WO2009136070A1 - Nouveaux anticorps utiles pour le traitement du cancer - Google Patents

Nouveaux anticorps utiles pour le traitement du cancer Download PDF

Info

Publication number
WO2009136070A1
WO2009136070A1 PCT/FR2009/050612 FR2009050612W WO2009136070A1 WO 2009136070 A1 WO2009136070 A1 WO 2009136070A1 FR 2009050612 W FR2009050612 W FR 2009050612W WO 2009136070 A1 WO2009136070 A1 WO 2009136070A1
Authority
WO
WIPO (PCT)
Prior art keywords
cdr
sequence
sequence seq
antibody
identity
Prior art date
Application number
PCT/FR2009/050612
Other languages
English (en)
Inventor
Jean-François HAEUW
Original Assignee
Pierre Fabre Medicament
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to UAA201013336A priority Critical patent/UA105630C2/uk
Application filed by Pierre Fabre Medicament filed Critical Pierre Fabre Medicament
Priority to JP2011503478A priority patent/JP2011517565A/ja
Priority to NZ588887A priority patent/NZ588887A/xx
Priority to CA2720904A priority patent/CA2720904A1/fr
Priority to EP09742268A priority patent/EP2268671A1/fr
Priority to BRPI0909016A priority patent/BRPI0909016A2/pt
Priority to AU2009245587A priority patent/AU2009245587B2/en
Priority to MX2010011147A priority patent/MX2010011147A/es
Priority to CN2009801169974A priority patent/CN102027014A/zh
Priority to US12/576,824 priority patent/US8198413B2/en
Publication of WO2009136070A1 publication Critical patent/WO2009136070A1/fr
Priority to TNP2010000460A priority patent/TN2010000460A1/fr
Priority to IL208595A priority patent/IL208595A0/en
Priority to ZA2010/07751A priority patent/ZA201007751B/en
Priority to MA33315A priority patent/MA32288B1/fr
Priority to US13/306,839 priority patent/US20120171114A1/en
Priority to US13/440,259 priority patent/US8697855B2/en
Priority to US14/049,617 priority patent/US20140193329A1/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]

Definitions

  • the present invention relates to novel antibodies, in particular monoclonal antibodies of murine origin, chimeric and humanized, capable of inhibiting tumor growth as well as the amino acid and nucleic acid sequences coding for these antibodies.
  • the subject of the invention is novel antibodies, derived compounds or functional fragments capable of inhibiting the proliferation of tumor cells.
  • the invention also includes the use of these antibodies as a medicament for the prophylactic and / or therapeutic treatment of cancers as well as in methods or kits for diagnosing cancers.
  • the invention finally comprises products and / or compositions comprising such antibodies in combination, for example, with antibodies and / or anticancer agents or conjugated with toxins and their use for the prevention and / or treatment of certain cancers. .
  • CD151 also called PET A-3 or SFA-I
  • PET A-3 is a membrane protein belonging to the family of tetraspanins (Boucheix and Rubinstein, 2001, Molecular Life Sci 58, 1189-1205, Hemler, 2001, J. CeIl Biol 155, 1103-1107).
  • CD151 has 253 amino acids, and contains 4 membrane fragments and 2 extracellular domains EC1 (18 amino acids, sequence [40-57]) and EC2 (109 amino acids, sequence [113-221]), also called extracellular loops.
  • a mutation in the peptide sequence can be observed, namely a mutation of residues K (Lys) and P (Pro) respectively at positions 132 and 137 into residues R Arg) and S (Ser) [Fitter et al., 1995, Blood 86 (4), 1348-1355 / Hasegawa et al., 1996, J. Virol. 70 (5), 3258-3263].
  • CD1 51 is overexpressed in many cancers, such as for example lung cancers [Tokuhara et al, 2001, Clin. Cancer Res. 7, 4109-4114], colon [Hashida et al, 2003, Br. J. Cancer 89, 158-167], prostate [Ang et al, 2004, Cancer Epidemiol. Biomarkers Prev. 13, 1717-1721] or pancreas [Gesierich et al, 2005, Clin. Cancer Res. 11, 2840-2852].
  • lung cancers [Tokuhara et al, 2001, Clin. Cancer Res. 7, 4109-4114]
  • colon Hoashida et al, 2003, Br. J. Cancer 89, 158-167
  • prostate Ang et al, 2004, Cancer Epidemiol. Biomarkers Prev. 13, 1717-1721] or pancreas [Gesierich et al, 2005, Clin. Cancer Res. 11, 2840-2852].
  • CD151 is involved. in several cancer-related phenomena, such as cell adhesion (Nishiuchi et al, 2005, Proc Natl Acad Sci USA 102, 1939-1944, Winterwood et al, 2006, Mol Biol, Cell 17, 2707-2721). cell motility (Kohno et al., 2002, Int J. Cancer 97, 336-343), cell migration (Yauch et al., 1998, Mol Biol., 9, 2751-2765, Testa et al. Cancer Res 59, 3812-3820, Penas et al., 2000, J.
  • tetraspanins One of the remarkable properties of tetraspanins is their ability to associate with each other, as well as a large number of other surface molecules to form structured macromolecular complexes.
  • each tetraspanol is specifically associated with one or more surface molecules thus forming primary complexes, consisting of a tetraspinanine and a partner molecule.
  • Tetraspanins can organize particular microdomains of the plasma membrane within which they would recruit their molecular partners that could be functionally coupled.
  • the set of interactions involving tetraspanins has been referred to as the "tetraspanin network" or "Tetraspanin Web".
  • CD151 interacts on the cell surface with different membrane proteins.
  • CD151 is able to regulate the adhesion, migration and cellular invasion phenomena by modulating different signaling pathways, such as the phosphoinositide pathway via an association with PI4-kinase (Yauch et al, 1998, Mol Biol., 9, 2751-2765), the c-Jun signaling pathway via phosphorylation of FAK, Src, p38-MAPK and JNK (Hong et al, 2006, J. Biol Chem.
  • signaling pathways such as the phosphoinositide pathway via an association with PI4-kinase (Yauch et al, 1998, Mol Biol., 9, 2751-2765), the c-Jun signaling pathway via phosphorylation of FAK, Src, p38-MAPK and JNK (Hong et al, 2006, J. Biol Chem.
  • Homophilic interactions between cells are also responsible for an increase in cell motility and the expression of metalloproteinase
  • the monoclonal antibody 50-6 (isotype IgG1) directed against CD 151 was generated in mice by subtractive immunizations with human squamous cell carcinoma HEp-3 cells (Testa et al., 1999, Cancer Res 59, 3812-3820). .
  • the 50-6 antibody is able to inhibit in vitro the migration of transfected human HeLa cervical carcinoma cells to overexpress CD151 and HEp-3 cells, and angiogenesis in a bFGF-induced chorioallantoic membrane neovascularization model. (basic fibroblast growth factor).
  • bFGF-induced chorioallantoic membrane neovascularization model (basic fibroblast growth factor).
  • metastases induced by inoculation of HEp-3 cells in 2 mouse embryo models chicken (Testa et al., 1999, Cancer Res 59, 3812-3820).
  • the inhibitory activity of the 50-6 antibody is determined by measuring the activity of huPA protein (human urokinase-type plasminogen activator) in lung extracts.
  • this dosage reflects the presence of human cells in the lungs.
  • metastases spread of HEp-3 cells in the lungs of chicken embryos
  • the reduction of metastases is estimated, compared to a control antibody, to 74% in a so-called "metastasis” model.
  • spontaneous "in which the inoculation of the cells is followed by an injection of the antibody, and 57% in a so-called model of” experimental metastasis in which the cells and the antibody are inoculated together.
  • the anti-tumor properties of the antibody 50-6 observed in vivo do not seem to be related to a cytostatic or cytotoxic effect since it showed no effect on the in vitro proliferation of HEp-3 cells.
  • the hybridoma producing antibody 50-6 is available to ATCC as CRL-2696 (hybridoma initially deposited as 50-6 [PTA-227]).
  • Anti-CD151 SFA1.2B4 monoclonal antibody (IgG1 isotype) was generated in mice after intraperitoneal immunization with NIH 3T3 cells transfected with the human CD151 gene (Hasegawa et al, 1996, J. Virol. 70, 3258-3263).
  • the SFA1.2B4 antibody is capable of inhibiting in vitro the invasion and cell motility of various human tumor lines (Kohno et al., 2002, Int J. Cancer 97, 336-343). It inhibits in vivo the pulmonary metastases induced by colon cancer lines RPMI14788 and fibrosarcoma HT1080 transfected to overexpress CD151 (Kohn et al., 2002, Int J.
  • CD9 and CD82 are less expressed on primary tumors when There is metastasis and their decline in expression predicts a lower survival rate.
  • lung cancer the combined decrease in CD9 and CD82 expression was correlated with greater metastatic potential than when expression of only one of these two antigens was reduced.
  • CD 151 is associated with the aggressiveness of certain cancers, such as lung, colon and prostate cancers, and could be considered a factor of poor prognosis (Tokuhara et al, 2001 Clin Cancer Res, 7, 4109-4114, Hashida et al, 2003, Br.
  • the average survival is indeed decreased in patients whose tumor expresses CD151, compared to those whose tumor does not express CD151.
  • the subject of the invention is an isolated antibody, or one of its derivative compounds or functional fragments, capable of binding to the CD151 protein, said antibody being characterized in that it comprises at least one CDR selected from the CDRs of sequence SEQ ID No.
  • ком ⁇ онент of an antibody according to the invention is meant in particular an antibody fragment, such as fragments Fv, scFv (whether for single chain), Fab, F (ab ') 2, Fab', scFv-Fc or diabodies, or any fragment whose half-life duration would have been increased.
  • an antibody fragment such as fragments Fv, scFv (whether for single chain), Fab, F (ab ') 2, Fab', scFv-Fc or diabodies, or any fragment whose half-life duration would have been increased.
  • Such functional fragments will be described in detail later in this specification.
  • derivative compounds are well known to those skilled in the art and will be described in more detail in the following description.
  • the invention comprises the antibodies, their derived compounds or their functional fragments, according to the present invention, in particular chimeric or humanized, obtained by genetic recombination or by chemical synthesis.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention is characterized in that it consists of a monoclonal antibody.
  • a monoclonal antibody means an antibody derived from a substantially homogeneous antibody population. More particularly, the individual antibodies of a population are identical with the exception of a few possible mutations that can occur naturally which can be found in minute proportions.
  • a monoclonal antibody consists of a homogeneous antibody resulting from the proliferation of a single cell clone (for example a hybridoma, a eukaryotic host cell transfected with a DNA molecule encoding the homogeneous antibody, a cell prokaryotic host transfected with a DNA molecule encoding the homogeneous antibody, etc.) and which is generally characterized by heavy chains of one and the same class and subclass, and light chains of a single type .
  • the monoclonal antibodies are highly specific and are directed against a single antigen.
  • each monoclonal antibody is directed against a single epitope of the antigen.
  • the invention does not relate to antibodies in natural form, that is to say that they are not taken in their natural environment but that they could be isolated or obtained by purification from from natural sources, or obtained by genetic recombination, or by chemical synthesis, and they may then include non-natural amino acids as will be described later.
  • a first antibody which is characterized in that it comprises i) a light chain comprising at least one CDR chosen from CDR-L1,
  • CDR-L1 chosen from the CDRs of sequence SEQ ID No. 1 or 59, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 1 or 59
  • CDR-L2 chosen from the CDRs of sequence SEQ ID No. 2 or 60, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 2 or 60;
  • CDR-H1 chosen from CDRs of sequence SEQ ID No. 4 or 61, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 4 or 61;
  • CDR-H2 chosen from the CDRs of sequence SEQ ID No. 5 or 62, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 5 or 62;
  • - CDR-H3 chosen from CDRs of sequence SEQ ID No. 6 or 63, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 6 or 63.
  • a second antibody which is characterized in that it comprises i) a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L L3, with
  • CDR-L1 chosen from the CDRs of sequence SEQ ID No. 17 or 69, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 17 or 69
  • CDR-L2 chosen from the CDRs of sequence SEQ ID No. 18 or 70, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 18 or 70;
  • CDR-H1 chosen from CDRs of sequence SEQ ID No. 20 or 71, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 20 or 71;
  • CDR-H2 chosen from CDRs having the sequence SEQ ID No. 21 or 72, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 21 or 72;
  • CDR-H3 chosen from the CDRs of sequence SEQ ID No. 22 or 73, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 22 or 73.
  • a third antibody which is characterized in that it comprises i) a light chain comprising at least one CDR chosen from CDR-L1,
  • CDR-L1 chosen from the CDRs of sequence SEQ ID No. 33 or 79, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 33 or 79
  • CDR-L2 chosen from the CDRs of sequence SEQ ID No. 2 or 60, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 2 or 60;
  • CDR-H2 chosen from the CDRs of sequence SEQ ID No. 34 or 80, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 34 or 80;
  • a fourth antibody which is characterized in that it comprises i) a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3, with
  • CDR-L1 chosen from the CDRs of sequence SEQ ID No. 43 or 85, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 43 or 85;
  • CDR-L2 chosen from the CDRs of sequence SEQ ID No. 44 or 86, or at least one sequence that has at least 80% identity after optimal alignment with the sequence SEQ ID No. 44 or 86; CDR-L3 of sequence SEQ ID No. 45, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 45; and / or ii) a heavy chain comprising at least one CDR chosen from CDR-H1,
  • CDR-H2 and CDR-H3 with - CDR-H1 selected from the CDRs of sequence SEQ ID No. 46 or 87, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 46 or 87;
  • CDR-H2 chosen from CDRs of sequence SEQ ID No. 47 or 88, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 47 or 88;
  • CDR-H3 chosen from the CDRs of sequence SEQ ID No. 48 or 89, or at least one sequence which has at least 80% identity after optimal alignment with the sequence SEQ ID No. 48 or 89.
  • region CDR or CDR hypervariable regions of the heavy and light chains of immunoglobulins. There are 3 heavy chain CDRs and 3 light chain CDRs.
  • the term CDR or CDRs is used herein to designate, as appropriate, one or more or all of these regions which contain the majority of the amino acid residues responsible for the affinity binding of the antibody for the antigen or epitope that it recognizes.
  • the CDRs can be defined according to the IMGT system.
  • the unique IMGT numbering system has been defined to compare variable domains regardless of antigen, chain type, or species [Lefranc M.-P., Immunology Today 18, 509 (1997); Lefranc M.-P., The Immunologist, 7, 132-136 (1999); Lefranc, M.-P., Pommie, C, Ruiz, M., Giudicelli, V., Foulquier, E., Truong, L., Thouvenin-Contet, V. and Lefranc, Dev. Comp. Immunol., 27, 55-77 (2003)].
  • the single numbering system IMGT thus provides a standardized delimitation of the framework regions (FRl-IMGT: positions 1 to 26, FR2-IMGT: positions 39 to 55, FR3-IMGT: positions 66 to 104 and FR4 IMGT: positions 118 to 128) as well as complementarity determining regions or CDRs (CDR1-IMGT: positions 27 to 38, CDR2-IMGT: positions 56 to 65 and CDR3-IMGT: positions 105 to 117). Since "holes" or "spaces" represent unoccupied positions, the length of CDRs according to IMGT becomes crucial information.
  • the IMGT system is used in 2D graphical representations, referred to as IMGT bead collars [Ruiz, M.
  • the first antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively. sequence SEQ ID No.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID Nos. 1, 2 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 1, 2 and 3.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 4, and 6, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 4, 5 and 6.
  • the second antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively.
  • SEQ ID No. 17 ATPRIGTGF AY
  • SEQ ID No. 18 SEQ ID SEQ ID SEQ ID 19: QQYSSNPT
  • SEQ ID No. 20 GFTLSTSGMG
  • SEQ ID No. 21 IYWDDDK
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 20, 21 and 22, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 20, 21 and 22.
  • the third antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively. of sequence SEQ ID No. 33, 2 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 33, 2 and 3 sequences. ; and / or a heavy chain comprising at least one CDR chosen from CDR-H1, CDR-H2 and CDR-H3 respectively of sequence SEQ ID No. 4, 34 and 35, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with sequences SEQ ID Nos. 4, 34 and 35.
  • SEQ ID No. 33 ASVD YYGTSL
  • SEQ ID No. 34 ISSGGVTT
  • SEQ ID No. 35 TSPRTGTGFAY
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain.
  • a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID Nos. 33, 2 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 33, 2 and 3.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 4, 34 and 35, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 4, 34 and 35.
  • the fourth and last antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively of sequence SEQ ID No. 43, 44 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequences SEQ ID No. 43 , 44 and 45; and / or a heavy chain comprising at least one CDR chosen from CDR-H1, CDR-H2 and CDR-H3 respectively of sequence SEQ ID No. 46, 47 and 48, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 46, 47 and 48 sequences.
  • SEQ ID No. 43 ENVGTY SEQ ID No. 44: GAS SEQ ID No. 45: GQTYSFPYT SEQ ID No. 46: GYTFTSSS SEQ ID No. 47: IHPNSGNT SEQ ID No. 48: ARARSFYY CDMA
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID Nos. 43, 44 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID NOs 43, 44 and 45.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 46, 47 and 48, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequences SEQ ID No. 46, 47 and 48.
  • the CDRs can be defined according to the traditional approach of Kabat et al. (Kabat et al, Sequences of Proteins of Immunological Interest, 5 th Ed., US Department of Health and Human Services, NIH, 1991, and later editions).
  • the first antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence.
  • SEQ ID Nos. 59, 60 and 3 or having at least 80%, preferably 85%, 90%, 95% and
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 61,
  • the second antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively.
  • the protein sequences mentioned are as follows:
  • SEQ ID No. 69 KASQNVGIAVA
  • SASNRYT SEQ ID No. 71: STSGMGVS
  • SEQ ID No. 72 HIYWDDDKRYNPSLKS
  • SEQ ID NO: 73 RDHYGDYS YAMDY
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID Nos. 69, 70 and 19, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 69, 70 and 19.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 71, 72 and 73, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 71, 72 and 73 sequences.
  • the third antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively. of sequence SEQ ID No. 79, 60 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 79, 60 and 3 sequences. ; and / or a heavy chain comprising at least one CDR chosen from CDR-H1, CDR-H2 and CDR-H3 respectively of SEQ sequence ID No. 61, 80 and 81, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No.
  • SEQ ID No. 79 ASVD YYGTSL
  • SEQ ID No. 80 YISSGGVTTYYPDTIKG
  • SEQ ID No. 81 PRTGTGFAY
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID Nos. 79, 60 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 79, 60 and 3.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 61, 80 and 81, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 61, 80 and 81.
  • the fourth and last antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising at least one CDR chosen from CDR-L1, CDR-L2 and CDR-L3 respectively of sequence SEQ ID No. 85, 86 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequences SEQ ID No. 85 , 86 and 45; and / or a heavy chain comprising at least one CDR chosen from CDR-H1, CDR-H2 and CDR-H3 respectively of sequence SEQ ID No. 87, 88 and 89, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 87, 88 and 89.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID Nos. 85, 86 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 85, 86 and 45.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a heavy chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 87, 88 and 89, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 87, 88 and 89.
  • polypeptides polypeptide sequences, peptides and proteins attached to the antibody compounds or their sequence are interchangeable. It should be understood here that the invention does not relate to antibodies in natural form, that is to say that they are not taken in their natural environment but that they could be isolated or obtained by purification from from natural sources, or obtained by genetic recombination, or by chemical synthesis, and they may then include non-natural amino acids as will be described later.
  • percent identity between two nucleic acid or amino acid sequences in the sense of the present invention, it is meant to designate a percentage of nucleotides or identical amino acid residues between the two sequences to be compared, obtained after the best alignment (optimal alignment), this percentage being purely statistical and the differences between the two sequences being randomly distributed over their entire length.
  • sequence comparisons between two nucleic acid or amino acid sequences are traditionally performed by comparing these sequences after optimally aligning them, said comparison being possible by segment or by "comparison window”.
  • the optimal alignment of the sequences for comparison can be realized, besides manually, by means of the local homology algorithm of Smith and Waterman (1981) [Ad. App. Math.
  • the percentage identity between two nucleic acid or amino acid sequences is determined by comparing these two optimally aligned sequences in which the nucleic acid or amino acid sequence to be compared may comprise additions or deletions. relative to the reference sequence for optimal alignment between these two sequences.
  • the percentage of identity is calculated by determining the number of identical positions for which the nucleotide or amino acid residue is identical between the two sequences, by dividing this number of identical positions by the total number of positions in the comparison window. and multiplying the result obtained by 100 to obtain the percentage identity between these two sequences.
  • the BLAST program "BLAST 2 sequences” (Tatusova et al., "Blast 2 sequences - a new tool for comparing protein and nucleotide sequences", FEMS Microbiol Lett., 174: 247-250) can be used on the site http://www.ncbi.nlm.nih.gov/gorf/bl2.html, the parameters used being those given by default (in particular for the parameters "open gap penalty”: 5, and “extension gap penalty”: 2, the chosen matrix being for example the "BLOSUM 62" matrix proposed by the program), the percentage of identity between the two sequences to be compared being calculated directly by the program.
  • amino acid sequence having at least 80%, preferably 85%, 90%, 95% and 98% identity with a reference amino acid sequence those with respect to the reference sequence are preferred.
  • certain modifications in particular deletion, addition or substitution of at least one amino acid, truncation or elongation.
  • substitutions in which the substituted amino acids are replaced by "equivalent” amino acids are preferred.
  • the expression "equivalent amino acids” is intended herein to designate any amino acid capable of being substituted for one of the amino acids of the basic structure without, however, essentially modifying the biological activities of the corresponding antibodies and as they will be defined by following, especially in the examples.
  • These equivalent amino acids can be determined either by relying on their structural homology with the amino acids to which they are substituted, or on results of comparative tests of biological activity between the different antibodies that may be carried out.
  • Table 1 shows the possibilities of substitution that can be carried out without resulting in a thorough modification of the biological activity of the corresponding modified antibody, the reverse substitutions being naturally occurring. under the same conditions.
  • the preferred characteristic CDRs of the antibody according to the invention will be the 3 CDRs of the heavy chain and, even more preferably, the CDR corresponding to CDR-H3.
  • the present invention relates to a murine antibody, or one of its derivative compounds or functional fragments, according to the invention.
  • said first antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 1, 2 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 1, 2 and 3; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 4, 5 and 6, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 4, 5 and 6.
  • said first antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 59, 60 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 59, 60 and 3; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 61, 62 and 63, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 61, 62 and 63.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a sequence light chain comprising the amino acid sequence SEQ ID No. 7 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 7, and / or comprising a sequence heavy chain comprising the sequence of amino acid SEQ ID No. 8 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 8.
  • said second antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 17, 18 and 19, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 17, 18 and 19; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 20, 21 and 22, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 20, 21 and 22.
  • said second antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 69 , 70 and 19, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 69, 70 and 19; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 71, 72 and 73, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 71, 72 and 73.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a sequence light chain comprising the amino acid sequence SEQ ID No. 23 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 23, and / or comprising a sequence heavy chain comprising the sequence of amino acid SEQ ID No. 24 or having at least 80% of preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 24.
  • SEQ ID No. 23 DIVMTQSQKFMSTSEGDRVSITCKASQNVGIAVAWYQQKPGQSPKLLIYSASNR YTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSNPTFGAGTKLELK
  • SEQ ID NO. 24 DIVMTQSQKFMSTSEGDRVSITCKASQNVGIAVAWYQQKPGQSPKLLIYSASNR YTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSNPTFGAGTKLELK
  • said third antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 33, 2 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 33, 2 and 3; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 4, 34 and 35, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 4, 34 and 35.
  • said third antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 79, 60 and 3, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 79, 60 and 3; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 61, 80 and 81, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 61, 80 and 81.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a sequence light chain comprising the amino acid sequence SEQ ID No. 36 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 36, and / or in that it comprises a heavy sequence chain comprising the amino acid sequence SEQ ID No. 37 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 37.
  • SEQ ID No. 37 EVKLVESGGDLVQPGGSLKLSCAASGFTFSTYTMSWVRQTPEKRLEWVAYISS GGVTTYYPDTIKGRFTISRDNAKNTLFLQMNSLKSEDTAMYYCTSPRTGTGFAY WGQGTLVTVSA
  • said fourth antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to IMGT, respectively of sequence SEQ ID No. 43, 44 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID NOs 43, 44 and 45; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 46, 47 and 48, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID No. 46, 47 and 48.
  • said fourth antibody, or one of its derivative compounds or functional fragments comprises a light chain comprising the three CDRs, as defined according to Kabat, respectively of sequence SEQ ID No. 85 , 86 and 45, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 85, 86 and 45; and a heavy chain comprising the three CDRs respectively of sequence SEQ ID Nos. 87, 88 and 89, or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with SEQ ID Nos. 87, 88 and 89.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention comprises a sequence light chain comprising the amino acid sequence SEQ ID No. 49 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 49, and / or in that it comprises a sequence heavy chain comprising the sequence of amino acid SEQ ID No. 50 or having at least 80%, preferably 85%, 90%, 95% and 98% identity after optimal alignment with the sequence SEQ ID No. 50.
  • the invention also relates to any compound derived from an antibody according to the invention.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention is characterized in that said derivative compound consists of a binding protein comprising a peptide framework on which is grafted at least one CDR of to retain all or part of the paratopic properties of recognition of the initial antibody.
  • One or more of the sequences of the CDRs described in this invention can also be presented on protein frames (or "scaffolds" according to the English nomenclature) different from immunoglobulins.
  • the protein sequence makes it possible to recreate a peptide backbone that is favorable to the folding of the grafted CDR (s), enabling it (them) to retain their paratopic properties of recognition of the antigen.
  • the origin of such proteinaceous frameworks can be, but is not limited to structures selected from: fibronectin and preferentially the 10th domain of fibronectin type 3, lipocalin, anticalin (Skerra A., J. Biotechnol 2001, 74 (4): 251 -IS), the protein Z derived from the B domain of Staphylococcus aureus protein A, thioredoxin A or the repeat-motif proteins of the "ankyrin repeat" type (Kohi et al, PNAS, 2003, vol.100, No. 4, 1700-1705), "armadillo repeat", “leucine-rich repeat” or "tetratricopeptide repeat”.
  • frameworks derived from toxins such as, for example, the following toxins derived from scorpions, insects, plants, molluscs, etc.) or protein inhibitors of neuronal NO synthase (PIN).
  • such peptide frameworks may comprise from 1 to 6 CDR (s) derived from the original antibody.
  • CDR derived from the original antibody.
  • those skilled in the art will select at least one CDR from the heavy chain, the latter being known to be mainly responsible for the specificity of the antibody.
  • the selection of the relevant CDR (s) is obvious to those skilled in the art, the latter then implementing known techniques (Bes et al., FEBS Letters 508, 2001 67-74).
  • the subject of the present invention is therefore an antibody, or one of its derivative compounds or functional fragments, characterized in that the peptide framework is selected from the proteins a) phylogenetically well conserved, b) of robust architecture, c) with a well-known three-dimensional molecular organization, d) of small size and / or e) comprising regions which can be modified by deletion and / or insertion without modifications of the stability properties.
  • the antibody, or one of its derivative compounds or functional fragments, according to the invention is characterized in that said peptide framework is selected from i) the frameworks derived from fibronectin, preferentially the 10th fibronectin type 3, lipocalin, anticalin, protein Z derived from domain B of Staphylococcus aureus protein A, thioredoxin A, ii) repetitive pattern proteins of the "ankyrin repeat” type, "armadillo repeat ",” leucine-rich repeat “or” tetratricopeptide repeat ", or iii) protein inhibitors of neuronal NO synthase (PIN).
  • the functional fragments of the antibody described above are also made to the functional fragments of the antibody described above.
  • the invention is directed to an antibody, or one of its derivative compounds or functional fragments, the invention characterized in that the said functional fragment is chosen from the Fv, Fab, (Fab ') 2, Fab' fragments, scFv, scFv-Fc and diabodies, or any fragment whose half life was increased as pegylated fragments.
  • Such functional fragments of antibodies according to the invention consist, for example, of fragments Fv, scFv (for simple chain), Fab, F (ab ') 2 , Fab', scFv-Fc or diabodies, or any fragment whose half-life time would have been increased by chemical modification, such as the addition of poly (alkylene) glycol such as poly (ethylene) glycol (“PEGylation") (PEGylated fragments called Fv-PEG, scFv-PEG, Fab -PEG, F (ab ') 2 -PEG or Fab'-PEG) ("PEG” according to the English nomenclature Poly (Ethylene) Glycol), or by incorporation into a liposome, microspheres or PLGA, said fragments exhibiting at least one of the characteristic CDRs according to the invention, and in particular, in that it is capable of generally exercising a very partial activity of the antibody from which it is derived.
  • poly (alkylene) glycol
  • said functional fragments will be constituted or will comprise a partial sequence of the heavy or light variable chain of the antibody of which they are derivatives, said partial sequence being sufficient to retain the same binding specificity as the antibody from which it is derived and a sufficient affinity, preferably at least equal to 1/100, more preferably at least 1/10 that of the antibody from which it is derived.
  • Such a functional fragment will comprise at least 5 amino acids, preferably 10, 15, 25, 50 and 100 consecutive amino acids of the sequence of the antibody from which it is derived.
  • these functional fragments will be fragments of the Fv, scFv, Fab, F (ab ') 2, F (ab'), scFv-Fc or diabodies type, which generally have the same binding specificity as the antibody for which they are present. are from.
  • antibody fragments of the invention can be obtained from antibodies as previously described by methods such as digestion with enzymes, such as pepsin or papain and / or by cleavage of disulfide bridges. by chemical reduction.
  • the antibody fragments included in the present invention may be obtained by genetic recombination techniques well known to those skilled in the art or by peptide synthesis using, for example, automatic peptide synthesizers such as than those provided by Applied Biosystems, etc.
  • the present invention relates to a chimeric antibody, or one of its derivative compounds or functional fragments, according to the invention, characterized in that said antibody further comprises the constant regions of light chain and of heavy chain derived from an antibody of a mouse heterologous species, in particular from humans.
  • the humanized antibody or one of its derivative compounds or functional fragments, is characterized in that the light chain and heavy chain constant regions derived from a human antibody are respectively the lambda region or kappa and gamma-1, gamma-2 or gamma-4.
  • the invention relates to a first murine hybridoma capable of secreting a monoclonal antibody according to the present invention, in particular the hybridoma of murine origin as deposited at the National Microorganism Culture Center (CNCM) (Pasteur Institute). , Paris, France) on February 22, 2008 under number 1-3920.
  • Said hybridoma was obtained by fusion of splenocytes of immunized Balb / c mice and Sp 20 Ag 14 myeloma cell lines.
  • monoclonal called here 203B6, or one of its derivative compounds or functional fragments is secreted by said hybridoma deposited at the CNCM February 22, 2008 under the number 1-3920.
  • the invention relates to a second murine hybridoma capable of secreting a monoclonal antibody according to the present invention, in particular the hybridoma of murine origin as deposited at the National Center for Culture of Microorganism (CNCM) (Institut Pasteur , Paris, France) on February 22, 2008 under number 1-3921.
  • Said hybridoma was obtained by fusion of splenocytes from Balb / c immunized mice and Sp 20 Ag 14 myeloma cell lines.
  • the monoclonal antibody referred to herein as 205H8, or one of its derivative compounds or functional fragments, is secreted by said hybridoma. filed with the CNCM on February 22, 2008 under the number 1-3921.
  • the invention relates to a third murine hybridoma capable of secreting a monoclonal antibody according to the present invention, in particular the hybridoma of murine origin as deposited at the National Center for Microorganism Culture (CNCM) (Institut Pasteur , Paris, France) on February 21, 2008 under number 1-3918.
  • Said hybridoma was obtained by fusion of splenocytes from Balb / c immunized mice and Sp 20 Ag 14 myeloma cell lines.
  • the monoclonal antibody referred to herein as 211F3, or one of its derivative compounds or functional fragments, is secreted by said hybridoma. filed with the CNCM on February 21, 2008 under number 1-3918.
  • the invention relates to a fourth murine hybridoma capable of secreting a monoclonal antibody according to the present invention, in particular the hybridoma of murine origin as deposited at the National Microorganism Culture Center (CNCM) ( Institut Pasteur, Paris, France) on February 21, 2008 under number 1-3919.
  • Said hybridoma was obtained by fusion of Balb / c immunized mouse splenocytes and Sp 20 Ag 14 myeloma cell lines.
  • the monoclonal antibody designated here 214B2, or one of its derivative compounds or functional fragments, is secreted by said hybridoma. filed with the CNCM on February 21, 2008 under number 1-3919.
  • Table 2 groups the different amino acid sequences corresponding to the different antibodies according to the invention with the CDR sequences defined according to IMGT in bold and those defined according to Kabat in italics.
  • Antibodies according to the present invention also include chimeric or humanized antibodies.
  • chimeric antibody an antibody which contains a naturally occurring variable (light chain and heavy chain) derived from an antibody of a given species in association with the light chain and heavy chain constant regions of an antibody of a heterologous species to said given species.
  • the antibodies or their chimeric-like fragments according to the invention can be prepared using genetic recombination techniques.
  • the chimeric antibody may be made by cloning a recombinant DNA comprising a promoter and a sequence coding for the variable region of a non-human monoclonal antibody, in particular murine monoclonal antibody, according to the invention and a sequence coding for the constant region.
  • human antibody A chimeric antibody of the invention encoded by such a recombinant gene will for example be a mouse-human chimera, the specificity of this antibody being determined by the variable region derived from murine DNA and its isotype determined by the constant region derived from the murine DNA. Human DNA.
  • Verhoeyn et al. BioEssays, 8:74, 1988.
  • humanized antibodies is meant an antibody which contains CDRs regions derived from an antibody of non-human origin, the other parts of the antibody molecule being derived from one (or more) human antibodies.
  • some of the skeletal segment residues (referred to as FR) may be modified to maintain binding affinity (Jones et al., Nature, 321: 522-525, 1986; Verhoeyen et al., Science, 239: 1534-1536 1988, Riechmann et al., Nature 332: 323-327, 1988).
  • the humanized antibodies according to the invention or their fragments may be prepared by techniques known to those skilled in the art (as for example those described in the documents Singer et al., J.
  • Such humanized antibodies according to the invention are preferred for use in in vitro diagnostic methods, or in vivo prophylactic and / or therapeutic treatment.
  • Other humanization techniques are also known to those skilled in the art, for example the "CDR Grafting" technique described by PDL which is the subject of patents EP 0 451 261, EP 0 682 040 and EP 0 939. 127, EP 0 566 647 or US 5,530,101, US 6,180,370, US 5,585,089 and US 5,693,761. It is also possible to mention US Pat. Nos. 5,639,641, 6,054,297, 5,886,152 and 5,877,293.
  • the invention also relates to the humanized antibodies derived from the murine antibodies described above.
  • the light chain and heavy chain constant regions derived from a human antibody are respectively the lambda or kappa region and gamma-1, gamma-2 or gamma-4.
  • an additional feature of the antibody is to exhibit effector functions such as ADCC (according to the English nomenclature “Antibody Dependent Cellular Cytotoxicity”) and / or the CDC (according to the English nomenclature “Complement Depends Cytotoxicity”).
  • the antibody that is the subject of the present invention is characterized by antibodies known to date in that it is capable of inhibiting the proliferation of tumor cells.
  • the CD 151 protein belongs to the family of tetraspanins and, as such, comprises 2 extracellular domains EC1 (18 amino acids, sequence [40-57]) and EC2 (109 amino acids, sequence [113-221]), also called extracellular loops.
  • the antibodies used are capable of binding to at least one epitope located in the extracellular domain.
  • said antibody will bind at the EC1 and / or EC2 loops.
  • EC2 extracellular loop 1
  • EC2 EC2
  • amino acids 40-57 and 113-221 respectively of the CD151 protein.
  • the loop EC1 [40-57] comprises 18 amino acids and has a theoretical mass of 2002.2 Da.
  • the EC2 loop [113-221] has a N-glycosylation site (Asn159 residue) and 6 Cysteine residues forming 3 disulfide bridges.
  • a structural model of the EC2 loop of tetraspanins, and in particular of CD151, has been proposed from the three-dimensional structure of the EC2 loop of CD81 tetraspinanine (Seigneuret et al., 2001, J. Biol Chem 276, 40055- 40064). According to this model, tetraspanins have a common, relatively conserved framework consisting of 3 ⁇ -helices and a variable specific domain. For CD151, this framework would consist of the regions [113-157] and [209-221], and the variable domain of the region [158-208].
  • variable domain of the EC2 loop would be more specifically involved in the specific interactions of CD151 with proteins of the family of integrins.
  • the present invention is directed to the use of at least one anti-CD151 antibody, or a functional fragment thereof, capable of binding to an epitope of the EC2 region.
  • the present invention relates to an isolated nucleic acid characterized in that it is selected from the following nucleic acids: a) a nucleic acid, DNA or RNA, encoding an antibody, or one of its derived compounds or functional fragments, as defined above; b) a nucleic acid complementary to a nucleic acid as defined above in a); c) a nucleic acid of at least 18 nucleotides capable of hybridizing under conditions of high stringency with at least one of the nucleic acid sequences SEQ ID No.
  • Table 3 below groups the different nucleotide sequences relating to the antibodies according to the invention with the CDR sequences defined according to IMGT in bold and those defined according to Kabat in italics.
  • nucleic acid nucleic or nucleic acid sequence, polynucleotide, oligonucleotide, polynucleotide sequence, nucleotide sequence, terms which will be used indifferently in the present description, is meant to designate a precise sequence of nucleotides, modified or otherwise, to define a fragment or a region of a nucleic acid, with or without unnatural nucleotides, and which may correspond to both a double-stranded DNA, a single-stranded DNA and transcripts of said DNAs.
  • nucleotide sequences in their natural chromosomal environment i.e., in the natural state.
  • sequences that have been isolated and / or purified that is to say that they have been taken directly or indirectly, for example by copy, their environment has been at least partially modified. It is thus also meant here to designate isolated nucleic acids obtained by genetic recombination by means of, for example, host cells or obtained by chemical synthesis.
  • nucleic sequences having an identity percentage of at least 80%, preferably 85%, 90%, 95% and 98%, after optimal alignment with a sequence of preference are meant nucleic sequences having, relative to the reference nucleic sequence, certain modifications such as in particular a deletion, a truncation, an elongation, a chimeric fusion and / or a substitution, in particular punctual. These are preferably sequences whose sequences encode the same amino acid sequences as the reference sequence, this linked to the degeneracy of the genetic code, or complementary sequences that are likely to hybridize specifically with the sequences. reference preferably under conditions of high stringency especially as defined below.
  • Hybridization under high stringency conditions means that the temperature and ionic strength conditions are chosen such that they allow the maintenance of hybridization between two complementary DNA fragments.
  • conditions of high stringency of the hybridization step for the purpose of defining the polynucleotide fragments described above are advantageously as follows.
  • DNA-DNA or DNA-RNA hybridization is carried out in two steps: (1) prehybridization at 42 ° C for 3 hours in phosphate buffer (20 mM, pH 7.5) containing 5 x SSC (1 x SSC corresponds to one solution 0.15 M NaCl + 0.015 M sodium citrate), 50% formamide, 7% sodium dodecyl sulfate (SDS), 10 x Denhardt's, 5% dextran sulfate and 1% salmon sperm DNA; (2) hybridization proper for 20 hours at a temperature dependent on the size of the probe (ie: 42 ° C, for a probe size> 100 nucleotides) followed by 2 washes of 20 minutes at 20 0 C in 2 x SSC + 2% SDS, 1 wash for 20 minutes at 20 ° C.
  • the invention also relates to a vector comprising a nucleic acid according to the present invention.
  • the invention particularly relates to the cloning and / or expression vectors which contain a nucleotide sequence according to the invention.
  • the vectors according to the invention preferably comprise elements which allow the expression and / or the secretion of the nucleotide sequences in a specific host cell.
  • the vector must then include a promoter, translation initiation and termination signals, as well as appropriate transcriptional regulatory regions. It must be able to be stably maintained in the host cell and may possibly have particular signals that specify the secretion of the translated protein. These different elements are chosen and optimized by those skilled in the art depending on the cellular host used.
  • nucleotide sequences according to the invention can be inserted into vectors with autonomous replication within the chosen host, or be integrative vectors of the chosen host.
  • vectors are prepared by methods commonly used by those skilled in the art, and the resulting clones can be introduced into a suitable host by standard methods, such as lipofection, electroporation, heat shock, or chemical methods. .
  • the vectors according to the invention are for example vectors of plasmid or viral origin. They are useful for transforming host cells in order to clone or express the nucleotide sequences according to the invention.
  • the invention also includes host cells transformed with or comprising a vector according to the invention.
  • the cellular host may be chosen from prokaryotic or eukaryotic systems, for example bacterial cells, but also yeast cells or animal cells, in particular mammalian cells. Insect cells or plant cells can also be used.
  • the invention also relates to animals, except humans, which comprise a transformed cell according to the invention.
  • the subject of the invention is a method for producing an antibody, or one of its functional fragments according to the invention, characterized in that it comprises the following steps: a) culturing in a suitable medium and culture conditions of a host cell according to the invention; and b) recovering said antibodies, or a functional fragment thereof, thereby produced from the culture medium or said cultured cells.
  • the cells transformed according to the invention can be used in processes for preparing recombinant polypeptides according to the invention.
  • the methods for preparing a polypeptide according to the invention in recombinant form characterized in that they implement a vector and / or a cell transformed with a vector according to the invention are themselves included in the present invention.
  • a cell transformed with a vector according to the invention is cultured under conditions which allow the expression of said polypeptide and said recombinant peptide is recovered.
  • the cellular host may be selected from prokaryotic or eukaryotic systems.
  • a vector according to the invention carrying such a sequence can therefore be advantageously used for the production of recombinant proteins, intended to be secreted. Indeed, the purification of these recombinant proteins of interest will be facilitated by the fact that they are present in the supernatant of the cell culture rather than inside the host cells.
  • the polypeptides according to the invention can also be prepared by chemical synthesis. Such a preparation method is also an object of the invention.
  • the antibodies, or one of their derivative compounds or functional fragments, obtainable by a process according to the invention are also included in the present invention.
  • the present invention relates to an antibody as described above, characterized in that it is, in addition, bispecific, that is to say capable to bind specifically to a human protein or a human receptor other than CD151.
  • Bispecific or bifunctional antibodies are a second generation of monoclonal antibodies in which two different variable regions are combined in the same molecule (Hollinger and Bohlen 1999 Cancer and Metastasis Rev. 18: 411-419). Their utility has been demonstrated both in the field of diagnosis and in the field of therapy by their ability to recruit new effector functions or to target several molecules on the surface of tumor cells.
  • These antibodies can be obtained by chemical methods (Glennie MJ et al., 1987 J. Immunol 139, 2367-2375, Repp R. et al., 1995 J. Hemat 377-382) or somatic (Staerz UD and Bevan MJ.
  • bispecific antibodies can be constructed as whole IgG, as bispecific Fab'2, as Fab'PEG or as diabodies or as bispecific scFv but also as a bispecific tetravalent antibody where two binding sites are present for each antigen targeted (Park et al., Mol Mol., Immunol 37 (18): 1123-30) or fragments thereof as described above.
  • bispecific antibodies In addition to the economic advantage that the production and administration of a bispecific antibody is less expensive than the production of two specific antibodies, the use of such bispecific antibodies has the advantage of reducing the toxicity of the treatment. Indeed, the use of a bispecific antibody makes it possible to reduce the overall quantity of circulating antibodies and, consequently, the possible toxicity.
  • the bispecific antibody is a divalent or tetravalent antibody.
  • the present invention relates to the antibody, or one of its derivative compounds or functional fragments, as described above as a drug.
  • the invention also relates to a pharmaceutical composition comprising as active principle a compound consisting of an antibody, or one of its derivative compounds or functional fragments, according to the invention.
  • said antibody is supplemented with an excipient and / or a pharmaceutically acceptable vehicle.
  • the present invention also relates to a pharmaceutical composition as described above which further comprises, as a combination product for simultaneous, separate or spread use, at least one other antibody, a cytotoxic / cytostatic agent, a cellular toxin or a radioelement.
  • the composition according to the invention considerably increases the effectiveness of cancer treatment.
  • the therapeutic effect of the antibody according to the invention is unexpectedly potentiated by the administration of a cytotoxic agent.
  • Another major subsequent advantage produced by a composition according to the invention concerns the possibility of using lower effective doses of active ingredient, which makes it possible to avoid or reduce the risks of occurrence of side effects, in particular the effect of the cytotoxic agent.
  • this composition according to the invention would make it possible to achieve the desired therapeutic effect more rapidly.
  • Anti-cancer therapeutics or "cytotoxic agents” means a substance that, when administered to a patient, treats or prevents the development of cancer in the patient.
  • cytotoxic agents By way of non-limiting example for such agents, mention may be made of “alkylating” agents, antimetabolites, anti-tumor antibiotics, mitotic inhibitors, chromatin function inhibitors, anti-angiogenesis agents, estrogen, anti-androgens or immunomodulators.
  • alkylating agents antimetabolites, anti-tumor antibiotics, mitotic inhibitors, chromatin function inhibitors, anti-angiogenesis agents, estrogen, anti-androgens or immunomodulators.
  • Such agents are, for example, cited in VIDAL, on the page dedicated to the compounds attached to oncology and hematology column "Cytotoxic", these cytotoxic compounds cited with reference to this document are cited here as preferred cytotoxic agents.
  • Alkylating agents refers to any substance that can covalently couple or alkylate any molecule, preferentially a nucleic acid (eg, DNA), within a cell.
  • nitrogen mustards such as mechlorethamine, chlorambucil, melphalan, hydrochloride, pipobroman, prednimustine, disodium phosphate or estramustine; oxazaphosphorines such as cyclophosphamide, altretamine, trofosfamide, sulfofosfamide or ifosfamide; aziridines or ethylenimines such as thiotepa, triethyleneamine or altetramine; nitrosoureas such as carmustine, streptozocin, fotemustine or lomustine; alkyl sulfonates such as busulfan, treosulfan or improvosulfan; triazenes such as
  • Antimetabolites refers to substances that block growth and / or cell metabolism by interfering with certain activities, usually DNA synthesis.
  • antimetabolite mention may be made of methotrexate, 5-fluorouracil, floxuridine, 5-fluorodeoxyuridine, capecitabine, cytarabine, fludarabine, cytosine arabinoside, 6-mercaptopurine (6-MP), 6-thioguanine (6- TG), chlorodeoxyadenosine, 5-azacytidine, gemcitabine, cladribine, deoxycoformycin and pentostatin.
  • Anti-tumor antibiotics refers to compounds that can prevent or inhibit the synthesis of DNA, RNA and / or proteins.
  • anti-tumor antibiotics examples include doxorubicin, daunorubicin, idarubicin valrubicin, mitoxantrone, dactinomycin, mithramycin, plicamycin, mitomycin C, bleomycin, and procarbazine.
  • Mitotic inhibitors prevent normal progression of the cell cycle and mitosis.
  • inhibitors of microtubules or "taxoids” such as paclitaxel and docetaxel are capable of inhibiting mitosis.
  • Vinca alkaloids such as vinblsatin, vincristine, vindesine and vinorelbine are also able to inhibit mitosis.
  • Chroisomerase inhibitors refer to substances that inhibit the normal function of chromatin-forming proteins such as topoisomerases I and IL.
  • examples of such inhibitors include, for topoisomerase I, camptothecin and its derivatives such as irinotecan or topotecan and, for topoisomerase II, etoposide, etposide phosphate and teniposide.
  • Anti-angiogenesis agents refer to any drug, compound, substance or agent that inhibits the growth of blood vessels.
  • anti-angiogenesis agents include, without limitation, razoxin, marimastat, batimastat, prinomastat, tanomastat, ilomastat, CGS-27023A, halofuginone, COL-3, neovastat, BMS-275291, thalidomide, CDC 501, DMXAA, L-651582, squalamine, endostatin, SU5416, SU6668, interferon-alpha, EMD121974, interleukin-12, IM862, angiostatin and vitaxine.
  • Anti-estrogen or “anti-estrogenic agents” refers to any substance that decreases, antagonizes or inhibits the action of estrogen. Examples of such agents are tamoxifen, toremifene, raloxifene, droloxifene, iodoxyfen, anastrozole, letrozole, and exemestane.
  • Anti-androgens or “anti-androgenic agents” refer to any substance that reduces, antagonizes or inhibits the action of an androgen.
  • anti-androgens are flutamide, nilutamide, bicalutamide, sprironolactone, cyproterone acetate, fmasteride and cimitidine.
  • Immunomodulators are substances that stimulate the immune system.
  • immunomodulators include interferons, interleukins such as aldesleukin, OCT-43, denileukin diflitox or interleukin-2, tumor necrosis factors such as tasonermin, or other types of immunomodulators such as lentinan, sizofran, roquinimex, pidotimod, pegademase, thymopentine, poly I: C, or levamisole in combination with 5-fluorouracil.
  • interferons interleukins such as aldesleukin, OCT-43, denileukin diflitox or interleukin-2
  • tumor necrosis factors such as tasonermin
  • other types of immunomodulators such as lentinan, sizofran, roquinimex, pidotimod, pegademase, thymopentine, poly I: C, or levamisole
  • said composition as a combination product according to the invention is characterized in that said cytotoxic agent is chemically coupled to said antibody for simultaneous use.
  • said composition according to the invention is characterized in that said cytotoxic / cyto static agent is chosen among the spindle inhibitory or stabilizing agents, preferably vinorelbine and / or vinflunine and / or vincristine.
  • the invention is, in another aspect, relating to a composition characterized in that at least one of said antibodies, or one of their derivative compound or functional fragment, is conjugated with a cellular toxin and / or a radioissement
  • said toxin or said radioelement is capable of preventing growth or proliferation of the tumor cell, in particular completely inactivating said tumor cell.
  • said toxin is an enterobacterial toxin, especially exotoxin A of Pseudomonas.
  • the radioelements preferably conjugated to the antibody used in therapy are radioisotopes that emit gamma rays and preferably iodine 131 , yttrium 90 , gold 199 , palladium 100 , copper 67 , bismuth 217 and antimony 211 . Radioisotopes that emit beta and alpha rays can also be used in therapy.
  • toxin or radioelement conjugated to at least one antibody, or one of their functional fragment is meant any means for linking said toxin or said radioelement to said at least one antibody, in particular by covalent coupling between the two compounds, with or without introduction of binding molecule.
  • benzoquinone carbodiimide and more particularly EDC (1-ethyl-3- [3] may be mentioned in particular.
  • bridging agents having one or more groups, having one or more phenylase groups, reacting with ultraviolet (UV) and most preferably N - [(4- (azidosalicylamino) butyl] -3 '- (2'-pyridyldithio) ) - propionamide (APDP), N-succinimid-3-yl (2-pyridyldithio) propionate (SPDP) and 6-hydrazino-nicotinamide (HYNIC).
  • UV ultraviolet
  • APDP N-succinimid-3-yl (2-pyridyldithio) propionate
  • HYNIC 6-hydrazino-nicotinamide
  • Another form of coupling especially for radioelements, may be the use of a bifunctional ion chelator.
  • chelates derived from EDTA ethylenediaminetetraacetic acid
  • DTPA diethylenetriaminepentaacetic acid
  • DTPA and its derivatives can be substituted by different groups on the carbon chain so as to increase the stability and rigidity of the ligand-metal complex (Krejcarek et al (1977), Brechbiel et al (1991), Gansow (1991) US Patent 4,831,175).
  • DTPA diethylenetriaminepentaacetic acid
  • its derivatives which has been widely used in medicine and biology for a long time either in its free form or in the form of a complex with a metal ion, has the remarkable characteristic of form stable chelates with metal ions and be coupled to proteins of therapeutic or diagnostic interest as antibodies for the development of radioimmunoconjugates in cancer therapy (Meases et al., (1984), Gansow et al. 1990)).
  • said at least one antibody forming said conjugate according to the invention is chosen from among its functional fragments, in particular fragments having their Fc component amputated, such as scFv fragments.
  • the present invention further comprises the use of the composition according to the invention for the preparation of a medicament for the prevention or treatment of cancer.
  • the present invention also relates to the use of an antibody, or one of its derived compounds or functional fragments, preferably humanized, and / or a composition according to the invention for the preparation of a medicinal product intended for to inhibit the proliferation of tumor cells.
  • the subject of the present invention is the use of an antibody, or one of its derivative compounds or fragments functional, preferably humanized, and / or a composition according to the invention, for the preparation of a medicament for the prevention or treatment of cancer
  • prostate cancer Of the cancers that can be prevented and / or treated, prostate cancer, osteosarcomas, lung cancer, breast cancer, endometrial cancer, colon cancer, multiple myeloma or ovarian cancer, pancreatic cancer or any other cancer.
  • said cancer is a cancer selected from prostate cancer, lung cancer, colon cancer and / or pancreatic cancer.
  • the present invention relates to the use of the antibody according to the invention in a diagnostic method, preferably in vitro, diseases related to a CD151 expression level. More particularly, the invention relates to a method for the in vitro diagnosis of diseases exhibiting overexpression or under-expression of the CD151 protein from a biological sample whose abnormal presence of CD151 protein is suspected, said method consisting in contacting said biological sample with an antibody according to the invention, said antibody possibly being labeled.
  • said diseases linked to the CD 151 protein in said diagnostic method will be cancers.
  • the antibody, or a functional fragment thereof may be in the form of an immunoconjugate or labeled antibody to provide a detectable and / or quantifiable signal.
  • the labeled antibodies according to the invention or their functional fragments include, for example, so-called immunoconjugated antibodies which may be conjugated for example with enzymes such as peroxidase, alkaline phosphatase, ⁇ -D-galactosidase, glucose oxidase, glucose amylase, carbonic anhydrase, acetylcholinesterase, lysozyme, malate dehydrogenase or glucose-6 phosphate dehydrogenase or by a molecule such as biotin, digoxigenin or 5-bromodeoxyuridine.
  • enzymes such as peroxidase, alkaline phosphatase, ⁇ -D-galactosidase, glucose oxidase, glucose amylase, carbonic anhydrase, acetylcholinesterase, lysozyme, malate dehydrogenase or glucose-6 phosphate dehydrogenase or by a molecule such as biotin, digoxi
  • Fluorescent markers may also be conjugated to the antibodies or their functional fragments according to the invention and include, in particular, fluorescein and its derivatives, fluorochrome, rhodamine and its derivatives, GFP (GFP for "Green Fluorescent Protein”), dansyl, umbelliferone etc.
  • fluorescein and its derivatives include fluorochrome, rhodamine and its derivatives, GFP (GFP for "Green Fluorescent Protein"
  • dansyl dansyl
  • umbelliferone etc.
  • the antibodies of the invention or their functional fragments can be prepared by methods known to those skilled in the art.
  • Conjugates having fluorescein labels may be prepared by reaction with isothiocyanate.
  • conjugates may also include chemiluminescent markers such as luminol and dioxetanes, bioluminescent markers such as luciferase and luciferin, or radioactive labels such as iodine 123 , iodine 125 , iodine 126 , iodine 133 , bromine 77 , technetium 99m , indium 111 , indium 113m , gallium 67 , gallium 68 , ruthenium 95 , ruthenium 97 , ruthenium 103 , ruthenium 105 , mercury 107 , mercury 203 , rhenium 99m , rhenium 101 , rhenium 105 , scandium 47 , tellurium 121m , tellurium 122m , tellurium 125m , thulium 165 , thulium 167 , thulium 168 , fluorine 18 , yttrium
  • the subject of the invention is also the use of an antibody according to the invention, for the preparation of a medicinal product intended for the specific targeting of a logically active organic compound to cells expressing or overexpressing the CD 151 protein.
  • biologically active compound is meant here any compound capable of modulating, in particular of inhibiting, cell activity, in particular their growth, proliferation, transcription or translation of genes.
  • the subject of the invention is also an in vivo diagnostic reagent comprising an antibody according to the invention, or one of its functional fragments, preferably labeled, in particular radiolabelled, and its use in medical imaging, in particular for the detection of cancer related to the expression or overexpression by a cell of the CD151 protein.
  • the invention also relates to a composition as a combination product or an anti-CD151 / toxin or radioelement conjugate, according to the invention, as a medicament.
  • composition as a combination product or said conjugate according to the invention will be supplemented with an excipient and / or a pharmaceutically acceptable vehicle.
  • the term "pharmaceutically acceptable carrier” is intended to denote a compound or combination of compounds used in a pharmaceutical composition that does not cause side reactions and that makes it possible, for example, to facilitate the administration of the active compound or compounds. increase its life and / or effectiveness in the body, increase its solubility in solution or improve its conservation.
  • these compounds will be administered systemically, in particular intravenously, intramuscularly, intradermally, intraperitoneally or subcutaneously, or orally. More preferably, the composition comprising the antibodies according to the invention will be administered several times, spread over time.
  • dosages and optimal dosage forms can be determined according to the criteria generally taken into account in the establishment of a treatment adapted to a patient such as the age or the body weight of the patient, the severity of his general condition, tolerance to treatment and side effects noted.
  • the invention thus relates to the use of an antibody, or a functional fragment thereof, for the preparation of a medicament for the specific targeting of a bio-logically active compound to cells expressing or overexpressing CD151.
  • FIG. 1 shows the nucleotide and protein sequences of the CD151 protein, sequences on which are highlighted the EC1 and EC2 loops.
  • FIG. 2 is a diagram illustrating the structure of the tetraspanins to which the CD151 protein belongs, and more particularly the two extra-cellular loops EC1 and EC2.
  • FIG. 3 shows the respective sequences of the heavy and light chains of the antibody 203B6 according to the invention.
  • the CDRs defined according to the IMGT system appear underlined and in bold while the CDRs defined according to Kabat appear framed.
  • FIG. 4 shows the respective sequences of the heavy and light chains of the antibody 205H8 according to the invention.
  • the CDRs defined according to the IMGT system appear underlined and in bold while the CDRs defined according to Kabat appear framed.
  • FIG. 5 shows the respective sequences of the heavy and light chains of the 211F3 antibody according to the invention.
  • the CDRs defined according to the IMGT system appear underlined and in bold while the CDRs defined according to Kabat appear framed.
  • FIG. 6 shows the respective sequences of the heavy and light chains of the antibody 214B2 according to the invention.
  • the CDRs defined according to the IMGT system appear underlined and in bold while the CDRs defined according to Kabat appear framed.
  • Figure 7 illustrates the expression of the CD151 molecule in patients with prostate cancer.
  • Each letter corresponds to the study of a patient and for each patient the upper panel corresponds to the normal tissue adjacent to the tumor and the lower panel corresponds to the tumor tissue.
  • Figure 8 illustrates the expression of the CD151 molecule in patients with lung cancer.
  • Each letter corresponds to the study of a patient and for each patient the upper panel corresponds to the normal tissue adjacent to the tumor and the lower panel corresponds to the tumor tissue.
  • Figure 9 shows the flow cytometry analysis of the recognition of CD151 by the antibody 203B6 on the surface of NIH 3T3-CD151, PC3 and A549 cells.
  • Figure 10 shows flow cytometric analysis of CD151 recognition by antibody 205H8 on the surface of NIH 3T3-CD151, PC3 and A549 cells.
  • Figure 11 shows the flow cytometry analysis of the recognition of CD151 by the 211F3 antibody on the surface of NIH 3T3-CD151, PC3 and A549 cells.
  • Figure 12 shows the flow cytometry analysis of the recognition of
  • Figure 13 shows the results of the evaluation of the specificity of antibodies 203B6, 205H8, 211F3 and 214B2 by western blot.
  • Figure 14 illustrates the anti-tumor activity of anti-CD151 monoclonal antibodies in the PC3 prostate tumor xenograft model. Swiss mice
  • the tumor volume is evaluated by the formula ⁇ / 6 x Length x width x thickness.
  • Figure 15 shows the analysis of iodine 125-labeled antibodies 203B6 and 214B2 with (A) Autoradiography after SDS-PAGE electrophoresis under reducing conditions, and (B) Analysis by molecular sieve chromatography.
  • FIG. 16 illustrates the study of the binding of the radiolabeled antibody 203B6 on PC3 cells: Determination of the equilibrium affinity constant with (A) saturation curve and (B) Scatchard plot.
  • FIG. 17 illustrates the study of the binding of the radiolabeled antibody 214B2 on PC3 cells: Determination of the equilibrium affinity constant with (A) saturation curve and (B) Scatchard plot.
  • Figure 18 shows the effect of anti-CD151 antibodies on platelet functions with (A) Platelet Aggregation and (B) Platelet Activation (Serotonin Release).
  • Figure 19 shows the effect of anti-CD151 antibodies on in vivo tumor growth of NCI-H441 cells.
  • Figure 20 illustrates phenotype A) and differentiation markers B) of THP-I cells cultured in the absence or presence of LDCs.
  • the 9G4 antibody is used as a control isotype and LPS as a positive activation control.
  • Figure 21 shows the effect of antibodies 241B2 and 203 B6 on antigen presentation.
  • the expression of the CD151 protein has been investigated by immunohistochemistry (IHC) in human tissue samples from patients with prostate cancer or lung cancer. For these patients, normal tissue slides adjacent to the tumor were available and were therefore included to calibrate the level of expression in tumor versus normal tissues.
  • IHC immunohistochemistry
  • a murine IgG1 control isotype antibody (DakoCytomation, Ref X0931) is used as a negative test of experience. Revelation of the labeling is done with the Envision Dual Link Disclosure System (DakoCytomation, Ref K4061) and the reference of DAB, peroxidase substrate is S3309 from DakoCytomation.
  • mice were immunized subcutaneously with 20 ⁇ 10 6 NIH 3T3 cells expressing human CD151 on their surface, cells generated by transfection with the CD151 gene.
  • the first immunization was carried out in the presence of Freund's complete adjuvant and then the following 2 in the presence of incomplete Freund's adjuvant.
  • a final booster injection of 10 ⁇ 10 6 NIH 3T3-CD151 cells was carried out intraperitoneally.
  • Spleen cells from a mouse were then fused to SP2 / 0-Agl4 myeloma cells in a 1: 1 ratio by the techniques conventionally described by Kohler and Milstein.
  • the antibodies secreted in the hybridoma supernatants resulting from the fusion were then screened for their ability to recognize the recombinant extracellular EC2 loop of CD151 by ELISA, and CD151 expressed on the surface of the PC3 prostate cancer human tumor cell line by cytometry. of flow.
  • 96-well plates are sensitized for 1 night at + 4 ° C. with the recombinant EC2 extracellular loop at 5 ⁇ g / ml in PBS. After washing with PBS, the wells are saturated with 0.5% gelatin solution in PBS for 1 h at 37 ° C and then washed again with PBS. The culture supernatants of the hybridomas are evaluated without dilution (incubation for 1 h at 37 ° C.).
  • Bound antibodies on immobilized EC2 loop are detected by successive incubation with anti-IgG goat polyclonal antibody conjugated mouse peroxidase (Jackson / USA, dilution of l / 5000 th, 1 h at 37 ° C) and then with a peroxidase substrate (TMB, Interchim / France, 10 min at room temperature). The reaction is stopped by addition of 1M sulfuric acid and the optical density (OD) is measured at 450 nm. The flow cytometric analyzes are carried out on 96-well plates. Undiluted hybridoma supernatants are added to 100,000 PC3 cells previously introduced into the wells.
  • FIGS. 9, 10, 11 and 12 show the flow cytometry recognition profiles of the NIH 3T3-CD151, PC3 and A549 cells obtained for the antibodies 203B6, 205H8, 211F3 and 214B2. These profiles are comparable to those obtained with the anti-CD151 antibody 50-6 (ATCC CRL-2696) and demonstrate the specificity of these antibodies for CD151.
  • the hybridomas were then deposited at the CNCM, National Collection of Cultures of Microorganisms, Pasteur Institute, 25 Rue du Dondel Roux, 75724 PARIS Cedex 15.
  • the specificity of the antibodies 203B6, 205H8, 211F3 and 214B2 was evaluated by Western blot.
  • the EC2 loop of CD151 was cloned into the pET22b vector for expression in soluble form in the periplasm of Escherichia coli.
  • the protein produced comprises amino acids 130 to 221 of the human CD151 peptide sequence, to which was added a Poly-His tail at the C-terminal position to facilitate purification.
  • the recombinant EC2 protein was purified by immobilized metal affinity chromatography (IMAC) on Chelating Sepharose HP support (GE Healthcare).
  • the antibodies 203B6, 205H8, 211F3 and 214B2 recognize the complete CD151 protein and the recombinant EC2 loop by western blot ( Figure 13).
  • the 205H8 antibody has lower reactivity for the complete CD151 protein under the assay conditions.
  • the signal obtained for the antibody 205H8 proves to be weaker. This difference is not observed for the recognition of the recombinant EC2 protein.
  • Example 4 Antitumor activity of anti-CD151 antibodies in the PC3 xenograft model Materials and methods
  • PC3 line is an ATCC-derived androgen-independent prostate line grown in F12K medium (Invitrogen Corporation, Scotland, United Kingdom), 10% FCS (Invitrogen Corporation).
  • F12K medium Invitrogen Corporation, Scotland, United Kingdom
  • FCS Invitrogen Corporation
  • the cells are divided two days before the transplant so that they are in the exponential growth phase.
  • Five million PC3 cells are grafted subcutaneously into six weeks old Swiss Nude male mice. Five days after implantation, the tumor volumes are measured, the mice are randomized to constitute non-statistically different batches and the treatment is initiated by the i.p. injection. a dose of 2 mg of antibody per mouse.
  • the animals are then treated twice a week with a dose of 1 mg of antibody per mouse and the tumors measured twice a week.
  • Animals in the control group receive an injection of PBS.
  • the tumor volumes are calculated according to the formula ⁇ / 6 x length x width x height. Statistical analysis is performed at each measurement using a Mann-Whitney test.
  • results presented in FIG. 14 show that the antibodies 203B6, 214B2 and 211F3 indicate significant inhibitions of the in vivo tumor growth of the PC3 cells.
  • Antibody 205H8 although inhibitory, shows a more modest antitumor activity in this model.
  • the anti-CD151 antibodies 203B6 and 214B2 were firstly labeled with 125 I by the method using chloramine T. After labeling, the antibodies were purified by molecular sieve chromatography on a PD-10 column (GE Healthcare) to eliminate free iodine 125. The radiochemical purity of the radiolabelled antibodies was determined, after purification, by thin layer chromatography of silica, analytical molecular sieve chromatography on Superdex 200 column (GE Healthcare) and by autoradiography after SDS-PAGE electrophoresis.
  • Figure 15 shows that the heavy ( ⁇ 50 kDa) and light ( ⁇ 25 kDa) chains of the 2 antibodies are labeled equally (15A) and confirm the absence of free iodine 125 after purification (15B).
  • the specific activity of radiolabelled antibodies was determined using a gamma counter (Wallace Wizard 1480, Perkin Elmer).
  • the affinity of the 2 radiolabeled antibodies for their CD151 target at the cell surface was then measured on PC3 prostate cancer cells.
  • the dissociation constant K D of the antibodies was determined by the Scatchard method.
  • PC3 cells (1.10 6 cells / 50 ⁇ l of PBS buffer containing 0.5% BSA) were incubated in the presence of increasing concentrations of the radiolabelled antibodies of between 6 ng / ml and 27 ⁇ g / ml for 1 h at 4 ° C. (final volume: 150 ⁇ l). After incubation, the total radioactivity associated with the cells (fixed radiolabelled antibody) was measured using a gamma counter. Nonspecific binding was determined for each concentration tested in the presence of an excess of non-radiolabelled antibody (x 100).
  • Aggregation is an essential function of platelets during the blood coagulation process, in response to vascular injury, for example. This phenomenon is usually preceded by platelet activation, which results in the exposure of certain proteins to their surface and the secretion of the contents of their storage granules (alpha granules and dense granules). Since CD141 is expressed on platelets (Goschnick and Jackson, 2007, Mini-Rev Med Chem 7: 1236-1247), the effect of anti-CD151 antibodies on platelet functions was evaluated in vitro using platelet aggregation and activation assays.
  • Activation of platelets was measured on the PPP of 10 donors by measuring the secretion of serotonin (5-hydroxytryptamine or 5-HT) by HPLC with detection fluorimetric.
  • the effect of antibodies on platelet functions was determined for a concentration of 10 ⁇ g / ml.
  • PM6 / 248 anti-CD41, integrin (Xm,) and 14A2.H1 (anti-CD151) as positive control antibodies
  • 9G4 isotype control (IgG1).
  • Different compounds tested are estimated for each donor as a percentage of the thrombin-induced aggregation taken as a reference (100%)
  • Figure 18A shows the average aggregation values obtained for each test compound.
  • PM6 / 248 antibodies less potent inducing agents than thrombin, lead to comparable aggregations of 30.1 ⁇ 10.5% and 47.6 ⁇ 12.7% respectively.
  • the differences obtained are typically observed in hemostasis and result from inter-individual variability
  • the 9G4 antibody does not induce platelet aggregation: this antibody makes it possible to define a detection threshold (5 nM)
  • These 2 antibodies induce a lower aggregation than that of the control antibody 14A2.H1.
  • Figure 18B shows the average serotonin values released by platelets (in nM) in the presence of the various compounds tested. The results obtained for this platelet activation test are comparable to those described previously.
  • the 9G4 antibody does not induce platelet activation whereas thrombin causes a very strong release of serotonin (-430 nM).
  • the amounts of serotonin released are lower in the presence of ADP, PM6 / 248 and 14A2.H1 (mean values of 72.6 nM, 34.6 nM and 21.6 nM respectively), but these compounds can be considered as platelet activators.
  • the release of serotonin induced by the anti-CD151 antibodies 203B6 and 214B2 is very weak: in fact, the average values determined for these 2 antibodies are respectively 2.4 and 3.6 times weaker than that of the antibody control anti- CD151 14A2.H1.
  • the 2 tests confirm that the anti-integrin control antibodies dm, PM6 / 248 and anti-CD151 14A2.H1 are capable of inducing platelet aggregation in vitro and inducing their activation (Roberts et al., 1995). Br. J. Haematol 89: 853-860; Hornby et al., 1991, Br. J. Haematol 79: 277-285). Unlike the 14A2.H1 antibody, the anti-CD151 antibodies 203B6 and 214B2 induce levels aggregation and platelet activation very weak and insignificant in human clinical.
  • the NCI-H441 cells from the ATCC are cultured in RPMI 1640 medium supplemented with 10% FCS and 1% L-Glutamine. The cells are divided two days before the transplant so as to obtain cells in the exponential phase of growth on the day of the transplant.
  • Ten million NCI-H441 cells are implanted subcutaneously in athymic Nude mice. Five days after the transplant, the tumors are measurable and the animals bearing tumors of comparable size are divided into groups of 6.
  • the mice are treated i.p. with an antibody dose of 2 mg / mouse and then twice a week with a dose of 1 mg of antibody per mouse.
  • the tumor volume is evaluated twice a week and calculated using the formula: ⁇ / 6 X length X width X height. The specific analysis of the data is performed at each measurement using a Mann-Whitney test.
  • TNF ⁇ being a marker of the activation of macrophages
  • TNF ⁇ concentration of culture supernatant of THP-I cells, cultured in the presence or absence of the antibodies to be tested was evaluated by ELISA.
  • the THP-I cell lines is a monocytic leukemia line capable of differentiating into a macrophage line in the presence of PMA-type agents or 25-Dihydroxy vitamin D3. This activation process is accompanied by a very significant secretion of TNF ⁇ .
  • THP-I cells are seeded in 6-well plates in presence or absence of PMA (250 nM) for 72 hours. After this incubation time, part of the cells are recovered in order to control the differentiation in the presence of PMA by microscopic observation or by FACS analysis of the CD14 / CDl1b markers.
  • the antibodies to be tested (241B2 and 203B6) are added to the other wells for an additional 24 hours.
  • the 9G4 antibody is used under the same conditions as control isotype.
  • LPS (1 ⁇ g / ml) is used as a positive control of the experiment. The culture supernatants are then removed, centrifuged and stored at -80 ° C. before being assayed for their TNF ⁇ content by an ELISA test.
  • FIG. 20A The results presented in FIG. 20A show that, in the absence of PMA, the THP-I cells are non-adherent, refractive and round. In the presence of PMA, these cells become adherent which clearly signifies a differentiation of monocytes into macrophages.
  • FACS analyzes FIG. 20B show that, in the absence of PMA, less than 20% of THP-I cells express CD1 Ib or CD14.
  • the PMA-induced cell differentiation is, as expected, associated with a significant increase in CD1 Ib-expressing cells from 9 to 65%.
  • the expression of CD14 is also significantly increased with a number of positive cells increasing from 20 to 37%.
  • Figure 2OC shows that no TNF ⁇ production is observed when THP-I cells are cultured in the absence of differentiation inducer. On the other hand, a very significant production (100 to 200 ⁇ g / ml) of TNF ⁇ is observed.
  • the LPS introduced as a positive control of experiment also causes the secretion of a high level of cytokine in this, in the presence or absence of differentiation inducer, presence of PMA. None of the anti-CD151 antibodies evaluated leads to secretions of TNF ⁇ whatever the state of cellular differentiation.
  • Example 9 Evaluation of two anti-CD151 antibodies on antigen presentation function. Since the CD 151 molecule is widely expressed on antigen presenting cells, a study was conducted to verify the potential impact of a CD151-directed therapy on antigen presentation function. The experiment carried out consists of monitoring the specific lymphocyte proliferation of the TT antigen when the tetanus toxoid protein is introduced on PBMCs. In this conformation, the protein must be processed by the antigen presenting cells and presented by these same cells in association with the MHC molecules. This antigenic presentation to CD4 + or CD8 + lymphocytes will lead to proliferation of antigen-specific clones. Any impact on the antigenic presentation will therefore result in a modulation of lymphocyte proliferation.
  • PBMCs are isolated by centrifugation of Ficoll gradient whole blood. The cells washed twice with PBS are counted and resuspended at a rate of 0.25 ⁇ 10 6 cells / ml in RPMI 1640 medium supplemented with 10% FCS and 1% glutamine. One hundred micro liters of the cell suspension are inoculated into each well of a 96-well plate in the presence of the antigen and the antibodies to be tested. The antibodies 214B2 and 203B6 are evaluated at the final concentration of 10 ⁇ g / ml. The 9G4 antibody is introduced at the same final concentration as isotype control experiment.
  • PHA (2.5 ⁇ g / ml in the well), a polyclonal activator of lymphocyte proliferation, is used as a positive proliferation control.
  • Tetanus toxoid (TT) was selected as test antigen and is used at the final concentration of 100 ⁇ g / ml.
  • the plates are incubated at 37 ° C. for 96 hours at the end of which 0.25 ⁇ Ci of H-thymidine are added to each well for an additional 24 hours. After incubation the cells are collected on filters and the radioactivity evaluated.
  • the results presented in FIG. 21A show that, as expected, the PHA used as a positive control leads to a very high lymphocyte proliferation. Signal strength is consistent with polyclonal activation of cell proliferation.
  • the 9G4 introduced into the experiment as isotype control has no impact on the proliferation of cells in the absence or presence of PHA.
  • the two anti-CD151 antibodies tested in no way modify the proliferation.
  • TT antigen induces a significant proliferation of part of the lymphocyte population ( Figure 21B). This proliferation is not impacted in the presence of 9G4 or the two anti-CD151 antibodies tested indicating that under the conditions of the experiment the antigenic presentation is not affected by the compounds tested.

Abstract

La présente invention est relative à de nouveaux anticorps capables de se lier spécifiquement à la protéine humaine CD 151, notamment monoclonaux d'origine murine, chimériques et humanisés, ainsi que les séquences d'acide aminé et nucléiques codant pour ces anticorps. L'invention comprend également l'utilisation de ces anticorps à titre de médicament pour le traitement prophylactique et/ou thérapeutique de cancers ainsi que dans des procédés ou nécessaire de diagnostic de maladies liées à la surexpression de la protéine CD151. L'invention comprend enfin des produits et/ou des compositions comprenant de tels anticorps en association avec des anticorps et/ou des agents anticancéreux ou conjugués avec des toxines et./ou des radioéléments et leur utilisation pour la prévention et/ou le traitement de certains cancers.

Description

NOUVEAUX ANTICORPS UTILES POUR LE TRAITEMENT DU CANCER
La présente invention est relative à de nouveaux anticorps, notamment monoclonaux d'origine murine, chimériques et humanisés, capables d'inhiber la croissance tumorale ainsi que les séquences d'acide aminé et nucléiques codant pour ces anticorps. Selon un aspect particulier, l'invention a pour objet de nouveaux anticorps, composés dérivés ou fragments fonctionnels, capables d'inhiber la prolifération des cellules tumorales. L'invention comprend également l'utilisation de ces anticorps à titre de médicament pour le traitement prophylactique et/ou thérapeutique des cancers ainsi que dans des procédés ou nécessaires de diagnostic des cancers. L'invention comprend enfin des produits et/ou des compositions comprenant de tels anticorps en association, par exemple, avec des anticorps et/ou des agents anticancéreux ou conjugués avec des toxines et leur utilisation pour la prévention et/ou le traitement de certains cancers.
CD151, appelé aussi PET A-3 ou SFA-I, est une protéine membranaire appartenant à la famille des tétraspanines (Boucheix et Rubinstein, 2001, CeIl Mol. Life Sci. 58, 1189-1205 ; Hemler, 2001, J. CeIl Biol. 155, 1103-1107). Chez l'homme, CD151 possède 253 acides aminés, et comporte 4 fragments membranaires et 2 domaines extracellulaires ECl (18 acides aminés, séquence [40-57]) et EC2 (109 acides aminés, séquence [113-221]), appelés aussi boucles extracellulaires. Il est cependant à noter qu'au niveau de la séquence nucléotidique, deux variants pour CDl 51 ont été identifiés à ce jour, à savoir l'un comprenant les nucléotides A et C respectivement aux positions 395 et 409 [Fitter et al, 1995, Blood 86(4), 1348-1355] et l'autre comprenant pour les mêmes positions les nucléotides G et T au lieu et place des nucléotides A et C [Hasegawa et al., 1996, J. Virol. 70(5), 3258-3263]. De ce fait, une mutation au niveau de la séquence peptidique peut être observée, à savoir une mutation des résidus K (Lys) et P (Pro) respectivement aux positions 132 et 137 en les résidus R Arg) et S (Ser) [Fitter et al, 1995, Blood 86(4), 1348-1355 / Hasegawa et al., 1996, J. Virol. 70(5), 3258-3263].
CDl 51 est surexprimé dans de nombreux cancers, comme par exemple les cancers du poumon [Tokuhara et al, 2001, Clin. Cancer Res. 7, 4109-4114], du colon [Hashida et al, 2003, Br. J. Cancer 89, 158-167], de la prostate [Ang et al, 2004, Cancer Epidemiol. Biomarkers Prev. 13, 1717-1721] ou du pancréas [Gesierich et al, 2005, Clin. Cancer Res. 11, 2840-2852].
L'utilisation des souris knock-out n'exprimant pas CD151, et d'anticorps anti- CDl 51 et de siRNA pour bloquer in vitro la fonctionnalité et l'expression de CDl 51 dans différents types cellulaires a permis de montrer que CD151 est impliqué dans plusieurs phénomènes liés au cancer, comme l'adhésion cellulaire (Nishiuchi et al, 2005, Proc. Natl. Acad. Sci. USA 102, 1939-1944 ; Winterwood et al, 2006, Mol. Biol. CeIl 17, 2707-2721), la motilité cellulaire (Kohno et al, 2002, Int. J. Cancer 97, 336- 343), la migration cellulaire (Yauch et al, 1998, Mol. Biol. CeIl 9, 2751-2765 ; Testa et al, 1999, Cancer Res. 59, 3812-3820 ; Penas et al, 2000, J. Invest. Dermatol. 114, 1126-1135 ; Klosek et al, 2005, Biochem. Biophys. Res. Commun. 336, 408-416), l'invasion cellulaire (Kohno et al, 2002, Int. J. Cancer 97, 336-343 ; Shiomi et al, 2005, Lab. Invest. 85, 1489-1506 ; Hong et al, 2006, J. Biol. Chem. 281, 24279-24292) et l'angiogénèse (Yanez-Mo et al, 1998, J. CeIl Biol. 141, 791-804 ; Sincock et al, 1999, J. CeIl Sci. 112, 833-844 ; Takeda et al, 2007, Blood 109, 1524-1532).
L'une des propriétés remarquable des tétraspanines est leur capacité à s'associer entre elles, ainsi qu'à un nombre important d'autres molécules de surface pour former des complexes macromoléculaires structurés. Au sein de ces complexes, chaque tétraspanine est associée spécifiquement à une ou plusieurs molécules de surface formant ainsi des complexes primaires, constitués d'une tétraspanine et d'une molécule partenaire. Les tétraspanines peuvent organiser des microdomaines particuliers de la membrane plasmique au sein desquels elles recruteraient leurs partenaires moléculaires qui pourraient être couplés fonctionnellement. L'ensemble des interactions impliquant les tétraspanines a été dénommé « réseau des tétraspanines » ou « Tetraspanin Web ». CD151 interagit à la surface des cellules avec différentes protéines membranaires. Des complexes très stables, résistants à l'action de certains détergents, ont notamment été mis en évidence avec les intégrines récepteurs des laminines, et plus particulièrement avec les intégrines α3βl ou α6β4 dont le ligand préférentiel est la laminine 5 (Yauch et al, 1998, Mol. Biol. CeIl 9, 2751-2765 ; Lammerding et al, 2003, Proc. Natl. Acad. Sci USA 100, 7616-7621). Cette association implique les domaines extracellulaires de CD151 et des intégrines. La séquence QRD [194-196] de CD151, localisée dans la boucle EC2, est très importante dans cette association puisque la mutation de ce site provoque la perte de l'interaction avec certaines intégrines (Kazarov et al, 2002, J. CeIl Biol. 158, 1299-1309). Des complexes ternaires fonctionnels CD151/intégrine α6β4/c-Met (récepteur du HGF) ont d'autre part été mis en évidence dans les cellules tumorales (Klosek et al, 2005, Biochem. Biophys. Res. Commun. 336, 408-416). L'inhibition de l'expression de CD151 par traitement des cellules avec un ARN interférence provoque une inhibition de la croissance et de la migration cellulaire induite par HGF.
Les interactions au sein d'une même cellule de CD151 avec d'autres tétraspanines, nécessaires à la formation du réseau des tétraspanines, dépendraient des régions membranaires et cytoplasmiques de CD151 puisqu'il a été montré que la délétion de la boucle EC2 ne rompait pas l'association de CD151 avec d'autres tétraspanines (Berditchevski, 2001, J. CeIl Sci. 114, 4143-4151).
CD151 est capable de réguler les phénomènes d'adhésion, de migration et d'invasion cellulaire par la modulation de différentes voies de signalisation, comme par exemple la voie des phosphoinositides via une association avec la PI4-kinase (Yauch et al, 1998, Mol. Biol. CeIl 9, 2751-2765), la voie de signalisation de c-Jun via la phosphorylation de FAK, Src, p38-MAPK et JNK (Hong et al, 2006, J. Biol. Chem.
281, 24279-24292), la phosphorylation des intégrines par la PKC (Zhang et al, 2001, J.
Biol. Chem. 276, 25005-25013), l'activation de GTPases de la famille Rho (Shigeta et al, 2003, J. CeIl Biol. 163, 165-176).
Des interactions de type homophilique entre cellules sont aussi responsables d'une augmentation de la motilité cellulaire et de l'expression de la métalloprotéinase
MMP-9 (Hong et al, 2006, J. Biol. Chem. 281, 24279-24292). Ces interactions intercellulaires CD151-CD151 provoquent l'activation de c-Jun via la phosphorylation de FAK, Src, p38-MAPK et JNK
A ce jour, en dépit de l'intérêt de la protéine CD 151, deux anticorps à visée thérapeutique ont été générés, à savoir les anticorps monoclonaux 50-6 et SFA1.2B4.
Ces 2 anticorps possèdent des activités comparables. Ils inhibent en effet la formation des métastases in vivo dans des modèles animaux, mais aucun effet sur la croissance tumorale in vivo n'a été mis en évidence.
L'anticorps monoclonal 50-6 (isotype IgGl) dirigé contre CD 151 a été généré chez la souris par immunisations soustractives avec des cellules humaines de carcinome épidermoïde HEp-3 (Testa ét al, 1999, Cancer Res. 59, 3812-3820).
L'anticorps 50-6 est capable d'inhiber in vitro la migration des cellules humaines de carcinome cervical HeLa transfectées afin de surexprimer CD151 et des cellules HEp-3, et l'angiogénèse dans un modèle de néovascularisation de membrane chorioallantoïque induite par le bFGF (basic fîbroblast growth factor). Il inhibe in vivo les métastases induites par inoculation de cellules HEp-3 dans 2 modèles d'embryon de poulet (Testa et al, 1999, Cancer Res. 59, 3812-3820). Dans ces modèles, l'activité inhibitrice de l'anticorps 50-6 est déterminée par la mesure de l'activité de la protéine huPA (human urokinase-type plasminogen activator) dans des extraits de poumons. Selon les auteurs, ce dosage constitue le reflet de la présence de cellules humaines dans les poumons. Après dosage, la réduction des métastases (dissémination des cellules HEp-3 dans les poumons des embryons de poulet) induite par l'anticorps 50-6 est estimée, par comparaison à un anticorps contrôle, à 74% dans un modèle dit de « métastase spontanée » dans lequel l'inoculation des cellules est suivie par une injection de l'anticorps, et à 57% dans un modèle dit de « métastase expérimentale » dans lequel les cellules et l'anticorps sont inoculés conjointement. Selon les auteurs, les propriétés anti-tumorales de l'anticorps 50-6 observées in vivo ne semblent pas être liées à un effet cytostatique ou cytotoxique puisqu'il n'a montré aucun effet sur la prolifération in vitro des cellules HEp-3.
L'hybridome produisant l'anticorps 50-6 est disponible à l'ATCC sous la référence CRL-2696 (hybridome déposé initialement sous la référence 50-6 [PTA- 227]).
L'anticorps monoclonal anti-CD151 SFAl .2B4 (isotype IgGl) a été généré chez la souris après immunisation par voie intra-péritonéale avec des cellules NIH 3T3 transfectées par le gène de CD151 humain (Hasegawa et al, 1996, J. Virol. 70, 3258- 3263). L'anticorps SFAl .2B4 est capable d'inhiber in vitro l'invasion et la motilité cellulaire de différentes lignées tumorales humaines (Kohno et al., 2002, Int. J. Cancer 97, 336-343). Il inhibe in vivo les métastases pulmonaires induites par les lignées de cancer du colon RPMI14788 et de fïbrosarcome HT1080 transfectées pour surexprimer CD151 (Kohno ét al, 2002, Int. J. Cancer 97, 336-343). D'autres anticorps murins anti-CD151 ont été décrits dans la littérature, comme par exemple les anticorps monoclonaux 14A2H1 (Ashman et al., 1991, Br. J. Haematol. 79, 263-270 ; Roberts et al, 1995, Br. J. Haematol. 89, 853-860), TS151 et TS151R (Serru et al, 1999, Biochem. J. 340, 103-111 ; Geary et al, 2001, Tissue Antigens 58, 141-153 ; Charrin et al, J. Biol. Chem. 276, 14329-14337 ; Chometon et al, 2006, Exp. CeIl Res. 312, 983-985). Aucune activité anti-tumorale in vivo n'a été décrite pour ces différents anticorps.
Plusieurs études expérimentales ont montré le rôle majeur des tétraspanines dans la formation de métastases, en agissant soit comme suppresseurs, soit comme promoteurs de métastases. Ainsi, la transfection de tétraspanines comme CD9, CD63 ou CD82 réduit le potentiel métastatique de lignées cancéreuses. En revanche, l'expression des tétraspanines CD151 et Co-029 semble produire l'effet inverse. Ces 2 tétraspanines seraient donc des promoteurs de la métastase. Ces résultats sont cohérents avec différentes études cliniques qui ont démontré que, dans plusieurs cancers (sein, poumon, oesophage, estomac, foie, pancréas, côlon, prostate, mélanome...), CD9 et CD82 sont moins exprimés sur les tumeurs primitives lorsqu'il y a métastase et que leur baisse d'expression prédit un taux de survie inférieur. Dans le cancer du poumon, la diminution combinée de l'expression de CD9 et de CD82 a été corrélée à un potentiel métastatique plus important que lorsque l'expression d'un seul de ces deux antigènes est réduite.
Plusieurs études rétrospectives ont montré que la surexpression de CD 151 était associée à l'agressivité de certains cancers, comme les cancers du poumon, du colon et de la prostate, et pouvait être considérée comme un facteur de mauvais pronostic (Tokuhara et al, 2001, Clin. Cancer Res. 7, 4109-4114 ; Hashida et al, 2003, Br. J.
Cancer 89, 158-167 ; Ang et al, 2004, Cancer Epidemiol. Biomarkers Prev. 13, 1717-
1721). Dans ces cas, la moyenne de survie est en effet diminuée chez les patients dont la tumeur exprime CD151, comparativement à ceux dont la tumeur n'exprime pas CD151.
La surexpression de CD 151 dans différentes lignées tumorales humaines (HeLa, RPMI14788, A172, HT1080), induite par transfection du gène correspondant, provoque une augmentation de la motilité, de la migration et de l'invasion des cellules transfectées (Testa et al, 1999, Cancer Res. 59, 3812-3820 ; Kohno et al, 2002, Int. J. Cancer 97, 336-343). Ces phénomènes sont inhibés en présence d'anticorps anti- CD151. Selon un premier aspect, l'invention a pour objet un anticorps isolé, ou l'un de ses composés dérivés ou fragments fonctionnels, capable de se lier à la protéine CD151, ledit anticorps étant caractérisé en ce qu'il comprend au moins un CDR choisi parmi les CDRs de séquence SEQ ID No. 1-6, 17-22, 33-35, 43-48, 59-63, 69-73, 79-81, ou 85-89 ou au moins un CDR dont la séquence présente au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 1-6, 17-22, 33-35, 43-48, 59-63, 69-73, 79-81, ou 85-89.
Par « fragment fonctionnel » d'un anticorps selon l'invention, on entend désigner en particulier un fragment d'anticorps, tel que des fragments Fv, scFv (se pour simple chaîne), Fab, F(ab')2, Fab', scFv-Fc ou diabodies, ou tout fragment dont la durée de demie-vie aurait été augmentée. De tels fragments fonctionnels seront décrits en détails plus loin dans la présente description.
Par « composé dérivé » d'un anticorps selon l'invention, on entend désigner en particulier une protéine de liaison comprenant une charpente peptidique ou « scaffold » et au moins l'un des CDRs de l'anticorps d'origine afin d'en conserver la capacité de reconnaissance. De tels composés dérivés sont bien connus de l'homme de l'art et seront décrits plus en détails dans la suite de la présente description.
De manière plus préférée, l'invention comprend les anticorps, leurs composés dérivés ou leurs fragments fonctionnels, selon la présente invention, notamment chimériques ou humanisés, obtenus par recombinaison génétique ou par synthèse chimique.
Selon une forme de réalisation préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention est caractérisé en ce qu'il consiste en un anticorps monoclonal.
Il faut entendre par « anticorps monoclonal » un anticorps issu d'une population d'anticorps sensiblement homogènes. Plus particulièrement, les anticorps individuels d'une population sont identiques à l'exception de quelques mutations éventuelles pouvant se produire naturellement qui peuvent se retrouver en proportions minimes. En d'autres termes, un anticorps monoclonal consiste en un anticorps homogène résultant de la prolifération d'un seul clone cellulaire (par exemple un hybridome, une cellule hôte eucaryote transféctée avec une molécule d'ADN codant pour l'anticorps homogène, une cellule hôte procary ote transféctée avec une molécule d'ADN codant pour l'anticorps homogène, etc.) et qui est généralement caractérisé par des chaînes lourdes d'une seule et même classe et sous-classe, et des chaînes légères d'un seul type. Les anticorps monoclonaux sont fortement spécifiques et sont dirigés contre un seul antigène. En outre, contrairement aux préparations d'anticorps polyclonaux qui comprennent classiquement différents anticorps dirigés contre différents déterminants, ou épitopes, chaque anticorps monoclonal est dirigé contre un seul épitope de l'antigène.
Il doit être compris ici que l'invention ne concerne pas les anticorps sous forme naturelle, c'est-à-dire qu'ils ne sont pas pris dans leur environnement naturel mais qu'ils ont pu être isolés ou obtenus par purification à partir de sources naturelles, ou bien obtenus par recombinaison génétique, ou par synthèse chimique, et qu'ils peuvent alors comporter des acides aminés non naturels comme cela sera décrit plus loin.
Plus particulièrement, selon une première forme d'exécution de l'invention, il est décrit un premier anticorps qui est caractérisé en ce qu'il comprend i) une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll,
CDR-L2 et CDR-L3, avec
- CDR-Ll choisi parmi les CDRs de séquence SEQ ID No. 1 ou 59 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 1 ou 59 ; - CDR-L2 choisi parmi les CDRs de séquence SEQ ID No. 2 ou 60 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 2 ou 60 ;
- CDR-L3 de séquence SEQ ID No. 3 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 3; et/ou ii) une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3, avec
- CDR-Hl choisi parmi les CDRs de séquence SEQ ID No. 4 ou 61 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 4 ou 61 ;
- CDR-H2 choisi parmi les CDRs de séquence SEQ ID No. 5 ou 62 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 5 ou 62 ;
- CDR-H3 choisi parmi les CDRs de séquence SEQ ID No. 6 ou 63 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 6 ou 63.
Selon une deuxième forme d'exécution de l'invention, il est décrit un deuxième anticorps qui est caractérisé en ce qu'il comprend i) une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3, avec
- CDR-Ll choisi parmi les CDRs de séquence SEQ ID No. 17 ou 69 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 17 ou 69 ; - CDR-L2 choisi parmi les CDRs de séquence SEQ ID No. 18 ou 70 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 18 ou 70 ;
- CDR-L3 de séquence SEQ ID No. 19, ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 19 ; et/ou ii) une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3, avec
- CDR-Hl choisi parmi les CDRs de séquence SEQ ID No. 20 ou 71 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 20 ou 71 ;
- CDR-H2 choisi parmi les CDRs de séquence SEQ ID No. 21 ou 72 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 21 ou 72 ; - CDR-H3 choisi parmi les CDRs de séquence SEQ ID No. 22 ou 73 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 22 ou 73.
Selon encore une troisième forme d'exécution de l'invention, il est décrit un troisième anticorps qui est caractérisé en ce qu'il comprend i) une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll,
CDR-L2 et CDR-L3, avec
- CDR-Ll choisi parmi les CDRs de séquence SEQ ID No. 33 ou 79 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 33 ou 79 ; - CDR-L2 choisi parmi les CDRs de séquence SEQ ID No. 2 ou 60 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 2 ou 60 ;
- CDR-L3 de séquence SEQ ID No. 3 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 3 ; et/ou ii) une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3, avec - CDR-Hl choisi parmi les CDRs de séquence SEQ ID No. 4 ou 61 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 4 ou 61 ;
- CDR-H2 choisi parmi les CDRs de séquence SEQ ID No. 34 ou 80 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 34 ou 80 ;
- CDR-H3 choisi parmi les CDRs de séquence SEQ ID No. 35 ou 81 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 35 ou 81. Enfin, selon une dernière forme d'exécution de l'invention, il est décrit un quatrième anticorps qui est caractérisé en ce qu'il comprend i) une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3, avec
- CDR-Ll choisi parmi les CDRs de séquence SEQ ID No. 43 ou 85 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 43 ou 85 ;
- CDR-L2 choisi parmi les CDRs de séquence SEQ ID No. 44 ou 86 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 44 ou 86 ; - CDR-L3 de séquence SEQ ID No. 45 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 45 ; et/ou ii) une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl,
CDR-H2 et CDR-H3, avec - CDR-Hl choisi parmi les CDRs de séquence SEQ ID No. 46 ou 87 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 46 ou 87 ;
- CDR-H2 choisi parmi les CDRs de séquence SEQ ID No. 47 ou 88 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 47 ou 88 ;
- CDR-H3 choisi parmi les CDRs de séquence SEQ ID No. 48 ou 89 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 48 ou 89. De manière générale, il est ici rappelé que par région CDR ou CDR, on entend désigner les régions hypervariables des chaînes lourdes et légères des immunoglobulines. Il existe 3 CDRs de chaîne lourde et 3 CDRs de chaîne légère. Le terme CDR ou CDRs est utilisé ici pour désigner suivant les cas, l'une de ces régions ou plusieurs, voire l'ensemble, de ces régions qui contiennent la majorité des résidus d'acide aminés responsables de la liaison par affinité de l'anticorps pour l'antigène ou l'épitope qu'il reconnaît.
Selon une première approche, les CDRs peuvent être définies suivant le système IMGT. Le système de numérotation unique IMGT a été défini de manière à comparer les domaines variables quelque soit l'antigène, le type de chaîne ou l'espèce [Lefranc M.-P., Immunology Today 18, 509 (1997) ; Lefranc M.-P., The Immunologist, 7, 132- 136 (1999) ; Lefranc, M.-P., Pommié, C, Ruiz, M., Giudicelli, V., Foulquier, E., Truong, L., Thouvenin-Contet, V. and Lefranc, Dev. Comp. Immunol., 27, 55-77 (2003)]. Dans ce système de numérotation, les acides aminés conservés gardent toujours la même position comme la cystéine 23 (lst-CYS), le tryptophane 41 (CONSERVED TRP), l'acide aminé hydrophobe 89, la cystéine 104 (2nd-CYS), la phénylalanine ou tryptophane 118 (J-PHE ou TRP). Le système de numérotation unique IMGT fournit donc une délimitation standardisée des régions charpentes (FRl-IMGT : positions 1 à 26, FR2-IMGT : positions 39 à 55, FR3-IMGT : positions 66 à 104 et FR4 IMGT : positions 118 à 128) ainsi que des régions déterminant la complémentarité ou CDRs (CDRl-IMGT : positions 27 à 38, CDR2-IMGT : positions 56 à 65 et CDR3-IMGT : positions 105 à 117). Comme les « trous » ou « espaces » représentent des positions inoccupées, la longueur des CDR selon IMGT devient une information cruciale. Le système IMGT est utilisé dans les représentations graphiques en 2D, désignés alors comme les colliers de perles IMGT [Ruiz, M. and Lefranc, M.-P., Immunogenetics, 53, 857-883 (2002) ; Kaas, Q. and Lefranc, M.-P., Current Bioinformatics, 2, 21-30 (2007)], et dans les structures en 3D nommées IMGT/3Dstructure-DB [Kaas, Q., Ruiz, M. and Lefranc, M.-P., T cell receptor and MHC structural data. Nucl. Acids. Res., 32, D208-D210 (2004)]. Suivant cette première approche, le premier anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll , CDR-L2 et CDR-L3 respectivement de séquence SEQ ID No. 1, 2 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 1, 2 et 3 ; et/ou une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3 respectivement de séquence SEQ ID No. 4, 5 et 6, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 4, 5 et 6.
Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes :
SEQ ID No. 1 ASVEYYGTSL SEQ ID No. 2 EAS SEQ ID No. 3 QQSRKAPYT SEQ ID No. 4 GFTFSTYT SEQ ID No. 5 ISSGGGTT SEQ ID No. 6 ATPRIGTGFAY
Plus particulièrement, de manière préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID Nos. 1, 2 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 1, 2 et 3.
De manière également préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne lourde comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID No. 4, 5 et 6, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 4, 5 et 6.
Suivant cette même approche, le deuxième anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3 respectivement de séquence SEQ ID No. 17, 18 et 19, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 17, 18 et 19 ; et/ou une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3 respectivement de séquence SEQ ID No. 20, 21 et 22, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 20, 21 et 22.
Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes : SEQ ID No. 17 : ATPRIGTGF AY SEQ ID No. 18 : SAS SEQ ID No. 19 : QQYSSNPT SEQ ID No. 20 : GFTLSTSGMG SEQ ID No. 21 : IYWDDDK
SEQ ID No. 22 : ARRDHYGDYSYAMDY
Plus particulièrement, de manière préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence
SEQ ID Nos. 17, 18 et 18, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 17, 18 et 19.
De manière également préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne lourde comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID No. 20, 21 et 22, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 20, 21 et 22.
Toujours suivant cette même approche, le troisième anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3 respectivement de séquence SEQ ID No. 33, 2 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 33, 2 et 3 ; et/ou une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3 respectivement de séquence SEQ ID No. 4, 34 et 35, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 4, 34 et 35.
Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes : SEQ ID No. 33 : ASVD YYGTSL SEQ ID No. 34 : ISSGGVTT SEQ ID No. 35 : TSPRTGTGFAY
Plus particulièrement, de manière préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID Nos. 33, 2 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 33, 2 et 3.
De manière également préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne lourde comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID No. 4, 34 et 35, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 4, 34 et 35.
Enfin, toujours selon cette même approche, le quatrième et dernier anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3 respectivement de séquence SEQ ID No. 43, 44 et 45, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 43, 44 et 45 ; et/ou une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3 respectivement de séquence SEQ ID No. 46, 47 et 48, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 46, 47 et 48.
Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes : SEQ ID No. 43 : ENVGTY SEQ ID No. 44 : GAS SEQ ID No. 45 : GQTYSFPYT SEQ ID No. 46 : GYTFTSSS SEQ ID No. 47 : IHPNSGNT SEQ ID No. 48 : ARARSFYY AMDC
Plus particulièrement, de manière préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID Nos. 43, 44 et 45, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 43, 44 et 45.
De manière également préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne lourde comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID No. 46, 47 et 48, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 46, 47 et 48.
Selon une deuxième approche, les CDRs peuvent être définies suivant l'approche classique de Kabat et al. (Kabat et al, Séquences of proteins of immunological interest, 5th Ed., U.S. Department of Health and Human Services, NIH, 1991, and later éditions).
Suivant cette première approche, le premier anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3 respectivement de séquence SEQ ID No. 59, 60 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 59, 60 et 3 ; et/ou une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3 respectivement de séquence SEQ ID No. 61, 62 et 63, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 61, 62 et 63.
Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes : SEQ ID No. 59 : RASASVEYYGTSLMH SEQ ID No. 60 : EASNVES SEQ ID No. 61 : STYTMS
SEQ ID No. 62 : YISSGGGTTYYPDTVKG SEQ ID No. 63 : PRIGTGFAY
Plus particulièrement, de manière préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence
SEQ ID Nos. 59, 60 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et
98% d'identité après alignement optimal avec les séquences SEQ ID No. 59, 60 et 3.
De manière également préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne lourde comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID No. 61,
62 et 63, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 61, 62 et 63. Suivant cette même approche, le deuxième anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3 respectivement de séquence SEQ ID No. 69, 70 et 19, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 69, 70 et 19 ; et/ou une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3 respectivement de séquence SEQ ID No. 71, 72 et 73, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 71, 72 et 73. Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes :
SEQ ID No. 69 : KASQNVGIAVA SEQ ID No. 70 : SASNRYT SEQ ID No. 71 : STSGMGVS SEQ ID No. 72 : HIYWDDDKRYNPSLKS SEQ ID No. 73 : RDHYGDYS YAMDY
Plus particulièrement, de manière préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID Nos. 69, 70 et 19, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 69, 70 et 19.
De manière également préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne lourde comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID No. 71, 72 et 73, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 71, 72 et 73.
Toujours suivant cette même approche, le troisième anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3 respectivement de séquence SEQ ID No. 79, 60 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 79, 60 et 3 ; et/ou une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3 respectivement de séquence SEQ ID No. 61, 80 et 81, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 100, 101 et 102. Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes : SEQ ID No. 79 : ASVD YYGTSL SEQ ID No. 80 : YISSGGVTTYYPDTIKG SEQ ID No. 81 : PRTGTGFAY
Plus particulièrement, de manière préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID Nos. 79, 60 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 79, 60 et 3.
De manière également préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne lourde comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID No. 61, 80 et 81, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 61, 80 et 81.
Enfin, toujours selon cette même approche, le quatrième et dernier anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3 respectivement de séquence SEQ ID No. 85, 86 et 45, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 85, 86 et 45 ; et/ou une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR-H2 et CDR-H3 respectivement de séquence SEQ ID No. 87, 88 et 89, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 87, 88 et 89.
Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes : SEQ ID No. 85 : KASENVGTYVS SEQ ID No. 86 : GASNRYTGVPD SEQ ID No. 87 : TSSSMH SEQ ID No. 88 : EIHPNSGNTNNNEKFKG SEQ ID No. 89 : ARSFYYAMDC Plus particulièrement, de manière préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID Nos. 85, 86 et 45, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 85, 86 et 45.
De manière également préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne lourde comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID No. 87, 88 et 89, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 87, 88 et 89.
Dans la présente description, les termes polypeptides, séquences polypeptidiques, peptides et protéines attachés aux composés anticorps ou à leur séquence sont interchangeables. II doit être compris ici que l'invention ne concerne pas les anticorps sous forme naturelle, c'est-à-dire qu'ils ne sont pas pris dans leur environnement naturel mais qu'ils ont pu être isolés ou obtenus par purification à partir de sources naturelles, ou bien obtenus par recombinaison génétique, ou par synthèse chimique, et qu'ils peuvent alors comporter des acides aminés non naturels comme cela sera décrit plus loin. Par « pourcentage d'identité » entre deux séquences d'acide nucléique ou d'acide aminé au sens de la présente invention, on entend désigner un pourcentage de nucléotides ou de résidus d'acides aminés identiques entre les deux séquences à comparer, obtenu après le meilleur alignement (alignement optimal), ce pourcentage étant purement statistique et les différences entre les deux séquences étant réparties au hasard et sur toute leur longueur. Les comparaisons de séquences entre deux séquences d'acide nucléique ou d'acide aminé sont traditionnellement réalisées en comparant ces séquences après les avoir alignées de manière optimale, ladite comparaison pouvant être réalisée par segment ou par « fenêtre de comparaison ». L'alignement optimal des séquences pour la comparaison peut être réalisé, outre manuellement, au moyen de l'algorithme d'homologie locale de Smith et Waterman (1981) [Ad. App. Math. 2:482], au moyen de l'algorithme d'homologie locale de Neddleman et Wunsch (1970) [J. Mol. Biol. 48:443], au moyen de la méthode de recherche de similarité de Pearson et Lipman (1988) [Proc. Natl. Acad. Sci. USA 85:2444], au moyen de logiciels informatiques utilisant ces algorithmes (GAP, BESTFIT, FASTA et TFASTA dans le Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI, ou encore par les logiciels de comparaison BLAST N ou BLAST P).
Le pourcentage d'identité entre deux séquences d'acide nucléique ou d'acide aminé est déterminé en comparant ces deux séquences alignées de manière optimale dans laquelle la séquence d'acide nucléique ou d'acide aminé à comparer peut comprendre des additions ou des délétions par rapport à la séquence de référence pour un alignement optimal entre ces deux séquences. Le pourcentage d'identité est calculé en déterminant le nombre de positions identiques pour lesquelles le nucléotide ou le résidu d'acide aminé est identique entre les deux séquences, en divisant ce nombre de positions identiques par le nombre total de positions dans la fenêtre de comparaison et en multipliant le résultat obtenu par 100 pour obtenir le pourcentage d'identité entre ces deux séquences.
Par exemple, on pourra utiliser le programme BLAST, « BLAST 2 séquences » (Tatusova et al., "Blast 2 séquences - a new tool for comparing protein and nucléotide séquences", FEMS Microbiol Lett. 174:247-250) disponible sur le site http://www.ncbi.nlm.nih.gov/gorf/bl2.html, les paramètres utilisés étant ceux donnés par défaut (en particulier pour les paramètres « open gap penaltie » : 5, et « extension gap penaltie » : 2 ; la matrice choisie étant par exemple la matrice « BLOSUM 62 » proposée par le programme), le pourcentage d'identité entre les deux séquences à comparer étant calculé directement par le programme.
Par séquence d'acide aminé présentant au moins 80 %, de préférence 85 %, 90 %, 95 % et 98 % d'identité avec une séquences d'acide aminé de référence, on préfère celles présentant par rapport à la séquence de référence, certaines modifications, en particulier une délétion, addition ou substitution d'au moins un acide aminé, une troncation ou un allongement. Dans le cas d'une substitution, d'un ou plusieurs acide(s) aminé(s) consécutifs) ou non consécutifs), on préfère les substitutions dans lesquelles les acides aminés substitués sont remplacés par des acides aminés « équivalents ». L'expression « acides aminés équivalents » vise ici à désigner tout acide aminé susceptible d'être substitué à l'un des acides aminés de la structure de base sans cependant modifier essentiellement les activités biologiques des anticorps correspondants et telles qu'elles seront définies par la suite, notamment dans les exemples. Ces acides aminés équivalents peuvent être déterminés soit en s 'appuyant sur leur homologie de structure avec les acides aminés auxquels ils se substituent, soit sur des résultats d'essais comparatifs d'activité biologique entre les différents anticorps susceptibles d'être effectués.
A titre d'exemple non limitatif, le tableau 1 ci-dessous reprend les possibilités de substitution susceptibles d'être effectuées sans qu'il en résulte une modification approfondie de l'activité biologique de l'anticorps modifié correspondant, les substitutions inverses étant naturellement envisageables dans les mêmes conditions.
Figure imgf000020_0001
Tableau 1
II est admis par l'homme de l'art, comme état de la technique, que la plus grande variabilité (longueur et composition) entre les 6 CDRs se retrouve chez les 3 CDRs de la chaîne lourde et, plus particulièrement, le CDR-H3 de cette chaîne lourde. Par conséquent, il sera évident que les CDRs caractéristiques préférés de l'anticorps selon l'invention seront les 3 CDRs de la chaîne lourde et, encore plus préférentiellement, le CDR correspondant au CDR-H3.
Dans un mode de réalisation particulier, la présente invention est relative à un anticorps murin, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention
Selon une autre forme de réalisation de l'invention, ledit premier anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels comprend une chaîne légère comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID No. 1, 2 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 1, 2 et 3 ; et une chaîne lourde comprenant les trois CDRs respectivement de séquence SEQ ID Nos. 4, 5 et 6, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 4, 5 et 6. Selon encore une autre forme de réalisation de l'invention, ledit premier anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels comprend une chaîne légère comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID No. 59, 60 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 59, 60 et 3 ; et une chaîne lourde comprenant les trois CDRs respectivement de séquence SEQ ID Nos. 61, 62 et 63, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 61, 62 et 63.
Selon encore une autre forme de réalisation, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère de séquence comprenant la séquence d'acide aminé SEQ ID No. 7 ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec la séquence SEQ ID No. 7, et/ou en ce qu'il comprend une chaîne lourde de séquence comprenant la séquence d'acide aminé SEQ ID No. 8 ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec la séquence SEQ ID No. 8.
Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes : SEQ ID No. 7 :
DIVLSQSPASLALSLGQRATISCRASASVEYYGTSLMHWYQQKPGQPPKLLIYE ASNVESGVPARFSGSGSGTDFSLNIHPVEEDDLAIYFCQQSRKAPYTFGGGTKLE IK SEQ ID No. 8 :
EVKLVESGGGLVQPGGSLKLSCAASGFTFSTYTMSWVRQTPEKRLEWVAYISS GGGTTYYPDTVKGRFTISRDNARNTLYLQMNSLKSEDTAMYYCATPRIGTGFA YWGQGTLVTVSA
Selon une autre forme de réalisation de l'invention, ledit deuxième anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels comprend une chaîne légère comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID No. 17, 18 et 19, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 17, 18 et 19 ; et une chaîne lourde comprenant les trois CDRs respectivement de séquence SEQ ID Nos. 20, 21 et 22, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 20, 21 et 22.
Selon encore une autre forme de réalisation de l'invention, ledit deuxième anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels comprend une chaîne légère comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID No. 69, 70 et 19, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 69, 70 et 19 ; et une chaîne lourde comprenant les trois CDRs respectivement de séquence SEQ ID Nos. 71, 72 et 73, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 71, 72 et 73.
Selon encore une autre forme de réalisation, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère de séquence comprenant la séquence d'acide aminé SEQ ID No. 23 ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec la séquence SEQ ID No. 23, et/ou en ce qu'il comprend une chaîne lourde de séquence comprenant la séquence d'acide aminé SEQ ID No. 24 ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec la séquence SEQ ID No. 24.
Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes : SEQ ID No. 23 : DIVMTQSQKFMSTSEGDRVSITCKASQNVGIAVAWYQQKPGQSPKLLIYSASNR YTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSNPTFGAGTKLELK SEQ ID No. 24 :
QVTLKESGPGILQPSQTLSLTCSFSGFTLSTSGMGVSWIRQPSGKGLEWLAHIYW DDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARRDHYGDYSY AMDYWGQGTSVTVSS
Selon une autre forme de réalisation de l'invention, ledit troisième anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels comprend une chaîne légère comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID No. 33, 2 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 33, 2 et 3 ; et une chaîne lourde comprenant les trois CDRs respectivement de séquence SEQ ID Nos. 4, 34 et 35, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 4, 34 et 35. Selon encore une autre forme de réalisation de l'invention, ledit troisième anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels comprend une chaîne légère comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID No. 79, 60 et 3, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 79, 60 et 3 ; et une chaîne lourde comprenant les trois CDRs respectivement de séquence SEQ ID Nos. 61, 80 et 81, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 61, 80 et 81.
Selon encore une autre forme de réalisation, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère de séquence comprenant la séquence d'acide aminé SEQ ID No. 36 ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec la séquence SEQ ID No. 36, et/ou en ce qu'il comprend une chaîne lourde de séquence comprenant la séquence d'acide aminé SEQ ID No. 37 ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec la séquence SEQ ID No. 37.
Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes : SEQ ID No. 36 :
DIVLTQSPASLALSLGQRATISCRASASVDYYGTSLMQWYQQKPGQPPKLLIYE
ASNVESGVPARFSGSGSGTDFSLNIHPVEEDDLAIYFCQQSRKAPYTFGGGTKLE
IK
SEQ ID No. 37 : EVKLVESGGDLVQPGGSLKLSCAASGFTFSTYTMSWVRQTPEKRLEWVAYISS GGVTTYYPDTIKGRFTISRDNAKNTLFLQMNSLKSEDTAMYYCTSPRTGTGFAY WGQGTLVTVSA
Selon une autre forme de réalisation de l'invention, ledit quatrième anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels comprend une chaîne légère comprenant les trois CDRs, tels que définis selon IMGT, respectivement de séquence SEQ ID No. 43, 44 et 45, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 43, 44 et 45 ; et une chaîne lourde comprenant les trois CDRs respectivement de séquence SEQ ID Nos. 46, 47 et 48, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 46, 47 et 48.
Selon encore une autre forme de réalisation de l'invention, ledit quatrième anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels comprend une chaîne légère comprenant les trois CDRs, tels que définis selon Kabat, respectivement de séquence SEQ ID No. 85, 86 et 45, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 85, 86 et 45 ; et une chaîne lourde comprenant les trois CDRs respectivement de séquence SEQ ID Nos. 87, 88 et 89, ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec les séquences SEQ ID No. 87, 88 et 89.
Selon encore une autre forme de réalisation, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention comprend une chaîne légère de séquence comprenant la séquence d'acide aminé SEQ ID No. 49 ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec la séquence SEQ ID No. 49, et/ou en ce qu'il comprend une chaîne lourde de séquence comprenant la séquence d'acide aminé SEQ ID No. 50 ou présentant au moins 80%, de préférence 85%, 90%, 95% et 98% d'identité après alignement optimal avec la séquence SEQ ID No. 50.
Pour plus de clarté, les séquences protéiques mentionnées sont les suivantes : SEQ ID No. 49 :
NIVMTQSPKSMSMSVGERVTLSCKASENVGTYVSWYQQKPEQSPKLLIYGASN RYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQTYSFPYTFGGGTKLEIK SEQ ID No. 50 :
QVQLQQPGSVLVRPGASVKLSCKASGYTFTSSSMHWAKQRPGQGLEWIGEIHP NSGNTNNNEKFKGKATLTVDTSSSTAYVDLSSLSSEDSAVYYCARARSFYYAM DCWGQGTSVTVSS
Comme vu plus haut, l'invention vise également tout composé dérivé d'un anticorps selon l'invention.
Plus particulièrement, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention est caractérisé en ce que ledit composé dérivé consiste en une protéine de liaison comprenant une charpente peptidique sur laquelle est greffé au moins un CDR de manière à conserver tout ou partie des propriétés paratopiques de reconnaissance de l'anticorps initial.
Une ou plusieurs séquences parmi les séquences des CDRs décrits dans cette invention peuvent aussi être présentées sur des charpentes (ou « scaffold » selon la nomenclature anglaise) protéiques différentes des immunoglobulines. Dans ce cas, la séquence protéique permet de recréer un squelette peptidique favorable au repliement du ou des CDRs greffés, lui(leur) permettant de conserver leurs propriétés paratopiques de reconnaissance de l'antigène.
De manière générale, l'homme de l'art sait déterminer le type de charpente protéique sur laquelle greffer au moins l'un des CDRs issu(s) de l'anticorps originel. Plus particulièrement, il est connu que, pour être sélectionnées, de telles charpentes doivent répondre au plus grand nombre de critères tels qu'énumérés ci-dessous (Skerra
A., J. Mol. Recogn. 13, 2000, 167-187) : bonne conservation phylogénétique ; structure tri-dimensionnelle connue (comme par exemple par cristallographie, spectroscopie NMR ou toute autre technique connue de l'homme de l'art) ; - petite taille ; - peu ou pas de modifications post-transcriptionelle ; et/ou facile à produire, à exprimer et à purifier.
L'origine de telles charpentes protéiques peut être, mais n'est pas limitée à des structures sélectionnées parmi : la fibronectine et préférentiellement le lOème domaine de la fibronectine de type 3, la lipocaline, l'anticaline (Skerra A., J. Biotechnol., 2001, 74(4) :251 -IS), la protéine Z issue du domaine B de la protéine A de Staphylococcus aureus, la thioredoxin A ou encore les protéines à motifs répétés de type "ankyrin repeat" (Kohi et al, PNAS, 2003, vol.100, No. 4, 1700-1705), "armadillo repeat", "leucine-rich repeat" ou "tetratricopeptide repeat".
Peuvent également être mentionnées les charpentes dérivées de toxines comme, par exemple les toxines suivantes issues de scorpions, insectes, plantes, mollusques, ...) ou les inhibiteurs protéiques de la NO synthase neuronale (PIN).
Comme exemple, aucunement limitatif, de telles constructions hybrides, il peut être cité l'insertion du CDR-Hl (chaîne lourde) d'un anticorps anti-CD4, à savoir le 13B8.2, sur l'une des boucles de PIN, la nouvelle protéine de liaison ainsi obtenue conservant les mêmes propriétés de liaison que l'anticorps d'origine (Bes et al, BBRC 343, 2006, 334- 344). Peut également être mentionné à titre illustratif la greffe du CDR-H3 (chaîne lourde) d'un anticorps VHH anti-lyzozyme sur l'une des boucles de la neocarzinostatine (Nicaise et al, 2004).
Enfin, comme décrit plus haut, de telles charpentes peptidiques peuvent comprendre de 1 à 6 CDR(s) issu(s) de l'anticorps d'origine. De manière préférée, mais sans aucune obligation, l'homme de l'art sélectionnera au moins un CDR issu de la chaîne lourde, cette dernière étant connue pour être principalement responsable de la spécificité de l'anticorps. La sélection du ou des CDR(s) pertinent(s) est évidente pour l'homme de l'art, ce dernier mettant alors en œuvre des techniques connues (Bes et al., FEBS letters 508, 2001 67-74).
Bien évidemment, ces exemples ne sont aucunement limitatifs, et toute autre structure connue ou évidente pour l'homme de l'art doit être considérée comme faisant partie de la protection conférée par la présente demande de brevet. La présente invention a donc pour objet un anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels caractérisé en ce que la charpente peptidique est sélectionnée parmi les protéines a) phylogénétiquement bien conservée, b) d'architecture robuste, c) avec une organisation moléculaire en trois dimensions bien connues, d) de petite taille et/ou e) comprenant des régions pouvant être modifiées par délétion et/ou insertion sans modifications des propriétés de stabilité.
Selon une forme de réalisation préférée, l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention est caractérisé en ce que ladite charpente peptidique est sélectionnée parmi i) les charpentes issues de la fîbronectine, préférentiellement le lOème domaine de la fîbronectine de type 3, la lipocaline, l'anticaline, la protéine Z issue du domaine B de la protéine A de Staphylococcus aureus, la thioredoxin A, ii) les protéines à motifs répétés de type "ankyrin repeat", "armadillo repeat", "leucine-rich repeat" ou "tetratricopeptide repeat", ou encore iii) les inhibiteurs protéiques de la NO synthase neuronale (PIN). Selon un autre aspect de l'invention, il est également fait mention des fragments fonctionnels de l'anticorps décrit plus haut.
Plus particulièrement, l'invention vise un anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, l'invention caractérisé en ce que ledit fragment fonctionnel est choisi parmi les fragments Fv, Fab, (Fab')2, Fab', scFv, scFv-Fc et les diabodies, ou tout fragment dont la demie-vie aurait été augmentée comme des fragments pégylés.
De tels fragments fonctionnels d'anticorps selon l'invention consistent, par exemple, en des fragments Fv, scFv (se pour simple chaîne), Fab, F(ab')2, Fab', scFv-Fc ou diabodies, ou tout fragment dont la durée de demie-vie aurait été augmentée par modification chimique, comme l'ajout de poly(alkylène) glycol tel que le poly(éthylène)glycol ("PEGylation") (fragments PEGylés appelés Fv-PEG, scFv-PEG, Fab-PEG, F(ab')2-PEG ou Fab'-PEG) (« PEG » d'après la nomenclature anglaise Poly(Ethylene) Glycol), ou par incorporation dans un liposome, microsphères ou PLGA, lesdits fragments présentant au moins un des CDRs caractéristiques selon l'invention, et, notamment, en ce qu'il est capable d'exercer de manière générale une activité même partielle de l'anticorps dont il est issu.
De préférence, lesdits fragments fonctionnels seront constitués ou comprendront une séquence partielle de la chaîne variable lourde ou légère de l'anticorps dont ils sont dérivés, ladite séquence partielle étant suffisante pour retenir la même spécificité de liaison que l'anticorps dont elle est issue et une affinité suffisante, de préférence au moins égale à 1/100, de manière plus préférée à au moins 1/10 de celle de l'anticorps dont elle est issue. Un tel fragment fonctionnel comportera au minimum 5 acides aminés, de préférence 10, 15, 25, 50 et 100 acides aminés consécutifs de la séquence de l'anticorps dont il est issu.
De préférence, ces fragments fonctionnels seront des fragments de type Fv, scFv, Fab, F(ab')2, F(ab'), scFv-Fc ou diabodies, qui possèdent généralement la même spécificité de fixation que l'anticorps dont ils sont issus. Selon la présente invention, des fragments d'anticorps de l'invention peuvent être obtenus à partir des anticorps tels que décrits précédemment par des méthodes telles que la digestion par des enzymes, comme la pepsine ou la papaïne et/ou par clivage des ponts disulfures par réduction chimique. D'une autre manière les fragments d'anticorps compris dans la présente invention peuvent être obtenus par des techniques de recombinaisons génétiques bien connues également de l'homme de l'art ou encore par synthèse peptidique au moyen par exemple de synthétiseurs automatiques de peptides tels que ceux fournis par la société Applied Biosystems, etc..
Sous un aspect également particulier, la présente invention est relative à un anticorps chimérique, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention, caractérisé en ce que ledit anticorps comprend en outre les régions constantes de chaîne légère et de chaîne lourde dérivées d'un anticorps d'une espèce hétérologue à la souris, notamment de l'Homme.
Selon encore un autre aspect de l'invention, l'anticorps humanisé, ou l'un de ses composés dérivés ou fragments fonctionnels, est caractérisé en ce que les régions constantes de chaîne légère et de chaîne lourde dérivées d'un anticorps humain sont respectivement la région lambda ou kappa et gamma- 1, gamma-2 ou gamma-4.
Selon un autre aspect, l'invention est relative à un premier hybridome murin capable de sécréter un anticorps monoclonal selon la présente invention, notamment l'hybridome d'origine murine tel que déposé au Centre National de Culture de Microorganisme (CNCM) (Institut Pasteur, Paris, France) le 22 février 2008 sous le numéro 1-3920. Ledit hybridome a été obtenu par fusion de splénocytes de souris immunisées Balb/c et de lignées cellulaires de myélome Sp 20 Ag 14. L'anticorps monoclonal dénommé ici 203B6, ou l'un de ses composés dérivés ou fragments fonctionnels est sécrété par ledit hybridome déposé à la CNCM le 22 février 2008 sous le numéro 1-3920.
Selon un autre aspect, l'invention est relative à un deuxième hybridome murin capable de sécréter un anticorps monoclonal selon la présente invention, notamment l'hybridome d'origine murine tel que déposé au Centre National de Culture de Microorganisme (CNCM) (Institut Pasteur, Paris, France) le 22 février 2008 sous le numéro 1-3921. Ledit hybridome a été obtenu par fusion de splénocytes de souris immunisées Balb/c et de lignées cellulaires de myélome Sp 20 Ag 14. L'anticorps monoclonal dénommé ici 205H8, ou l'un de ses composés dérivés ou fragments fonctionnels est sécrété par ledit hybridome déposé à la CNCM le 22 février 2008 sous le numéro 1-3921.
Selon un autre aspect, l'invention est relative à un troisième hybridome murin capable de sécréter un anticorps monoclonal selon la présente invention, notamment l'hybridome d'origine murine tel que déposé au Centre National de Culture de Microorganisme (CNCM) (Institut Pasteur, Paris, France) le 21 février 2008 sous le numéro 1-3918. Ledit hybridome a été obtenu par fusion de splénocytes de souris immunisées Balb/c et de lignées cellulaires de myélome Sp 20 Ag 14. L'anticorps monoclonal dénommé ici 211F3, ou l'un de ses composés dérivés ou fragments fonctionnels est sécrété par ledit hybridome déposé à la CNCM le 21 février 2008 sous le numéro 1-3918.
Enfin, selon un autre aspect, l'invention est relative à un quatrième hybridome murin capable de sécréter un anticorps monoclonal selon la présente invention, notamment l'hybridome d'origine murine tel que déposé au Centre National de Culture de Microorganisme (CNCM) (Institut Pasteur, Paris, France) le 21 février 2008 sous le numéro 1-3919. Ledit hybridome a été obtenu par fusion de splénocytes de souris immunisées Balb/c et de lignées cellulaires de myélome Sp 20 Ag 14. L'anticorps monoclonal dénommé ici 214B2, ou l'un de ses composés dérivés ou fragments fonctionnels est sécrété par ledit hybridome déposé à la CNCM le 21 février 2008 sous le numéro 1-3919.
Pour plus de clarté, le tableau 2 ci dessous regroupe les différentes séquences en acides aminés correspondant aux différents anticorps selon l'invention avec les séquences de CDR définies selon IMGT en gras et celles définies selon Kabat en italique.
Figure imgf000030_0001
Tableau 2
Sont également compris par anticorps selon la présente invention, les anticorps chimériques ou humanisés.
Par anticorps chimérique, on entend désigner un anticorps qui contient une région variable (chaîne légère et chaîne lourde) naturelle dérivée d'un anticorps d'une espèce donnée en association avec les régions constantes de chaîne légère et chaîne lourde d'un anticorps d'une espèce hétérologue à ladite espèce donnée.
Les anticorps ou leurs fragments de type chimérique selon l'invention peuvent être préparés en utilisant les techniques de recombinaison génétique. Par exemple, l'anticorps chimérique pourra être réalisé en clonant un ADN recombinant comportant un promoteur et une séquence codant pour la région variable d'un anticorps monoclonal non humain, notamment murin, selon l'invention et une séquence codant pour la région constante d'anticorps humain. Un anticorps chimérique de l'invention codé par un tel gène recombinant sera par exemple une chimère souris-homme, la spécificité de cet anticorps étant déterminée par la région variable dérivée de l'ADN murin et son isotype déterminé par la région constante dérivée de l'ADN humain. Pour les méthodes de préparation d'anticorps chimériques, on pourra par exemple se référer au document Verhoeyn et al. (BioEssays, 8:74, 1988).
Par anticorps humanisés, on entend désigner un anticorps qui contient des régions CDRs dérivées d'un anticorps d'origine non humaine, les autres parties de la molécule d'anticorps étant dérivée d'un (ou de plusieurs) anticorps humains. En outre, certains des résidus des segments du squelette (dénommés FR) peuvent être modifiés pour conserver l'affinité de liaison (Jones et al, Nature, 321 :522-525, 1986 ; Verhoeyen et al, Science, 239:1534-1536, 1988 ; Riechmann et al, Nature, 332:323-327, 1988). Les anticorps humanisés selon l'invention ou leurs fragments peuvent être préparés par des techniques connues de l'homme de l'art (comme par exemple celles décrites dans les documents Singer et al., J. Immun. 150:2844-2857, 1992 ; Mountain et al, Biotechnol. Genêt. Eng. Rev., 10:1-142, 1992 ; ou Bebbington et al, Bio/Technology, 10:169-175, 1992). De tels anticorps humanisés selon l'invention sont préférés pour leur utilisation dans des méthodes de diagnostic in vitro, ou de traitement prophylactique et/ou thérapeutique in vivo. D'autres techniques d'humanisation sont également connues de l'homme de l'art comme par exemple la technique du « CDR Grafting » décrite par PDL faisant l'objet des brevets EP 0 451 261, EP 0 682 040, EP 0 939 127, EP 0 566 647 ou encore US 5,530,101, US 6,180,370, US 5,585,089 et US 5,693,761. On peut également citer les brevets US 5,639,641 ou encore 6,054,297, 5,886,152 et 5,877,293.
En outre, l'invention vise également les anticorps humanisés issus des anticorps murins décrit ci-dessus.
De manière préférée, les régions constantes de chaîne légère et de chaîne lourde dérivées d'un anticorps humain sont respectivement la région lambda ou kappa et gamma- 1, gamma-2 ou gamma-4
Dans la forme d'exécution correspondant à l'isotype IgGl, une caractéristique supplémentaire de l'anticorps est de présenter des fonctions effectrices comme l'ADCC (d'après la nomenclature anglaise « Antibody Dépendent Cellular Cytotoxicity ») et/ou la CDC (d'après la nomenclature anglaise « Complément Dépendent Cytotoxicity »).
En outre, comme cela ressortira des exemples ci-après, l'anticorps objet de la présente invention se caractérise des anticorps connus à ce jour en ce sens qu'il est capable d'inhiber la prolifération des cellules tumorales.
Comme cela a été dit plus haut, la protéine CD 151 fait partie de la famille des tétraspanines et, à ce titre, comprend 2 domaines extracellulaires ECl (18 acides aminés, séquence [40-57]) et EC2 (109 acides aminés, séquence [113-221]), appelés aussi boucles extracellulaires. Selon la présente invention, les anticorps utilisés sont capables de se lier à au moins un épitope situé dans le domaine extracellulaire. De manière préférée, ledit anticorps se fixera au niveau des boucles ECl et/ou EC2.
Plus particulièrement, selon une forme d'exécution préférée de l'invention, il est décrit l'utilisation d'au moins un anticorps anti-CD151, ou l'un de ses fragments fonctionnels, capable de se lier à un épitope compris dans la boucle extra-cellulaire 1 (ECl) et/ou 2 (EC2), préférentiellement EC2, correspondant respectivement aux acides- aminés 40-57 et 113-221 de la protéine CD151.
La boucle ECl [40-57] comprend 18 acides-aminés et présente une masse théorique de 2002,2 Da.
La boucle EC2 [113-221] possède un site de N-glycosylation (résidu Asnl59) et 6 résidus Cystéine formant 3 ponts disulfure. Un modèle structural de la boucle EC2 des tétraspanines, et notamment de CD151, a été proposé à partir de la structure tridimensionnelle de la boucle EC2 de la tétraspanine CD81 (Seigneuret et al., 2001, J. Biol. Chem. 276, 40055-40064). Selon ce modèle, les tétraspanines possèdent une charpente commune, relativement conservée et constituée de 3 hélices α, et un domaine spécifique variable. Pour CD151, cette charpente serait constituée des régions [113-157] et [209-221], et le domaine variable de la région [158-208].
Le domaine variable de la boucle EC2 serait plus particulièrement impliqué dans les interactions spécifiques de CD151 avec des protéines de la famille des intégrines.
Des expériences de mutagénèse dirigée ont notamment montré l'importance de la région
[193-208], et plus précisément du tripeptide QRD [194-196] et du résidu Cystéine en position 192, dans l'association de CD151 avec certaines intégrines récepteurs de la laminine, telles que les intégrines α3βl ou α6β4 (Kazarov et al, 2002, J. CeIl Biol. 158, 1299-1309).
De manière encore plus préférée, la présente invention vise l'utilisation d'au moins un anticorps anti-CD151, ou l'un de ses fragments fonctionnels, capable de se lier à un épitope de la région EC2.
Sous un nouvel aspect, la présente invention est relative à un acide nucléique isolé caractérisé en ce qu'il est choisi parmi les acides nucléiques suivants : a) un acide nucléique, ADN ou ARN, codant pour un anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, tel que défini plus haut ; b) un acide nucléique complémentaire d'un acide nucléique tel que défini ci-dessus en a) ; c) un acide nucléique d'au moins 18 nucléotides capable d'hybrider dans des conditions de forte stringence avec au moins l'une des séquences d'acide nucléique SEQ ID No. 9-16, 25-32, 38-42, 51-58, 64-68, 74-78, 82-84 ou 90-94 ou avec une séquence présentant au moins 80 %, de préférence 85 %, 90 %, 95 % et 98 %, d'identité après alignement optimal avec lesdites séquences.
Le tableau 3 ci-dessous regroupe les différents séquences nucléotidiques concernant les anticorps selon l'invention avec les séquences de CDR définies selon IMGT en gras et celles définies selon Kabat en italique.
Figure imgf000033_0001
Tableau 3
Par acide nucléique, séquence nucléique ou d'acide nucléique, polynucléotide, oligonucléotide, séquence de polynucléotide, séquence nucléotidique, termes qui seront employés indifféremment dans la présente description, on entend désigner un enchaînement précis de nucléotides, modifiés ou non, permettant de définir un fragment ou une région d'un acide nucléique, comportant ou non des nucléotides non naturels, et pouvant correspondre aussi bien à un ADN double brin, un ADN simple brin que des produits de transcription desdits ADNs.
Il doit être aussi compris ici que la présente invention ne concerne pas les séquences nucléotidiques dans leur environnement chromosomique naturel, c'est-à-dire à l'état naturel. Il s'agit de séquences qui ont été isolées et/ou purifiées, c'est-à-dire qu'elles ont été prélevées directement ou indirectement, par exemple par copie, leur environnement ayant été au moins partiellement modifié. On entend ainsi également désigner ici les acides nucléiques isolés obtenus par recombinaison génétique au moyen par exemple de cellules hôtes ou obtenus par synthèse chimique.
Par séquences nucléiques présentant un pourcentage d'identité d'au moins 80 %, de préférence 85 %, 90 %, 95 % et 98 %, après alignement optimal avec une séquence de préférence, on entend désigner les séquences nucléiques présentant, par rapport à la séquence nucléique de référence, certaines modifications comme en particulier une délétion, une troncation, un allongement, une fusion chimérique et/ou une substitution, notamment ponctuelle. Il s'agit de préférence de séquences dont les séquences codent pour les mêmes séquences d'acide aminés que la séquence de référence, ceci lié à la dégénérescence du code génétique, ou de séquences complémentaires qui sont susceptibles de s'hybrider spécifiquement avec les séquences de référence de préférence dans des conditions de forte stringence notamment telles que définies ci-après.
Une hybridation dans des conditions de forte stringence signifie que les conditions de température et de force ionique sont choisies de telle manière qu'elles permettent le maintien de l'hybridation entre deux fragments d'ADN complémentaires. A titre illustratif, des conditions de forte stringence de l'étape d'hybridation aux fins de définir les fragments polynucléotidiques décrits ci-dessus, sont avantageusement les suivantes. L'hybridation ADN -ADN ou ADN-ARN est réalisée en deux étapes : (1) préhybridation à 42°C pendant 3 heures en tampon phosphate (20 mM, pH 7,5) contenant 5 x SSC (1 x SSC correspond à une solution 0,15 M NaCl + 0,015 M citrate de sodium), 50 % de formamide, 7 % de sodium dodécyl sulfate (SDS), 1O x Denhardt's, 5 % de dextran sulfate et 1 % dADN de sperme de saumon ; (2) hybridation proprement dite pendant 20 heures à une température dépendant de la taille de la sonde (i.e. : 42°C, pour une sonde de taille > 100 nucléotides) suivie de 2 lavages de 20 minutes à 200C en 2 x SSC + 2 % SDS, 1 lavage de 20 minutes à 200C en 0,1 x SSC + 0,1 % SDS. Le dernier lavage est pratiqué en 0,1 x SSC + 0,1 % SDS pendant 30 minutes à 600C pour une sonde de taille > 100 nucléotides. Les conditions d'hybridation de forte stringence décrites ci-dessus pour un polynucléotide de taille définie, peuvent être adaptées par l'homme du métier pour des oligonucléotides de taille plus grande ou plus petite, selon l'enseignement de Sambrook et al, (1989, Molecular cloning : a laboratory manual. 2nd Ed. CoId Spring Harbor). L'invention est également relative à un vecteur comprenant un acide nucléique selon la présente invention.
L'invention vise notamment les vecteurs de clonage et/ou d'expression qui contiennent une séquence nucléotidique selon l'invention. Les vecteurs selon l'invention comportent de préférence des éléments qui permettent l'expression et/ou la sécrétion des séquences nucléotidiques dans une cellule hôte déterminée. Le vecteur doit alors comporter un promoteur, des signaux d'initiation et de terminaison de la traduction, ainsi que des régions appropriées de régulation de la transcription. Il doit pouvoir être maintenu de façon stable dans la cellule hôte et peut éventuellement posséder des signaux particuliers qui spécifient la sécrétion de la protéine traduite. Ces différents éléments sont choisis et optimisés par l'homme du métier en fonction de l'hôte cellulaire utilisé. A cet effet, les séquences nucléotidiques selon l'invention peuvent être insérées dans des vecteurs à réplication autonome au sein de l'hôte choisi, ou être des vecteurs intégratifs de l'hôte choisi. De tels vecteurs sont préparés par des méthodes couramment utilisées par l'homme du métier, et les clones résultant peuvent être introduits dans un hôte approprié par des méthodes standards, telle que la lipofection, l'électroporation, le choc thermique, ou des méthodes chimiques.
Les vecteurs selon l'invention sont par exemple des vecteurs d'origine plasmidique ou virale. Ils sont utiles pour transformer des cellules hôtes afin de cloner ou d'exprimer les séquences nucléotidiques selon l'invention.
L'invention comprend également les cellules hôtes transformées par ou comprenant un vecteur selon l'invention.
L'hôte cellulaire peut être choisi parmi des systèmes procaryotes ou eucaryotes, par exemple les cellules bactériennes mais également les cellules de levure ou les cellules animales, en particulier les cellules de mammifères. On peut également utiliser des cellules d'insectes ou des cellules de plantes.
L'invention concerne également les animaux, excepté l'Homme, qui comprennent une cellule transformée selon l'invention. Sous un autre aspect, l'invention a pour objet un procédé de production d'un anticorps, ou l'un de ses fragments fonctionