limited to, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, hairy cell leukemia; polycythemia vera; lymphoma such as but not limited to Hodgkin's disease, non-Hodgkin's disease; multiple myeloma such as but not limited to smoldering multiple myeloma, nonsecretory myeloma, osteosclerotic myeloma, plasma cell leukemia, solitary plasmacytoma and extramedullary plasmacytoma; Wald
- cancer include myxosarcoma, osteogenic sarcoma, endotheliosarcoma, lymphangioendotheliosarcoma, mesothelioma, synovioma, hemangioblastoma, epithelial carcinoma, cystadenocarcinoma, bronchogenic carcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma and papillary adenocarcinomas (for a review of such disorders, see Fishman et ah, 1985, Medicine, 2d Ed., J.B. Lippincott Co., Philadelphia and Murphy et al, 1997, Informed Decisions: The Complete Book of Cancer Diagnosis, Treatment, and Recovery, Viking Penguin, Penguin Books U.S.A., Inc., United States of America).
- the cancer is one that is associated with cleavage of notch by ⁇ -secretase including, but not limited to, leukemia, non small cell lung cancer, ovarian cancer, breast cancer, or brain cancer.
- the subject in need of treatment has previously undergone or is presently undergoing treatment for cancer.
- the treatment includes, but is not limited to, chemotherapy, radiation therapy, surgery or immunotherapy, such as administration of a cancer vaccine.
- the subject in need of treatment has previously undergone or is presently undergoing treatment for cancer.
- the treatment includes, but is not limited to, chemotherapy, radiation therapy, surgery or immunotherapy, such as administration of a cancer vaccine.
- the Coumarin-Based Compounds are also useful for treating or preventing a cancer caused by a virus.
- viruses include human papilloma virus, which can lead to cervical cancer (see, e.g., Hernandez- Avila et al, Archives of Medical Research (1997) 28:265-271); Epstein-Barr virus (EBV), which can lead to lymphoma (see, e.g., Herrmann et al., J. Pathol. (2003) 199(2): 140-5); hepatitis B or C virus, which can lead to liver carcinoma (see, e.g., El-Serag, J. Clin. Gastroenterol. (2002) 35(5 Suppl.
- HTLV human T cell leukemia virus
- HTLV human T cell leukemia virus
- human herpesvirus-8 infection which can lead to Kaposi's sarcoma
- Kaposi's sarcoma see, e.g., Kadow et al., Curr. Opin. Investig. Drugs (2002) 3(11): 1574-9
- Human Immune deficiency Virus (HIV) infection which can lead to cancer as a consequence of immunodeficiency (see, e.g., Dal Maso et al., Lancet Oncol (2003) 4(2): 110-9).
- the Coumarin-Based Compounds are also useful for preventing cancer, or preventing progression of a cancer, including but not limited to the cancers listed in Table 27.
- Such prophylactic use includes that in which non-neoplastic cell growth such as hyperplasia, metaplasia, or most specifically, dysplasia has occurred.
- non-neoplastic cell growth such as hyperplasia, metaplasia, or most specifically, dysplasia has occurred.
- the presence of one or more characteristics of a transformed phenotype, or of a malignant phenotype, displayed in vivo or displayed in vitro by a cell sample from a subject can indicate the desirability of prophylactic or therapeutic administration of a Coumarin-Based Compound.
- Such characteristics of a transformed phenotype include morphology changes, looser substratum attachment, loss of contact inhibition, loss of anchorage dependence, protease release, increased sugar transport, decreased serum requirement, expression of fetal antigens, disappearance of the 250,000 dalton cell surface protein, etc.
- leukoplakia a benign-appearing hyperplastic or dysplastic lesion of the epithelium, or Bowen's disease, a carcinoma in situ, is treatable or preventable according to the present methods.
- fibrocystic disease cystic hyperplasia, mammary dysplasia, specifically adenosis (benign epithelial hyperplasia) is treatable or preventable according to the present methods.
- a subject that has one or more of the following predisposing factors for malignancy can be treated by administration of an effective amount of a Coumarin-Based Compound: a chromosomal translocation associated with a malignancy (e.g., the Philadelphia chromosome for chronic myelogenous leukemia; t(14;l 8) for follicular lymphoma); familial polyposis or Gardner's syndrome; benign monoclonal gammopathy; a first degree kinship with persons having a cancer or precancerous disease showing a Mendelian (genetic) inheritance pattern (e.g., familial polyposis of the colon, Gardner's syndrome, hereditary exostosis, poly endocrine, adenomatosis, medullary thyroid carcinoma with amyloid production and pheochromocytoma, Peutz-Jeghers syndrome, neurofibromatosis of Von Recklinghausen, retinoblastoma, carot
- the Coumarin-Based Compounds that are useful for treating or preventing cancer are those of Formulas I to XXVI, described above.
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of Formula A
- the subject is in need of treatment or prevention of cancer.
- the compounds of Formula A are those where u is 0
- R 11 is s wherein each R 12 is independently bromo, iodo, C 4 -Cs alkoxy, amino, hydroxy, C 1 -Cs alkyl, NHAc, or trihalomethyl and / is 1.
- R 12 is independently bromo, iodo, NHAc, or trihalomethyl and / is 1.
- the compounds of Formula A are those where u is 0 and R 11 is a C 1 -Cs alkyl or C 3 -Cs cycloalkyl.
- the compounds of Formula A are those where u is 0
- R 11 is , wherein R . 14 is bromo, iodo, or fluoro.
- R . 14 is bromo, iodo, or fluoro.
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of Formula B
- the compounds of Formula B are those where u is 0; R
- R , 1 1 1 1 is , wherein each R . 1 1 2 Z is independently bromo, fluoro, iodo, NHAc, or trihalomethyl and / is 1.
- the compounds of Formula B are those where u is 0; R 3 is halo or methyl; and R 11 is a C 1 -Cs alkyl or C 3 -Cs cycloalkyl. [00206] In certain embodiments, the compound of Formula B is
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of Formula C
- the compounds of Formula C are those where R 1 is halo. In other embodiments, the compounds of Formula C are those where R 1 is fluoro. In other embodiments, the compounds of Formula C are those where R 3 is halo or methyl. In other embodiments, the compounds of Formula C are those where R 1 is halo and R 3 is halo or methyl.
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of Formula D
- the subject is in need of treatment or prevention of cancer.
- the compounds of Formula D are those where R 1 is halo. In other embodiments, the compounds of Formula D are those where R 1 is fluoro. In other embodiments, the compounds of Formula D are those where R 3 is halo or methyl. In other embodiments, the compounds of Formula D are those where R 1 is halo and R 3 is halo or methyl.
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of Formula E
- the subject is in need of treatment or prevention of cancer.
- the compounds of Formula E are those where R 1 is halo. In other embodiments, the compounds of Formula E are those where R 1 is fluoro. In other embodiments, the compounds of Formula E are those where R is halo or methyl. In other embodiments, the compounds of Formula D are those where R 1 is halo and R 3 is halo or methyl.
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of Formula F
- the compounds of Formula F are those where R 11 is
- each R 13 is independently chloro, bromo, iodo, C 1 -Cs alkoxy, amino, hydroxy, cyano, C 1 -Cs alkyl, NHAc, or trihalomethyl and m is 3.
- the compounds of Formula F are those where u is 0; R
- R 11 is halo or methyl; and R 11 is , wherein each R 12 is halo.
- the invention provides methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of the formula:
- the present methods for treating or preventing cancer can further comprise the administration of another anticancer agent.
- the present invention provides methods for treating or preventing cancer, comprising the administration of an effective amount of a Coumarin- Based Compound and another anticancer agent to a subject in need thereof.
- the Coumarin- Based Compound and another anticancer agent can be administered concurrently.
- the Coumarin-Based Compound and another anticancer agent can be administered within the same composition, or can be administered from different compositions, via the same or different routes of administration.
- the Coumarin-Based Compound is administered during a time when the other anticancer agent exerts its prophylactic or therapeutic effect, or vice versa.
- the Coumarin-Based Compound or other anticancer agent is administered in doses commonly employed when such agents are used as monotherapy for the treatment of cancer.
- the Coumarin-Based Compound or other anticancer agent is administered in doses that are lower than the doses commonly employed when such agents are used as monotherapy for the treatment of cancer.
- the Coumarin-Based Compound and other anticancer agent act synergistically and are administered in doses that are lower than the doses commonly employed when such agents are used as monotherapy for the treatment of cancer.
- the dosage of the Coumarin-Based Compound or other anticancer agent administered as well as the dosing schedule can depend on various parameters, including, but not limited to, the cancer being treated, the subject's general health, and the administering physician's discretion.
- a Coumarin-Based Compound can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concurrently with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of the other anticancer agent, to a subject in need thereof.
- a Coumarin-Based Compound and the other anticancer agent are administered 1 minute apart, 10 minutes apart, 30 minutes apart, less than 1 hour apart, 1 hour apart, 1 hour to 2 hours apart, 2 hours to 3 hours apart, 3 hours to 4 hours apart, 4 hours to 5 hours apart, 5 hours to 6 hours apart, 6 hours to 7 hours apart, 7 hours to 8 hours apart, 8 hours to 9 hours apart, 9 hours to 10 hours apart, 10 hours to 11 hours apart, 11 hours to 12 hours apart, no more than 24 hours apart or no more than 48 hours apart.
- a Coumarin- Based Compound and the other anticancer agent are administered within 3 hours.
- a Coumarin-Based Compound and the other anticancer agent are administered at 1 minute to 24 hours apart.
- an effective amount of a Coumarin-Based Compound and an effective amount of other anticancer agent are present in the same composition.
- this composition is useful for oral administration, in another embodiment, this composition is useful for intravenous administration.
- compositions comprise an amount of a Coumarin-
- compositions comprise an effective amount of temozolomide, procarbazine, dacarbazine, inter leukin-2, irinotecan, or doxorubicin, a pharmaceutically acceptable carrier or vehicle, and an effective amount of a Coumarin-Based Compound.
- the amount of a Coumarin-Based Compound and the other anticancer agent is at least about 0.01% of the combined combination chemotherapy agents by weight of the composition. When intended for oral administration, this amount can be varied from about 0.1% to about 80% by weight of the composition. Some oral compositions can comprise from about 4% to about 50% of combined amount of a Coumarin- Based Compound and the other anticancer agent by weight of the composition. Other compositions of the present invention are prepared so that a parenteral dosage unit contains from about 0.01% to about 2% by weight of the composition.
- Compound and the other anticancer agent include, but are not limited to, the list of cancers set forth above in Table 27.
- the cancer is brain cancer.
- the brain cancer is pilocytic astrocytoma, astrocytoma, anaplastic astrocytoma, glioblastoma multiforme or a metastatic brain tumor.
- the cancer is melanoma.
- the melanoma is metastatic melanoma.
- the Coumarin-Based Compound and other anticancer agent can act additively or synergistically.
- a synergistic combination of a Coumarin-Based Compound and the other anticancer agent might allow the use of lower dosages of one or both of these agents and/or less frequent administration of the agents to a subject with cancer.
- the ability to utilize lower dosages of one or both of the Coumarin-Based Compound and other anticancer agent and/or to administer the agents less frequently can reduce any toxicity associated with the administration of the agents to a subject without reducing the efficacy of the agents in the treatment of cancer.
- a synergistic effect might result in the improved efficacy of these agents in the treatment of cancer and/or the reduction of any adverse or unwanted side effects associated with the use of either agent alone.
- Suitable other anticancer agents useful in the methods and compositions of the present invention include, but are not limited to temozolomide, a topoisomerase I inhibitor, procarbazine, dacarbazine, gemcitabine, capecitabine, methotrexate, taxol, taxotere, mercaptopurine, thioguanine, hydroxyurea, cytarabine, cyclophosphamide, ifosfamide, nitrosoureas, cisplatin, carboplatin, mitomycin, dacarbazine, procarbizine, etoposide, teniposide, campathecins, bleomycin, doxorubicin, idarubicin, daunorubicin, dactinomycin, plicamycin
- additional anticancer agents that are useful in the compositions and methods of the present invention include, but are not limited to: acivicin; aclarubicin; acodazole hydrochloride; acronine; adozelesin; aldesleukin; altretamine; ambomycin; ametantrone acetate; amino glutethimide; amsacrine; anastrozole; anthramycin; asparaginase; asperlin; azacitidine; azetepa; azotomycin; batimastat; benzodepa; bicalutamide; bisantrene hydrochloride; bisnaf ⁇ de dimesylate; bizelesin; bleomycin sulfate; brequinar sodium; bropirimine; busulfan; cactinomycin; calusterone; caracemide; carbetimer; carboplatin; carmustine; carubicin hydrochloride
- anticancer drugs that are useful in the methods and compositions of the invention include, but are not limited to: 20-epi-l,25 dihydroxyvitamin D3; 5- ethynyluracil; abiraterone; aclarubicin; acylfulvene; adecypenol; adozelesin; aldesleukin; ALL-TK antagonists; altretamine; ambamustine; amidox; amifostine; aminolevulinic acid; amrubicin; amsacrine; anagrelide; anastrozole; andrographolide; angiogenesis inhibitors; antagonist D; antagonist G; antarelix; anti-dorsalizing morpho genetic protein- 1; antiandrogen, prostatic carcinoma; antiestrogen; antineoplaston; antisense oligonucleotides; aphidicolin glycinate; apoptosis gene modulators; apoptosis regulators;
- the other anticancer agent is interferon- ⁇ . In another embodiment, the other anticancer agent is inter leukin-2. In one embodiment, the other anticancer agent is an alkylating agent, such as a nitrogen mustard, a nitrosourea, an alkylsulfonate, a triazene, or a platinum-containing agent. In one embodiment, the other anticancer agent is a triazene alkylating agent In one embodiment, the other anticancer agent is O-6-benzyl guanine. In another embodiment, the other anticancer agent is 0-6- benzylguanine and temozolomide. In another embodiment, the other anticancer agent is 0-6- benzylguanine and procarbazine. In still another embodiment, the other anticancer agent is O- 6-benzyl guanine and dacarbazine.
- the other anticancer agent is an alkylating agent, such as a nitrogen mustard, a nitrosourea, an
- the Coumarin-Based Compounds can be administered to a subject that has undergone or is currently undergoing one or more additional anticancer therapies including, but not limited to, surgery, radiation therapy, or immunotherapy, such as cancer vaccines.
- additional anticancer therapies including, but not limited to, surgery, radiation therapy, or immunotherapy, such as cancer vaccines.
- the invention provides methods for treating or preventing cancer comprising administering to a subject in need thereof an effective amount of a Coumarin-Based Compound to treat or prevent cancer and another anticancer therapy including, but not limited to, surgery, radiation therapy, or immunotherapy, such as a cancer vaccine.
- the other anticancer therapy is radiation therapy. In another embodiment, the other anticancer therapy is surgery. In still another embodiment, the other anticancer therapy is immunotherapy.
- the present methods for treating or preventing cancer comprise administering an effective amount of a Coumarin-Based Compound and radiation therapy.
- the radiation therapy can be administered concurrently with, prior to, or subsequent to the Coumarin-Based Compound, in one embodiment at least an hour, five hours, 12 hours, a day, a week, a month, in another embodiment several months (e.g., up to three months), prior or subsequent to administration of the Coumarin-Based Compound.
- the other anticancer therapy is radiation therapy
- any radiation therapy protocol can be administered depending upon the type of cancer to be treated.
- X-ray radiation can be administered; specifically, high-energy megavoltage (radiation of greater that 1 MeV energy) can be administered for deep tumors, and electron beam and orthovoltage X-ray radiation can be administered for skin cancers.
- high-energy megavoltage radiation of greater that 1 MeV energy
- electron beam and orthovoltage X-ray radiation can be administered for skin cancers.
- Gamma-ray emitting radioisotopes such as radioactive isotopes of radium, cobalt and other elements, can also be administered.
- the invention provides methods of treatment of cancer comprising administering a Coumarin-Based Compound as an alternative to chemotherapy or radiation therapy where the chemotherapy or the radiation therapy results in a negative side effect in the subject being treated.
- the subject being treated can, optionally, be treated with another anticancer therapy such as surgery, radiation therapy, or immunotherapy.
- the Coumarin-Based Compounds can also be administered in vitro or ex vivo, such as for the treatment of certain cancers, including, but not limited to leukemias and lymphomas, such treatment involving autologous stem cell transplants.
- the Coumarin-Based Compounds are useful for treating or preventing a neurodegenerative disease.
- the invention provides methods for treating or preventing a neurodegenerative disease, comprising administering an effective amount of a Coumarin- Based Compound to a subject in need thereof.
- neurodegenerative diseases include, but are not limited to, Alexander's disease, Alper's disease, Alzheimer's disease, Amyotrophic lateral sclerosis, Ataxia telangiectasia.
- Batten disease also known as Spielmeyer-Vogt-Sjogren-Batten disease
- Bovine spongiform encephalopathy Canavan disease, Cockayne syndrome, Corticobasal degeneration, Creutzfeldt-Jakob disease, Huntington's disease, HIV-associated dementia, Kennedy's disease, Krabbe's disease, Lewy body dementia, Machado-Joseph disease (Spinocerebellar ataxia type 3), Multiple sclerosis, Multiple System Atrophy, Narcolepsy, Neuroborreliosis, Parkinson's disease, Pelizaeus- Merzbacher Disease, Pick's disease, Primary lateral sclerosis, Prion diseases, Progressive Supranuclear Palsy, Refsum's disease, Sandhoffs disease, Schilder's disease, Subacute combined degeneration of spinal cord secondary to Pernicious Anaemia, Spinocerebellar ataxia, Spinal muscular atrophy, Steele -Richardson-Olszewski disease,
- the neurodegenerative disease is Alzheimer's disease.
- Other examples of neurdegenerative diseases include, but are not limited to, diffuse Lewy body disease, multisystem degeneration (Shy-Drager syndrome), motor neuron diseases including amyotrophic lateral sclerosis, degenerative ataxias, cortical basal degeneration, ALS- Parkinson's-Dementia complex of Guam, subacute sclerosing panencephalitis, Huntington's disease, synucleinopathies, primary progressive aphasia, striatonigral degeneration, Machado-Joseph disease/spinocerebellar ataxia type 3 and olivopontocerebellar degenerations, Gilles De La Tourette's disease, bulbar and pseudobulbar palsy, spinal and spinobulbar muscular atrophy (Kennedy's disease), primary lateral sclerosis, familial spastic paraplegia, Werdnig-Hoffmann disease, Kugelberg-Welander disease, Tay-S
- Coumarin-Based Compounds that are useful for treating or preventing a neurodegenerative disease are those of Formulas I to XXVI, set forth above.
- the invention emcompasses methods for treating or preventing cancer, comprising administering to a subject an effective amount of a compound of Formula A, B, C, D, E, or F, described above, or a pharmaceutically acceptable salt thereof.
- the subject is in need of treatment or prevention of the neurodegenerative disease.
- the present methods for treating or preventing a neurodegenerative disease can further comprise the administration of another anti- neurodegenerative disease agent.
- the present invention provides methods for treating or preventing a neurodegenerative disease, comprising the administration of an effective amount of a Coumarin-Based Compound and another anti-neurodegenerative disease agent to a subject in need thereof.
- the Coumarin-Based Compound and another anti-neurodegenerative disease agent can be administered concurrently.
- the Coumarin-Based Compound and another anti-neurodegenerative disease agent can be administered within the same composition, or can be administered from different compositions, via the same or different routes of administration.
- the Coumarin-Based Compound is administered during a time when the other anti-neurodegenerative disease agent exerts its prophylactic or therapeutic effect, or vice versa.
- the Coumarin-Based Compound or other anti- neurodegenerative disease agent is administered in doses commonly employed when such agents are used as monotherapy for the treatment of a neurodegenerative disease.
- the Coumarin-Based Compound or other anti- neurodegenerative disease agent is administered in doses that are lower than the doses commonly employed when such agents are used as monotherapy for the treatment of a neurodegenerative disease.
- the Coumarin-Based Compound and other anti- neurodegenerative disease agent act synergistically and are administered in doses that are lower than the doses commonly employed when such agents are used as monotherapy for the treatment of a neurodegenerative disease.
- the dosage of the Coumarin-Based Compound or other anti-neurodegenerative disease agent administered as well as the dosing schedule can depend on various parameters, including, but not limited to, the neurodegenerative disease being treated, the subject's general health, and the administering physician's discretion.
- a Coumarin-Based Compound can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concurrently with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of the other anti-neurodegenerative disease agent, to a subject in need thereof.
- a Coumarin-Based Compound and the other anti-neurodegenerative disease agent are administered 1 minute apart, 10 minutes apart, 30 minutes apart, less than 1 hour apart, 1 hour apart, 1 hour to 2 hours apart, 2 hours to 3 hours apart, 3 hours to 4 hours apart, 4 hours to 5 hours apart, 5 hours to 6 hours apart, 6 hours to 7 hours apart, 7 hours to 8 hours apart, 8 hours to 9 hours apart, 9 hours to 10 hours apart, 10 hours to 11 hours apart, 11 hours to 12 hours apart, no more than 24 hours apart or no more than 48 hours apart.
- a Coumarin-Based Compound and the other anti-neurodegenerative disease agent are administered within 3 hours.
- a Coumarin-Based Compound and the other anti-neurodegenerative disease agent are administered at 1 minute to 24 hours apart.
- an effective amount of a Coumarin-Based Compound and an effective amount of other anti-neurodegenerative disease agent are present in the same composition.
- this composition is useful for oral administration, in another embodiment, this composition is useful for intravenous administration.
- the compositions comprise an amount of a Coumarin-
- the Coumarin-Based Compound and other anti-neurodegenerative disease agent can act additively or synergistically.
- a synergistic combination of a Coumarin-Based Compound and the other anti-neurodegenerative disease agent might allow the use of lower dosages of one or both of these agents and/or less frequent administration of the agents to a subject with a neurodegenerative disease.
- the ability to utilize lower dosages of one or both of the Coumarin-Based Compound and other anti-neurodegenerative disease agent and/or to administer the agents less frequently can reduce any toxicity associated with the administration of the agents to a subject without reducing the efficacy of the agents in the treatment of a neurodegenerative disease.
- a synergistic effect might result in the improved efficacy of these agents in the treatment of a neurodegenerative disease and/or the reduction of any adverse or unwanted side effects associated with the use of either agent alone.
- Suitable other anti-neurodegenerative disease agents useful in the methods and compositions of the present invention include, but are not limited to, anti- Alzheimer's agents such as cholinesterase inhibitors (e.g., tacrine, donepezil hydrochloride, rivastigmine, or galantamine), or partial glutamate antagonists (e.g., memantine), or anti-Parkinson's agents such as levodopa, carbidopa, tolcapone, bromocriptine, pergolide, pramipexole, ropinirole, selegiline, or amantadine.
- anti- Alzheimer's agents such as cholinesterase inhibitors (e.g., tacrine, donepezil hydrochloride, rivastigmine, or galantamine), or partial glutamate antagonists (e.g., memantine), or anti-Parkinson's agents such as levodopa, carbidopa, tolcapone, bromocriptine
- ⁇ -secretase activity includes, but are not limited to, a small molecule, a synthetic drug, a peptide (including a cyclic peptide), a polypeptide, a protein, a nucleic acid ⁇ e.g., a DNA and RNA nucleotide including, but not limited to, an antisense nucleotide sequence, a triple helix, RNAi, and a nucleotide sequence encoding a biologically active protein, polypeptide or peptide), an antibody, a synthetic or natural inorganic molecule, a mimetic agent, and a synthetic or natural organic molecule.
- an immunomodulatory agent ⁇ e.g., interferon
- anti-inflammatory agent ⁇ e.g., an adrenocorticoid
- corticosteroid ⁇ e.g., beclomethasone, budesonide, flunisolide, fluticasone, triamcinolone, methylprednisolone, prednisolone, prednisone, hydrocortisone), a glucocorticoid, a steroid, and a non-steriodal anti- inflammatory drug ⁇ e.g., aspirin, ibuprofen, diclofenac, and a COX-2 inhibitor), a pain reliever, a leukotreine antagonist ⁇ e.g., montelukast, a methyl xanthine, zafirlukast, and zileuton), a beta2-agonist ⁇ e.g., albuterol,
- Coumarin-Based Compounds are advantageously useful in veterinary and human medicine. As described above, the Coumarin-Based Compounds are useful for treating or preventing a Condition in a subject in need thereof. Without being bound by theory, it is believed that the Coumarin-Based Compounds exert their therapeutic or prophylactic effect by inhibiting ⁇ -secretase.
- the Coumarin-Based Compounds can be administered in amounts that are effective to treat or prevent a Condition in a subject, including a subject that is in need of treatment or prevention of a Condition.
- the Coumarin-Based Compounds can be administered as a component of a composition that comprises a pharmaceutically acceptable carrier or vehicle.
- the pharmaceutically acceptable "carrier or vehicle” includes, for example, a diluent and an excipient.
- the present compositions, which comprise a Coumarin- Based Compound can be administered orally.
- the Coumarin-Based Compounds can also be administered by any other convenient route, for example, by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral, rectal, or intestinal mucosa) and can be administered together with another biologically active agent. Administration can be systemic or local.
- Methods of administration include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, oral, sublingual, intracerebral, intravaginal, transdermal, rectal, by inhalation, or topical, specifically to the ears, nose, eyes, or skin. In some instances, administration will result in the release of a Coumarin-Based Compound into the bloodstream.
- the Coumarin-Based Compounds are administered orally.
- the Coumarin-Based Compounds can be desirable to administer the Coumarin-Based Compounds locally. This can be achieved, for example, and not by way of limitation, by local infusion during surgery, topical application, e.g., in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository or enema, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers.
- Intraventricular injection can be facilitated by an intraventricular catheter, for example, attached to a reservoir, such as an Ommaya reservoir.
- Pulmonary administration can also be employed, e.g., by use of an inhaler of nebulizer, and formulation with an aerosolizing agent, or via perfusion in a fluorocarbon oar, synthetic pulmonary surfactant.
- the Coumarin-Based Compounds can be formulated as a suppository, with traditional binders and excipients such as triglycerides.
- Coumarin-Based Compounds can be delivered in a vesicle, specifically a liposome (see Langer, Science 249:1527-1533 (1990) and Liposomes in Therapy of Infectious Disease and Cancer 317-327 and 353-365 (1989)).
- the Coumarin-Based Compounds can be delivered in a controlled-release system or sustained-release system (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)). Other controlled or sustained-release systems discussed in the review by Langer, Science 249: 1527-1533 (1990) can be used.
- a pump can be used (Langer, Science 249: 1527- 1533 (1990); Sefton, CRC Crit. Ref. Biomed. Eng. 14:201 (1987); Buchwald et al, Surgery 88:507 (1980); and Saudek et al., N. Engl. J Med. 321 :574 (1989)).
- polymeric materials can be used (see Medical Applications of Controlled Release (Langer and Wise eds., 1974); Controlled Drug Bioavailability, Drug Product Design and Performance (Smolen and Ball eds., 1984); Ranger and Peppas, J. Macromol. Sd. Rev. Macromol. Chem.
- a controlled- or sustained-release system can be placed in proximity of a target of the Coumarin-Based Compounds, e.g., the spinal column, brain, skin, lung, or gastrointestinal tract, thus requiring only a fraction of the systemic dose.
- the present compositions can optionally comprise a suitable amount of a pharmaceutically acceptable excipient so as to provide the form for proper administration to the subject.
- Such pharmaceutical excipients can be liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- the pharmaceutical excipients can be saline, gum acacia, gelatin, starch paste, talc, keratin, colloidal silica, urea and the like.
- auxiliary, stabilizing, thickening, lubricating, and coloring agents can be used.
- the pharmaceutically acceptable excipients are sterile when administered to a subject. Water is a useful excipient when the Coumarin-Based Compound is administered intravenously.
- Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid excipients, specifically for injectable solutions.
- suitable pharmaceutical excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
- the present compositions if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
- compositions can take the form of solutions, suspensions, emulsion, tablets, pills, pellets, capsules, capsules containing liquids, powders, sustained- release formulations, suppositories, emulsions, aerosols, sprays, suspensions, or any other form suitable for use.
- the composition is in the form of a capsule (see e.g. U.S. Patent No. 5,698,155).
- suitable pharmaceutical excipients are described in Remington 's Pharmaceutical Sciences 1447-1676 (Alfonso R. Gennaro eds., 19th ed. 1995), incorporated herein by reference.
- the Coumarin-Based Compound is formulated in accordance with routine procedures as a composition adapted for oral administration to human beings.
- Compositions for oral delivery can be in the form of tablets, lozenges, aqueous or oily suspensions, granules, powders, emulsions, capsules, syrups, or elixirs for example.
- Orally administered compositions can contain one or more agents, for example, sweetening agents such as fructose, aspartame or saccharin; flavoring agents such as peppermint, oil of wintergreen, or cherry; coloring agents; and preserving agents, to provide a pharmaceutically palatable preparation.
- compositions can be coated to delay disintegration and absorption in the gastrointestinal tract thereby providing a sustained action over an extended period of time.
- Selectively permeable membranes surrounding an osmotically active driving a Coumarin-Based Compound are also suitable for orally administered compositions.
- fluid from the environment surrounding the capsule is imbibed by the driving compound, which swells to displace the agent or agent composition through an aperture.
- delivery platforms can provide an essentially zero order delivery profile as opposed to the spiked profiles of immediate release formulations.
- a time-delay material such as glycerol monostearate or glycerol stearate can also be useful.
- compositions can include standard excipients such as mannitol, lactose, starch, magnesium stearate, sodium saccharin, cellulose, and magnesium carbonate.
- the excipients are of pharmaceutical grade.
- the Coumarin-Based Compounds can be formulated for intravenous administration.
- compositions for intravenous administration comprise sterile isotonic aqueous buffer.
- the compositions can also include a solubilizing agent.
- Compositions for intravenous administration can optionally include a local anesthetic such as lignocaine to lessen pain at the site of the injection.
- the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized-powder or water- free concentrate in a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent.
- a hermetically sealed container such as an ampule or sachette indicating the quantity of active agent.
- the Coumarin-Based Compounds are to be administered by infusion, they can be dispensed, for example, with an infusion bottle containing sterile pharmaceutical grade water or saline.
- an ampule of sterile water for injection or saline can be provided so that the ingredients can be mixed prior to administration.
- Coumarin-Based Compounds can be administered by controlled-release or sustained-release means or by delivery devices that are well known to those of ordinary skill in the art. Examples include, but are not limited to, those described in U.S. Patent Nos. 3,845,770; 3,916,899; 3,536,809; 3,598,123; 4,008,719; 5,674,533; 5,059,595; 5,591,767; 5,120,548; 5,073,543; 5,639,476; 5,354,556; and 5,733,556, each of which is incorporated herein by reference in its entirety.
- Such dosage forms can be useful for providing controlled- or sustained-release of one or more active ingredients using, for example, hydropropylmethyl cellulose, other polymer matrices, gels, permeable membranes, osmotic systems, multilayer coatings, microparticles, liposomes, microspheres, or a combination thereof to provide the desired release profile in varying proportions.
- Suitable controlled- or sustained-release formulations known to those skilled in the art, including those described herein, can be readily selected for use with the active ingredients of the invention.
- the invention thus provides single unit dosage forms suitable for oral administration such as, but not limited to, tablets, capsules, ge leaps, and cap lets that are adapted for controlled- or sustained-release.
- a controlled- or sustained-release composition comprises a minimal amount of a Coumarin-Based Compound to treat or prevent the Condition over a period of time.
- Advantages of controlled- or sustained-release compositions include extended activity of the drug, reduced dosage frequency, and increased subject compliance.
- controlled- or sustained-release compositions can favorably affect the time of onset of action or other characteristics, such as blood levels of the Coumarin-Based Compound, and can thus reduce the occurrence of adverse side effects.
- Controlled- or sustained-release compositions can initially release an amount of a Coumarin-Based Compound that promptly produces the desired therapeutic or prophylactic effect, and gradually and continually release other amounts of the Coumarin-Based Compound to maintain this level of therapeutic or prophylactic effect over an extended period of time. To maintain a constant level of the Coumarin-Based Compound in the body, the Coumarin-Based Compound can be released from the dosage form at a rate that will replace the amount of Coumarin-Based Compound being metabolized and excreted from the body.
- Controlled- or sustained-release of an active ingredient can be stimulated by various conditions, including but not limited to, changes in pH, changes in temperature, concentration or availability of enzymes, concentration or availability of water, or other physiological conditions or compounds.
- the amount of the Coumarin-Based Compounds that is effective in the treatment or prevention of a Condition can be determined by standard clinical techniques.
- in vitro or in vivo assays can optionally be employed to help identify optimal dosage ranges.
- the precise dose to be employed can also depend on the route of administration, and the seriousness of the condition being treated and can be decided according to the judgment of the practitioner and each subject's circumstances in view of, e.g., published clinical studies.
- Suitable effective dosage amounts range from about 10 micrograms to about 5 grams about every 4 hours, although they are typically about 500 mg or less per every 4 hours.
- the effective dosage is about 0.01 mg, 0.5 mg, about 1 mg, about 50 mg, about 100 mg, about 200 mg, about 300 mg, about 400 mg, about 500 mg, about 600 mg, about 700 mg, about 800 mg, about 900 mg, about 1 g, about 1.2 g, about 1.4 g, about 1.6 g, about 1.8 g, about 2.0 g, about 2.2 g, about 2.4 g, about 2.6 g, about 2.8 g, about 3.0 g, about 3.2 g, about 3.4 g, about 3.6 g, about 3.8 g, about 4.O g, about 4.2 g, about 4.4 g, about 4.6 g, about 4.8 g, and about 5.0 g, every 4 hours.
- Equivalent dosages can be administered over various time periods including, but not limited to, about every 2 hours, about every 6 hours, about every 8 hours, about every 12 hours, about every 24 hours, about every 36 hours, about every 48 hours, about every 72 hours, about every week, about every two weeks, about every three weeks, about every month, and about every two months.
- the effective dosage amounts described herein refer to total amounts administered; that is, if more than one Coumarin-Based Compound is administered, the effective dosage amounts correspond to the total amount administered.
- compositions can be prepared according to conventional mixing, granulating or coating methods, respectively, and the present compositions can contain, in one embodiment, from about 0.1% to about 99%; and in another embodiment from about 1% to about 70% of the Coumarin-Based Compound by weight or volume.
- the dosage regimen utilizing the Coumarin-Based Compound can be selected in accordance with a variety of factors including type, species, age, weight, sex and medical condition of the subject; the severity of the condition to be treated; the route of administration; the renal or hepatic function of the subject; and the specific Coumarin-Based Compound employed.
- a person skilled in the art can readily determine the effective amount of the drug useful for treating or preventing the Condition.
- An Coumarin-Based Compound can be administered in a single daily dose, or the total daily dosage can be administered in divided doses of two, three or four times daily.
- a Coumarin-Based Compound can be administered in intranasal form via topical use of suitable intranasal vehicles, or via transdermal routes, using those forms of transdermal skin patches well known to those of ordinary skill in that art.
- the dosage administration can be continuous rather than intermittent throughout the dosage regimen.
- Other illustrative topical preparations include creams, ointments, lotions, aerosol sprays and gels, wherein the concentration of Coumarin-Based Compound ranges from about 0.1% to about 15%, w/w or w/v.
- the Coumarin-Based Compounds can be assayed in vitro or in vivo for the desired therapeutic or prophylactic activity prior to use in humans. Animal model systems can be used to demonstrate safety and efficacy.
- a Coumarin-Based Compound or pharmaceutical composition thereof is administered to a human that has an age in a range of from about 0 months to about 6 months old, from about 6 to about 12 months old, from about 6 to about 18 months old, from about 18 to about 36 months old, from about 1 to about 5 years old, from about 5 to about 10 years old, from about 10 to about 15 years old, from about 15 to about 20 years old, from about 20 to about 25 years old, from about 25 to about 30 years old, from about 30 to about 35 years old, from about 35 to about 40 years old, from about 40 to about 45 years old, from about 45 to about 50 years old, from about 50 to about 55 years old, from about 55 to about 60 years old, from about 60 to about 65 years old, from about 65 to about 70 years old, from about 70 to about 75 years old, from about 75 to about 80 years old, from about 80 to about 85 years old, from about 85 to about 90 years old, from about 90 to about 95 years old or from about 95 to about 100 years old.
- a Coumarin-Based Compound or pharmaceutical composition thereof is administered to a human infant. In other embodiments, a Coumarin- Based Compound or pharmaceutical composition thereof is administered to a human toddler. In other embodiments, a Coumarin-Based Compound or pharmaceutical composition thereof is administered to a human child. In other embodiments, a Coumarin-Based Compound or pharmaceutical composition thereof is administered to a human adult. In yet other embodiments, a Coumarin-Based Compound or pharmaceutical composition thereof is administered to an elderly human. [00282] In certain embodiments, a Coumarin-Based Compound or pharmaceutical composition thereof is administered a subject in an immunocompromised state or immunosuppressed state or at risk for becoming immunocompromised or immunosuppressed.
- a Coumarin-Based Compound or pharmaceutical composition thereof is administered to a subject receiving or recovering from immunosuppressive therapy.
- a Coumarin-Based Compound or pharmaceutical composition thereof is administered to a patient who is susceptible to adverse reactions to conventional anti- ⁇ -secretase therapies.
- a ⁇ -secretase inhibitor or pharmaceutical composition thereof is administered to a patient who has proven refractory to anti- ⁇ -secretase therapies other than ⁇ -secretase inhibitors, but are no longer on these therapies. Among these patients are refractory patients, and patients who are too young for conventional therapies.
- the subject being administered a Coumarin-Based
- Compound or pharmaceutical composition thereof has not received therapy prior to the administration of the Coumarin-Based Compound or pharmaceutical composition thereof.
- kits that can simplify the administration of a
- a typical kit of the invention comprises a unit dosage form of a Coumarin-
- the unit dosage form is a container, which can be sterile, containing an effective amount of a Coumarin-Based Compound and a pharmaceutically acceptable carrier or vehicle.
- the kit can further comprise a label or printed instructions instructing the use of the Coumarin-Based Compound to treat or prevent a Condition.
- the kit can also further comprise a unit dosage form of another prophylactic or therapeutic agent, for example, a container containing an effective amount of the other prophylactic or therapeutic agent.
- the kit comprises a container containing an effective amount of a Coumarin-Based Compound and an effective amount of another prophylactic or therapeutic agent. Examples of other prophylactic or therapeutic agents include, but are not limited to, those listed above.
- Example 1 General Procedure for the Synthesis of Coumarin-Based Compounds of Formulas I to IV, VI, VII, IX to XI, and XIII.
- Example 28 In Vitro Inhibition of ⁇ -Secretase Activity
- the assay protocol employed was a modified version of that described in Li et al., 2000, Proc. Nat 'I Acad. Sd. USA 97:6183-643, incorporated herein by reference. Briefly, recombinant peptide substrate was incubated with with ⁇ -secretase (40 ⁇ g/ml) in the presence or absence of test compound. The reaction mixture contained 0.25% CHAPSO, O.l ⁇ g/ ⁇ l BSA, protease inhibitor, 5OmM PIPES, pH 7.0, 5mM MgCl 2 , 5 mM CaCl 2 and 150 mM KCl.
- the reaction was incubated for 2.5 hr at 37 0 C and stopped by adding RIPA buffer (15OmM NaCl, 1.0% NP-40, 0.5% sodium deoxycholate, 0.1% SDS, 50 mM Tris HCl, pH 8.0).
- RIPA buffer 15OmM NaCl, 1.0% NP-40, 0.5% sodium deoxycholate, 0.1% SDS, 50 mM Tris HCl, pH 8.0.
- the products were detected with various antibody combinations using electrochemiluminescence (ECL) technology as previously described in Li et al., 2000, Proc. Nat 'I Acad. Sci. USA 97:6183-643; Lai et al., 2003, J. Biol. Chem. 278 : 22475-22481; and Yin et al., 2007, J. Biol. Chem. 282:23639-23644.
- the amount of product was determined using synthetic peptide or recombinant standards.
- Example 29 Cell-based Assay for Production of A ⁇ 38, A ⁇ 40 and A ⁇ 42 peptides
- the following cell-based assay can be used for assessing inhibitory activity of test compounds on ⁇ -secretase activity on APP expressed in stably transfected cells.
- Cells such as HEK239 or N2A cells that stably express APP are incubated 24-48 hr. in medium to which is added ⁇ -secretase with or without test compound. The conditioned medium is collected.
- Secreted A ⁇ peptides are detected by electrochemiluminescence (ECL) technology as previously described, for example, in Li et al., 2000, Proc. Nat 'I Acad. Sci.
- ECL electrochemiluminescence
- Concentration of A ⁇ peptides can be calculated from standard curves that are generated using synthetic peptides using the ECL assay.
- Results of a cell-based assay are provided in Figure 1 in which cells stably transfected with APP were incubated in medium containing ⁇ -secretase activity and the indicated amounts of compound 37. These results show that as concentrations of compound 37 are increased in the medium there is a decrease in the amount of A ⁇ 42 (triangles) secreted from the cells. The amounts of A ⁇ 38 (squares) and A ⁇ 40 (circles) secreted remain relatively constant between cells treated with different concentrations of compound 37.
- Example 30 Modulation of ⁇ -secretase specificity using small molecule allosteric inhibitors
- ⁇ -Secretase cleaves multiple substrates within the transmembrane domain that include the amyloid precursor protein as well as the Notch family of receptors. These substrates are associated with Alzheimer disease (AD) and cancer. Despite extensive investigation of this protease, little is known regarding the regulation of ⁇ -secretase specificity. To discover selective inhibitors for drug development and for probing the mechanisms of ⁇ -secretase specificity, we screened chemical libraries and consequently developed a di-coumarin family of inhibitors that preferentially inhibits ⁇ -secretase -mediated production of A ⁇ 42 over other cleavage activities.
- coumarin-dimer based compounds interact with ⁇ -secretase by binding to an allosteric site.
- This allosteric binding causes a conformational change within the active site of ⁇ -secretase at the S2 and Sl sub sites that leads to selective inhibition of A ⁇ 42.
- Uutilizing these di-coumarin compounds we reveal an unprecedented mechanism by which ⁇ -secretase specificity is regulated and provide insights into the molecular basis by which familial presenilin mutations may affect the active site and specificity of ⁇ -secretase.
- this class of selective inhibitors may be useful in medicine, and particularly in the development of AD therapeutics.
- ⁇ -Secretase is a multi-protein membrane -bound complex that is currently at the frontline of basic and translational research. It is composed of at least four proteins that include Presenilin, Nicastrin, Aph-1 and Pen-2 (1). Presenilin is believed to contain the active site of ⁇ -secretase (2-4). It represents a novel class of protease that catalyzes peptide bond hydrolysis within the transmembrane hydrophobic environment and plays an essential role in a newly emerged signaling pathway known as regulated intramembrane proteolysis (5).
- ⁇ -Secretase cleaves a variety of type I membrane proteins that include the amyloid precursor protein (APP) and the Notch family of proteins despite limited primary sequence homology across targeted substrates (6). Elucidation of the mechanisms that control the specificity of ⁇ -secretase for these substrates has been hindered due to technical difficulties associated with intramembrane enzymology. Determining the factors that contribute to ⁇ - secretase specificity is critical to understanding the biology of this unique protease and targeting it for therapeutic purposes.
- APP amyloid precursor protein
- ⁇ -Secretase is an appealing drug target for Alzheimer disease and cancer
- Secretase cleaves APP to generate neurotoxic A ⁇ peptides, ranging from 37 to 46 amino acids in length (7).
- a ⁇ 40 and A ⁇ 42 have been extensively investigated for their association with AD (7).
- disease-causing familial AD mutations (FAD) within APP, presenilin-1 (PS-I) and presenilin-2 (PS-2) proteins result in an increase in the ratio of A ⁇ 42 to A ⁇ 40 (see review (7)). Mutations in both enzyme and substrate can influence the specificity of ⁇ -secretase and lead to pathological consequences.
- Non-selective inhibition of ⁇ -secretase activity has been explored as an AD and cancer therapeutic approach, however the abrogation of all activities of ⁇ -secretase results in toxicity in the gastrointestinal tract due to the blockage of Notchl signaling (8). Therefore, the development of selective inhibitors is necessary to investigate ⁇ -secretase specificity and provide candidates for drug development.
- GSMs non-steroidal anti-inflammatory drugs
- GSMs non-steroidal anti-inflammatory drugs
- ⁇ -secretase modulators were able to selectively decrease ⁇ - secretase -mediated production of A ⁇ 42 with a concomitant increase in A ⁇ 38, and had no effect on A ⁇ 40 or Notchl cleavage (12).
- GSMs non-steroidal anti-inflammatory drugs
- other GSMs were determined to stimulate the production of A ⁇ 42 while reducing A ⁇ 38 cleavage.
- Subsequent studies have shown that these GSMs alter ⁇ -secretase cleavage preference by binding directly to the APP substrate and not to ⁇ -secretase (13).
- Di-coumarin compounds are selective ⁇ -secretase inhibitors in vitro
- the coumarin- dimer compounds also exhibited decreased potency for inhibition of Notch- 1 processing.
- these compounds could represent a novel class of inhibitors that selectively target A ⁇ 42 production.
- the most effective compound, CS-I exhibited in vitro IC 50 values of 0.07 ⁇ M, 0.31 ⁇ M, 0.71 ⁇ M, and 1.77 ⁇ M against A ⁇ 42, A ⁇ 40, A ⁇ 38, and Notch respectively.
- Di-coumarin compounds are selective ⁇ -secretase inhibitors in cells
- CS-I inhibited A ⁇ 42 production with an EC50 of approximately 3 ⁇ M in our cell-based assay, yet had virtually no effect on A ⁇ 38 or A ⁇ 40 production up to 30 ⁇ M (Fig. 3a). Furthermore, cytotoxicity studies using Alamar Blue indicated CS-I had little to no effect on cell viability up to 30 ⁇ M (data not shown). In addition, we found that CS-3 exhibited an identical inhibitory profile with a slightly increased EC50 for A ⁇ 42 inhibition ( ⁇ 5 ⁇ M). Compound E inhibited the production of all three ⁇ -amyloid species with equal potency (Fig. 3b), whereas indomethacin significantly enhanced A ⁇ 38 production, abrogated A ⁇ 42, and had no effect on A ⁇ 40 (Fig. 3c).
- the fragment expressed by the ⁇ E Notch construct is a membrane -tethered portion of the Notch- 1 receptor that is a direct substrate of ⁇ -secretase.
- ⁇ E Notch was transiently expressed in HEK-293 cells for 24 hrs in the presence of DMSO or GSI. The expression of ⁇ E Notch protein was confirmed by anti-Myc antibody. We found that Compound E effectively blocked all production of the Notch intracellular domain (NICD) as detected by the anti-NICDl SM320 antibody. However, CS-I at concentrations up to 30 ⁇ M, which was able to abrogate virtually all of A ⁇ 42 production, had no effect on NICD generation (Fig. 3e).
- Di-coumarin inhibitors are non-competitive inhibitors
- Di-coumarin inhibitors alter the subsites of the ⁇ -secretase active site
- L458 contains a hydroxyethylamine transition-state isostere that mimics the tetrahedral intermediate of aspartyl proteases and this moiety hydrogen bonds with the catalytic aspartate residues of ⁇ -secretase (20). According to the nomenclature of Schechter and Berger (24), L458 contains the P2, Pl, Pl', P2' and P3' residues that putatively bind to the S2, Sl, Sl', S2' and S3' subsites, respectively, within the active site of ⁇ -secretase (Fig. 4c).
- CS-I up to 100 ⁇ M did not block the L505 labeling of PSl-NTF and only slightly inhibited JC-8. This indicated that CSl binding has no significant effect on the Sl' and S3' subsites and supports the notion that CS-I and L458 do not bind at the same site within ⁇ -secretase (Fig. 4e, two upper panels).
- CS-I virtually abolished all of the labeling of PSl-NTF by L646 and GY-4 (Fig. 4e, two lower panels), which confirmed that this class of inhibitors directly interacts with ⁇ -secretase and that CS-I binding alters the S2 and Sl subpockets within the active site.
- ⁇ -Secretase cleaves numerous substrates that are involved in diverse biological processes.
- the multiple substrates of ⁇ -secretase appear to possess little primary sequence homology and consequently, the factors governing cleavage specificity remain unknown.
- the localization or compartmentalization of ⁇ -secretase substrates has been proposed as one mechanism to control its activity (27-28).
- ⁇ - secretase initiates proteolysis of APP at multiple sites.
- a ⁇ 42 is more hydrophobic and therefore more prone to aggregate and form the characteristic neurotoxic oligomers and fibrils associated with AD as compared to other ⁇ -amyloid species (29).
- a ⁇ species or substrates has been an appealing strategy for AD therapeutics. Establishment of these selective inhibitors could potentially reduce the Notch-related toxicity witnessed with current GSIs and maintain A ⁇ 40 production, which is thought to be neuroprotective against AD (10).
- AGSI coumarin-dimer class of allosteric GSIs
- AGSIs directly target ⁇ -secretase by binding to an allosteric site within the enzyme, rather than targeting the APP substrate.
- these coumarin-dimer compounds similarly affect ⁇ -secretase activity for A ⁇ 40 and A ⁇ 38 production and lack the interconnected effect witnessed with the GSMs whereby decreased A ⁇ 42 resulted in increased A ⁇ 38 generation, and vice versa (17). Therefore, these AGSIs represent a class of inhibitors that are distinct from the GSMs (12, 17) as well as previously reported GSIs (14-15, 18). It is noteworthy to point out that coumarin-dimer based compounds have been reported to be active against HIV integrase (32) and human NAD(P)H:quinine oxidoreductase-1 (33), as well as exhibit anticoagulant activity (34). However, the coumarin-dimer compounds that Nolan et al.
- AGSI binding is capable of altering the conformation of the catalytic core of ⁇ -secretase within the S2 and Sl subsites. These changes likely are the cause for differential inhibition of A ⁇ 42 over A ⁇ 38, A ⁇ 40 and Notch cleavage by the di-coumarin compounds. Therefore, it is conceivable that other factors influencing ⁇ -secretase cleavage specificity for A ⁇ 42 could similarly affect the S2 and Sl pockets.
- PS-I FAD mutations significantly affect A ⁇ 42 production and represent one potential pathological example whereby mutational alteration of the S2 and Sl subsites results in altered enzymatic specificity.
- ⁇ -Secretase is a large multi-protein complex composed of at least four proteins possessing 19 putative transmembrane domains.
- the complexity of ⁇ -secretase has made acquisition of its crystal structure a daunting challenge and it has not yet been successfully obtained.
- Our method thereby offers a practical chemical approach for elucidating the action mechanism of inhibitors against the ⁇ -secretase complex and other enzymes in which sufficient resolution of structures are not available or obtainable.
- photoreactive compounds are valuable tools for examining the active site of endogenous ⁇ -secretase and can be used to analyze factors that influence its conformation or to investigate differences across varied tissues or cell lines.
- the discovery of these selective AGSIs and development of our multiple photoaffinity small molecule approach has helped to elucidate a mechanism of ⁇ - secretase specificity and shed light on how ⁇ -secretase specificity is modulated.
- the family of di-coumarin compounds represents a novel class of drug candidates for therapeutic AD development and will be useful probes for unraveling the intricacies of this enigmatic protease under physiological and pathological conditions.
- the in vitro ⁇ -secretase assay detecting Notch cleavage was similar to the assays described above, however there were a few notable differences.
- the substrate used was a directly biotinylated Notch transmembrane domain peptide (Notch 1 -TM, acetyl- YVAAAAFVLLFFVGCGVLLSRKRRRQHGK-biotin).
- This Notch substrate was incubated with 40 ng/ ⁇ l solubilized ⁇ -secretase, 0.25% CHAPSO and 1% DMSO or GSI in the presence of IX PIPES, pH 7.0 buffer for 2.5 hrs at 37 0 C.
- Cleaved product was detected using the affinity polyclonal anti-NICD-1 antibody (SM320), which recognizes the cleaved product and not the substrate, as well as a ruthenylated secondary anti-rabbit antibody.
- SM320 affinity polyclonal anti-NICD-1 antibody
- the sample was then similarly incubated with magnetic streptavidin beads and quantified by measuring electrochemiluminescence .
- IP-MS Analysis of ⁇ -amyloid peptides from cell media IP-MS Analysis of ⁇ -amyloid peptides from cell media.
- the molecular masses of immunoprecipitated A ⁇ species were measured using a Voyager-DE STR matrix assisted laser desorption ionization time-of- flight mass spectrometer (Applied Biosystems). Each spectrum was collected using 750 laser shots. Mass spectra were calibrated using bovine insulin as internal mass calibrant. Peaks corresponding to A ⁇ peptides were identified using the measured molecular masses searching against human A ⁇ peptide.
- ⁇ E Notch or empty pcDNA3.1(-) construct was transfected into HEK-293 cells in a 6-well format using Lipofectamine reagent, following manufacturer's instructions. Transfection mixture was incubated with cells for 5 hrs at 37 0 C. Following incubation, media was removed and fresh media was added back containing 1% DMSO or GSI.
- AICD generation assay and photolabeling the ⁇ -Secretase Active Site were performed as previously described
- Weggen S, et al. (2001) A subset of ⁇ SAIDs lower amyloidogenic Abeta42 independently of cyclooxygenase activity. Nature 414:212-216.
- Notch-1 signalling requires ligand- induced proteolytic release of intracellular domain. Nature 393:382-386.
- Shearman MS et al. (2000) L-685,458, an aspartyl protease transition state mimic, is a potent inhibitor of amyloid beta-protein precursor gamma-secretase activity. Biochemistry 39:8698-8704.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Biomedical Technology (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Heterocyclic Compounds Containing Sulfur Atoms (AREA)
- Quinoline Compounds (AREA)
- Pyridine Compounds (AREA)
- Pyrane Compounds (AREA)
- Heterocyclic Carbon Compounds Containing A Hetero Ring Having Oxygen Or Sulfur (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2009330124A AU2009330124A1 (en) | 2008-12-22 | 2009-12-21 | Coumarin-based compounds for the treatment of Alzheimer's disease and cancer |
| CA2747811A CA2747811A1 (en) | 2008-12-22 | 2009-12-21 | Coumarin-based compounds |
| US13/140,791 US20110306605A1 (en) | 2008-12-22 | 2009-12-21 | Coumarin-based compounds for the treatment of alzheimer's disease and cancer |
| JP2011543615A JP2012513471A (ja) | 2008-12-22 | 2009-12-21 | アルツハイマー病および癌の治療のためのクマリン系化合物 |
| EP09775519A EP2379504A2 (en) | 2008-12-22 | 2009-12-21 | Coumarin-based compounds |
| US14/323,438 US20150133493A1 (en) | 2008-12-22 | 2014-07-03 | Coumarin-based compounds for the treatment of alzheimer's disease and cancer |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13983008P | 2008-12-22 | 2008-12-22 | |
| US61/139,830 | 2008-12-22 | ||
| US25581909P | 2009-10-28 | 2009-10-28 | |
| US61/255,819 | 2009-10-28 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/140,791 A-371-Of-International US20110306605A1 (en) | 2008-12-22 | 2009-12-21 | Coumarin-based compounds for the treatment of alzheimer's disease and cancer |
| US14/323,438 Continuation US20150133493A1 (en) | 2008-12-22 | 2014-07-03 | Coumarin-based compounds for the treatment of alzheimer's disease and cancer |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2010075280A2 true WO2010075280A2 (en) | 2010-07-01 |
| WO2010075280A3 WO2010075280A3 (en) | 2010-08-19 |
Family
ID=41785813
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2009/068989 Ceased WO2010075280A2 (en) | 2008-12-22 | 2009-12-21 | Coumarin-based compounds |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US20110306605A1 (https=) |
| EP (1) | EP2379504A2 (https=) |
| JP (2) | JP2012513471A (https=) |
| AU (1) | AU2009330124A1 (https=) |
| CA (1) | CA2747811A1 (https=) |
| WO (1) | WO2010075280A2 (https=) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102584841A (zh) * | 2011-12-16 | 2012-07-18 | 浙江工业大学 | 一种喹啉香豆素衍生物及其制备方法及用途 |
| CN102731458A (zh) * | 2012-07-12 | 2012-10-17 | 中国科学院南海海洋研究所 | 双异戊烯基香豆素及其制备方法和应用 |
| WO2013071267A1 (en) * | 2011-11-10 | 2013-05-16 | Cangene U.S., Incorporated | Compositions and methods for treating alzheimer's disease |
| CN104529987A (zh) * | 2014-12-04 | 2015-04-22 | 中国人民解放军第四军医大学 | 一类4-羟基双香豆素类化合物及其应用 |
| US9216217B2 (en) | 2010-03-03 | 2015-12-22 | The University Of British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
| CN105884681A (zh) * | 2014-10-24 | 2016-08-24 | 江苏师范大学 | 一种聚乙二醇中吡啶衍生物的合成方法 |
| CN108774204A (zh) * | 2018-06-13 | 2018-11-09 | 中国人民解放军第四军医大学 | 3,3′-(3,5二氟苯亚甲基)-双-4-羟基香豆素及其应用 |
| US10980251B2 (en) | 2011-06-26 | 2021-04-20 | Anitox Corporation | Cold weather formulation for conditioning animal feed |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP6509079B2 (ja) * | 2015-08-27 | 2019-05-08 | 株式会社ファンケル | ヘリピロンAを有効成分とするPGC1α産生促進剤 |
| CN112898278B (zh) * | 2019-11-19 | 2022-05-13 | 广东医科大学 | Sigma-2荧光配体的制备及应用 |
| CN111848565B (zh) * | 2020-07-24 | 2023-01-31 | 华润三九医药股份有限公司 | 单萜基双香豆素类化合物、药物组合物及其制备方法和用途 |
| CN112645922B (zh) * | 2020-12-24 | 2022-01-07 | 中国人民解放军空军军医大学 | 香豆素类化合物、制备方法及应用 |
Citations (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3536809A (en) | 1969-02-17 | 1970-10-27 | Alza Corp | Medication method |
| US3598123A (en) | 1969-04-01 | 1971-08-10 | Alza Corp | Bandage for administering drugs |
| US3845770A (en) | 1972-06-05 | 1974-11-05 | Alza Corp | Osmatic dispensing device for releasing beneficial agent |
| US3916899A (en) | 1973-04-25 | 1975-11-04 | Alza Corp | Osmotic dispensing device with maximum and minimum sizes for the passageway |
| US4008719A (en) | 1976-02-02 | 1977-02-22 | Alza Corporation | Osmotic system having laminar arrangement for programming delivery of active agent |
| US5059595A (en) | 1989-03-22 | 1991-10-22 | Bioresearch, S.P.A. | Pharmaceutical compositions containing 5-methyltetrahydrofolic acid, 5-formyltetrahydrofolic acid and their pharmaceutically acceptable salts in controlled-release form active in the therapy of organic mental disturbances |
| US5073543A (en) | 1988-07-21 | 1991-12-17 | G. D. Searle & Co. | Controlled release formulations of trophic factors in ganglioside-lipsome vehicle |
| US5120548A (en) | 1989-11-07 | 1992-06-09 | Merck & Co., Inc. | Swelling modulated polymeric drug delivery device |
| US5354556A (en) | 1984-10-30 | 1994-10-11 | Elan Corporation, Plc | Controlled release powder and process for its preparation |
| US5591767A (en) | 1993-01-25 | 1997-01-07 | Pharmetrix Corporation | Liquid reservoir transdermal patch for the administration of ketorolac |
| US5639476A (en) | 1992-01-27 | 1997-06-17 | Euro-Celtique, S.A. | Controlled release formulations coated with aqueous dispersions of acrylic polymers |
| US5674533A (en) | 1994-07-07 | 1997-10-07 | Recordati, S.A., Chemical And Pharmaceutical Company | Pharmaceutical composition for the controlled release of moguisteine in a liquid suspension |
| US5698155A (en) | 1991-05-31 | 1997-12-16 | Gs Technologies, Inc. | Method for the manufacture of pharmaceutical cellulose capsules |
| US5733556A (en) | 1995-10-18 | 1998-03-31 | Akzo Nobel N.V. | Newcastle disease virus combination vaccine |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| FR3801M (fr) * | 1963-10-31 | 1966-01-03 | Denys Monnier | Nouveaux médicaments anti-coagulants. |
| IL108459A0 (en) * | 1993-02-05 | 1994-04-12 | Opjohn Company | 4-Hydroxy-benzopyran-2-ones and 4-hydroxy-cycloalkyl [B] pyran-2-ones useful for treating infections due to hiv and other retroviruses |
| EP1448543A1 (en) * | 2001-10-01 | 2004-08-25 | PLIVA-ISTRAZIVACKI INSTITUT d.o.o. | Products of condensations of hydroxycoumarin derivatives with aromatic and aliphatic dialdehydes, their preparation and antiviral action thereof |
| US20060035245A1 (en) * | 2004-04-20 | 2006-02-16 | Ason Brandon L | Modulators of enzymatic nucleic acid elements mobilization |
| EP1846387A2 (en) * | 2005-01-14 | 2007-10-24 | GlaxoSmithKline istrazivacki centar Zagreb d.o.o. | Bis-(coumarin) compounds with anti-inflammatory activity |
| US20070037193A1 (en) * | 2005-08-12 | 2007-02-15 | Rong-Hwa Lin | Modulation of peroxisome proliferator-activated receptors |
| WO2007082178A2 (en) * | 2006-01-06 | 2007-07-19 | Abgenomics Corporation | Prostaglandin reductase inhibitors |
| WO2007112288A2 (en) * | 2006-03-23 | 2007-10-04 | Mount Sinai School Of Medicine | Cardiovascular composition and use the same for the treatment of alzheimers disease |
-
2009
- 2009-12-21 EP EP09775519A patent/EP2379504A2/en not_active Withdrawn
- 2009-12-21 US US13/140,791 patent/US20110306605A1/en not_active Abandoned
- 2009-12-21 JP JP2011543615A patent/JP2012513471A/ja active Pending
- 2009-12-21 WO PCT/US2009/068989 patent/WO2010075280A2/en not_active Ceased
- 2009-12-21 CA CA2747811A patent/CA2747811A1/en not_active Abandoned
- 2009-12-21 AU AU2009330124A patent/AU2009330124A1/en not_active Abandoned
-
2014
- 2014-07-03 US US14/323,438 patent/US20150133493A1/en not_active Abandoned
- 2014-09-26 JP JP2014196911A patent/JP2015038103A/ja active Pending
Patent Citations (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3536809A (en) | 1969-02-17 | 1970-10-27 | Alza Corp | Medication method |
| US3598123A (en) | 1969-04-01 | 1971-08-10 | Alza Corp | Bandage for administering drugs |
| US3845770A (en) | 1972-06-05 | 1974-11-05 | Alza Corp | Osmatic dispensing device for releasing beneficial agent |
| US3916899A (en) | 1973-04-25 | 1975-11-04 | Alza Corp | Osmotic dispensing device with maximum and minimum sizes for the passageway |
| US4008719A (en) | 1976-02-02 | 1977-02-22 | Alza Corporation | Osmotic system having laminar arrangement for programming delivery of active agent |
| US5354556A (en) | 1984-10-30 | 1994-10-11 | Elan Corporation, Plc | Controlled release powder and process for its preparation |
| US5073543A (en) | 1988-07-21 | 1991-12-17 | G. D. Searle & Co. | Controlled release formulations of trophic factors in ganglioside-lipsome vehicle |
| US5059595A (en) | 1989-03-22 | 1991-10-22 | Bioresearch, S.P.A. | Pharmaceutical compositions containing 5-methyltetrahydrofolic acid, 5-formyltetrahydrofolic acid and their pharmaceutically acceptable salts in controlled-release form active in the therapy of organic mental disturbances |
| US5120548A (en) | 1989-11-07 | 1992-06-09 | Merck & Co., Inc. | Swelling modulated polymeric drug delivery device |
| US5698155A (en) | 1991-05-31 | 1997-12-16 | Gs Technologies, Inc. | Method for the manufacture of pharmaceutical cellulose capsules |
| US5639476A (en) | 1992-01-27 | 1997-06-17 | Euro-Celtique, S.A. | Controlled release formulations coated with aqueous dispersions of acrylic polymers |
| US5591767A (en) | 1993-01-25 | 1997-01-07 | Pharmetrix Corporation | Liquid reservoir transdermal patch for the administration of ketorolac |
| US5674533A (en) | 1994-07-07 | 1997-10-07 | Recordati, S.A., Chemical And Pharmaceutical Company | Pharmaceutical composition for the controlled release of moguisteine in a liquid suspension |
| US5733556A (en) | 1995-10-18 | 1998-03-31 | Akzo Nobel N.V. | Newcastle disease virus combination vaccine |
Non-Patent Citations (77)
| Title |
|---|
| ALFONSO R. GENNARO: "Remington 's Pharmaceutical Sciences, 19th ed.", 1995, pages: 1447 - 1676 |
| BENTAHIR M ET AL.: "Presenilin clinical mutations can affect gamma-secretase activity by different mechanisms", J NEUROCHEM, vol. 96, 2006, pages 732 - 742 |
| BORCHELT DR ET AL.: "Familial Alzheimer's disease-linked presenilin 1 variants elevate Abetal-42/1-40 ratio in vitro and in vivo", NEURON, vol. 17, 1996, pages 1005 - 1013 |
| BROWN ET AL., CELL, vol. 100, 2000, pages 391 - 398 |
| BROWN MS; YE J; RAWSON RB; GOLDSTEIN JL: "Regulated intramembrane proteolysis: a control mechanism conserved from bacteria to humans", CELL, vol. 100, 2000, pages 391 - 398, XP002267181, DOI: doi:10.1016/S0092-8674(00)80675-3 |
| BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 507 |
| CHCN ET AL., NATURE, vol. 440, 2006, pages 1208 - 1212 |
| CHUN J; YIN YI; YANG G; TARASSISHIN L; LI YM: "Stereoselective Synthesis of Photoreactive Peptidomimetic gamma-Secretase Inhibitors", J ORG CHEM, vol. 69, 2004, pages 7344 - 7347, XP055016388, DOI: doi:10.1021/jo0486948 |
| DAL MASO ET AL., LANCET ONCOL, vol. 4, no. 2, 2003, pages 110 - 9 |
| DE STROOPER B: "Aph-1, Pen-2, and Nicastrin with Presenilin generate an active gamma-Secretase complex", NEURON, vol. 38, 2003, pages 9 - 12 |
| DE STROOPER, NEURON, vol. 38, 2003, pages 9 - 12 |
| DENG Y ET AL.: "Deletion of prcscnilin 1 hydrophilic loop sequence leads to impaired gamma-secretase activity and exacerbated amyloid pathology", J NEUROSC, vol. 26, 2006, pages 3845 - 3854 |
| DURING ET AL., ANN. NEURAL., vol. 25, 1989, pages 351 |
| EL-SERAG, J. CLIN. GASTROENTEROL., vol. 35, 2002, pages 572 - 8 |
| ESLER ET AL., NAT. CELL. BIOL., vol. 2, 2000, pages 428 - 434 |
| ESLER WP ET AL.: "Transition-state analogue inhibitors of gamma-secretase bind directly to presenilin-1", NAT CELL BIOL, vol. 2, 2000, pages 428 - 434, XP001042318, DOI: doi:10.1038/35017062 |
| GOODSON, MEDICAL APPLICATIONS OF CONTROLLED RELEASE, vol. 2, 1984, pages 115 - 138 |
| HARDY; SELKOE, SCIENCE, vol. 297, 2002, pages 353 - 356 |
| HARRISON T; CHURCHER I; BEHER D: "gamma-Secretase as a target for drug intervention in Alzheimer's disease", CURR OPIN DRUG DISCOV DEVEL, vol. 7, 2004, pages 709 - 719, XP008045520 |
| HECIMOVIC S ET AL.: "Mutations in APP have independent effects on Abeta and CTFgamma gcncration", NEUROBIOL DIS, vol. 17, 2004, pages 205 - 218, XP004592560, DOI: doi:10.1016/j.nbd.2004.04.018 |
| HERNANDEZ- AVILA ET AL., ARCHIVES OF MEDICAL RESEARCH, vol. 28, 1997, pages 265 - 271 |
| HERRMANN ET AL., J. PATHOT., vol. 199, no. 2, 2003, pages 140 - 5 |
| HOWARD ET AL., J NEUROSURG, vol. 71, 1989, pages 105 |
| JARRETT ET AL., BIOCHEMISTRY, vol. 32, 1993, pages 4693 - 4697 |
| JARRETT JT; BERGER EP; LANSBURY PT, JR.: "The C-terminus of the beta protein is critical in amyloidogenesis", ANN N YACAD SCI, vol. 695, 1993, pages 144 - 148 |
| KADOW ET AL., CURR. OPIN. INVESTIG. DRUGS, vol. 3, no. 11, 2002, pages 1574 - 9 |
| KANG ET AL., NATURE, vol. 325, 1987, pages 733 - 736 |
| KIM J ET AL.: "Abeta40 inhibits amyloid deposition in vivo", J NEUROSCI, vol. 27, 2007, pages 627 - 633, XP055107257, DOI: doi:10.1523/JNEUROSCI.4849-06.2007 |
| KITAGUCHI ET AL., NATURE, vol. 331, 1988, pages 530 - 532 |
| KOPAN R; GOATE A: "A common enzyme connects notch signaling and Alzheimer's disease", GENES DEV, vol. 14, 2000, pages 2799 - 2806 |
| KUKAR T ET AL.: "Diverse compounds mimic Alzheimer disease-causing mutations by augmenting Abeta42 production", NAT MED, vol. 11, 2005, pages 545 - 550 |
| KUKAR TL ET AL.: "Substrate-targeting gamma-secretase modulators", NATURE, vol. 453, 2008, pages 925 - 929 |
| KUMAR-SINGH S ET AL.: "Mean age-of-onset of familial alzheimer disease caused by presenilin mutations correlates with both increased Abeta42 and decreased Abeta40", HUM MUTAT, vol. 27, 2006, pages 686 - 695 |
| KUO ET AL., 1. BIOL. CHEM., vol. 271, 1996, pages 4077 - 4081 |
| LAI ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 22475 - 22481 |
| LAMMICH S ET AL.: "Presenilin-dependent intramembrane proteolysis of CD44 leads to the liberation of its intracellular domain and the secretion of an Abeta-like peptide", J BIOL CHEM, vol. 277, 2002, pages 44754 - 44759 |
| LANGCR AND WISE: "Medical Applications of Controlled Release", 1974 |
| LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
| LEVY ET AL., SCIENCE, vol. 228, 1935, pages 190 |
| LI ET AL., NATURE, vol. 405, 2000, pages 689 - 694 |
| LI ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 97, 2000, pages 6183 - 643 |
| LI YM ET AL.: "Photoactivated gamma-secretase inhibitors directed to the active site covalently label presenilin", NATURE, vol. 405, 2000, pages 689 - 694, XP001026218, DOI: doi:10.1038/35015085 |
| LI YM ET AL.: "Presenilin 1 is linked with gamma-secretase activity in the detergent solubilized state", PROC NATL ACAD SCI U S A, vol. 97, 2000, pages 613 8 - 6143 |
| LICHTENTHALER ET AL., BIOCHEMISTRY, vol. 36, 1997, pages 15396 - 15403 |
| LIPOSOMES, THERAPY OF INFECTIOUS DISEASE AND CANCER, 1989, pages 317 - 327,353-365 |
| MAYER SC ET AL.: "Discovery of begacestat, a Notch-1-sparing gamma-secretase inhibitor for the treatment of Alzheimer's disease", J MED CHEM, vol. 51, 2008, pages 7348 - 7351, XP002587471, DOI: doi:10.1021/JM801252W |
| MORTREUX ET AL., LEUKEMIA, vol. 17, no. 1, 2003, pages 26 - 38 |
| NETZER WJ ET AL.: "Gleevec inhibits beta-amyloid production but not Notch cleavage", PROC NATL ACAD SCI USA, vol. 100, 2003, pages 12444 - 12449 |
| NOLAN KA ET AL.: "Coumarin-based inhibitors of human NAD(P)H:quinone oxidoreductase-1. Identification, structure-activity, off-target effects and in vitro human pancreatic cancer toxicity", J MED CHEM, vol. 50, 2007, pages 6316 - 6325, XP002572997, DOI: doi:10.1021/JM070472P |
| OSCNKOWSKI P ET AL.: "Cryoclcctron microscopy structure of purified gamma-secretase at 12 A resolution", J MOL BIOL, vol. 385, 2009, pages 642 - 652, XP025861016, DOI: doi:10.1016/j.jmb.2008.10.078 |
| PLACANICA L ET AL.: "Pen2 and Presenilin-I Modulate the Dynamic Equilibrium of Presenilin-I and Presenilin-2 {gamma}-Secretase Complexes", J BIOL CHEM, vol. 284, 2009, pages 2967 - 2977 |
| PONTE ET AL., NATURE, vol. 331, 1988, pages 525 - 527 |
| RANGER; PEPPAS, J. MACROMOL. SD. REV. MACROMOL. CHEM., vol. 2, 1983, pages 61 |
| SAUDEK ET AL., N. ENGL. J MED., vol. 321, 1989, pages 574 |
| SCHECHTER I; BERGER A: "On the size of the active site in proteases. I. Papain", BIOCHEM BIOPHYS RES COMMUN, vol. 27, 1967, pages 157 - 162, XP000987004, DOI: doi:10.1016/S0006-291X(67)80055-X |
| SCHROETER EH; KISSLINGER JA; KOPAN R: "Notch-I signalling requires ligand- induced proteolytic release of intracellular domain", NATURE, vol. 393, 1998, pages 382 - 386, XP002916847, DOI: doi:10.1038/30756 |
| SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1987, pages 201 |
| SELKOE DJ: "Alzheimer's disease: genes, proteins, and therapy", PHYSIOL REV, vol. 81, 2001, pages 741 - 766 |
| SELKOE, NATURE, vol. 399, 1999, pages A23 - A31 |
| SELKOE, TRENDS CELL BIOL., vol. 8, 1998, pages 447 - 453 |
| SHEARMAN MS ET AL.: "L-685,458, an aspartyl protease transition state mimic, is a potent inhibitor of amyloid beta-protein precursor gamma-secretase activity", BIOCHEMISTRY, vol. 39, 2000, pages 8698 - 8704, XP002164178, DOI: doi:10.1021/bi0005456 |
| SMOLEN AND BALL: "Controlled Drug Bioavailability, Drug Product Design and Performance", 1984 |
| STRUHL; ADACHI, MOL. CELL, vol. 6, 2000, pages 625 - 636 |
| TARASSISHIN L; YIN YI; BASSIT B; LI YM: "Processing of Notch and amyloid precursor protein by gamma-secretase is spatially distinct", PROC NATL ACAD SCI USA, vol. 101, 2004, pages 17050 - 17055, XP002402343, DOI: doi:10.1073/pnas.0408007101 |
| TIAN G ET AL.: "Linear non-competitive inhibition of solubilized human gamma-secretase by pepstatin A methylester, L685458, sulfonamides, and benzodiazepines", J BIOL CHEM, vol. 277, 2002, pages 31499 - 31505 |
| VAN ES JH ET AL.: "Notch/gamma-secretase inhibition turns proliferative cells in intestinal crypts and adenomas into goblet cells", NATURE, vol. 435, 2005, pages 959 - 963, XP055106703, DOI: doi:10.1038/nature03659 |
| VETRIVEL KS ET AL.: "Spatial segregation of gamma-secretase and substrates in distinct membrane domains", J BIOL CHEM, vol. 280, 2005, pages 25892 - 25900 |
| WANG R; SWEENEY D; GANDY SE; SISODIA SS: "The profile of soluble amyloid beta protein in cultured cell media. Detection and quantification of amyloid beta protein and variants by immunoprecipitation-mass spectrometry", J BIOL CHEM, vol. 271, 1996, pages 31894 - 31902, XP002247951, DOI: doi:10.1074/jbc.271.50.31894 |
| WEGGEN S ET AL.: "A subset of NSAIDs lower amyloidogenic Abeta42 independently of cyclooxygenase activity", NATURE, vol. 414, 2001, pages 212 - 216, XP001206225, DOI: doi:10.1038/35102591 |
| WOLFE ET AL., NATURE, vol. 398, 1999, pages 513 - 517 |
| WOLFE MS ET AL.: "Two transmembrane aspartates in presenilin-1 required for presenilin endoproteolysis and gamma-secretase activity", NATURE, vol. 398, 1999, pages 513 - 517, XP002186848, DOI: doi:10.1038/19077 |
| YANG G ET AL.: "Stereo-controlled synthesis of novel photoreactive gamma-secretase inhibitors", BIOORG MED CHEM LETT, vol. 19, 2009, pages 922 - 925, XP025925853, DOI: doi:10.1016/j.bmcl.2008.11.117 |
| YIN ET AL., J. BIOL. CHEM., vol. 282, 2007, pages 23639 - 23644 |
| YIN YI ET AL.: "{gamma}-Secretase Substrate Concentration Modulates the Abeta42/Abeta40 Ratio: IMPLICATIONS FOR ALZHEIMER DISEASE", J BIOL CHEM, vol. 282, 2007, pages 23639 - 23644 |
| ZHAO H ET AL.: "Coumarin-based inhibitors of HIV integrase", J MED CHEM, vol. 40, 1997, pages 242 - 249, XP002092069, DOI: doi:10.1021/jm960450v |
| ZHOU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 102, 2005, pages 7499 - 7504 |
| ZHOU HY; HONG JL; SHU P; NI YJ; QIN MJ: "A new dicoumarin and anticoagulant activity from Viola yedoensis Makino", FITOTERAPIA, vol. 80, 2009, pages 283 - 285, XP026234725, DOI: doi:10.1016/j.fitote.2009.03.005 |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9216217B2 (en) | 2010-03-03 | 2015-12-22 | The University Of British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
| US9849165B2 (en) | 2010-03-03 | 2017-12-26 | The University Of British Columbia | Oligomer-specific amyloid beta epitope and antibodies |
| US10980251B2 (en) | 2011-06-26 | 2021-04-20 | Anitox Corporation | Cold weather formulation for conditioning animal feed |
| WO2013071267A1 (en) * | 2011-11-10 | 2013-05-16 | Cangene U.S., Incorporated | Compositions and methods for treating alzheimer's disease |
| CN102584841A (zh) * | 2011-12-16 | 2012-07-18 | 浙江工业大学 | 一种喹啉香豆素衍生物及其制备方法及用途 |
| CN102584841B (zh) * | 2011-12-16 | 2014-11-12 | 浙江工业大学 | 一种喹啉香豆素衍生物及其制备方法及用途 |
| CN102731458A (zh) * | 2012-07-12 | 2012-10-17 | 中国科学院南海海洋研究所 | 双异戊烯基香豆素及其制备方法和应用 |
| CN105884681A (zh) * | 2014-10-24 | 2016-08-24 | 江苏师范大学 | 一种聚乙二醇中吡啶衍生物的合成方法 |
| CN104529987A (zh) * | 2014-12-04 | 2015-04-22 | 中国人民解放军第四军医大学 | 一类4-羟基双香豆素类化合物及其应用 |
| CN108774204A (zh) * | 2018-06-13 | 2018-11-09 | 中国人民解放军第四军医大学 | 3,3′-(3,5二氟苯亚甲基)-双-4-羟基香豆素及其应用 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2379504A2 (en) | 2011-10-26 |
| CA2747811A1 (en) | 2010-07-01 |
| JP2015038103A (ja) | 2015-02-26 |
| JP2012513471A (ja) | 2012-06-14 |
| US20150133493A1 (en) | 2015-05-14 |
| WO2010075280A3 (en) | 2010-08-19 |
| AU2009330124A1 (en) | 2011-07-14 |
| US20110306605A1 (en) | 2011-12-15 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP2379504A2 (en) | Coumarin-based compounds | |
| EP2629776B1 (en) | Compounds, compositions and methods useful for cholesterol mobilisation | |
| EP2198863A1 (en) | Cancer treatment with gamma-secretase inhibitors | |
| EP3111956A1 (en) | Bmi 1 protein expression modulators | |
| TWI721136B (zh) | 特定苯並二氫呋喃類木脂素於抑制乳癌細胞轉移之用途 | |
| Carbone et al. | Marine terpenoid diacylguanidines: Structure, synthesis, and biological evaluation of naturally occurring actinofide and synthetic analogues | |
| US20150272962A1 (en) | Methods for treating or preventing cancer and neurodegenerative diseases | |
| Seidel et al. | Live-cell Imaging Analysis of Antimycin-Type Depsipeptides via SRS Microscopy | |
| AU2015227476B2 (en) | Compounds, compositions and methods useful for cholesterol mobilisation | |
| AU2016203507B2 (en) | Compounds, compositions and methods useful for cholesterol mobilisation | |
| HK1183797A (en) | Compounds, compositions and methods useful for cholesterol mobilisation | |
| HK1183797B (en) | Compounds, compositions and methods useful for cholesterol mobilisation |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09775519 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009330124 Country of ref document: AU Ref document number: 2747811 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2011543615 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2009330124 Country of ref document: AU Date of ref document: 20091221 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009775519 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13140791 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |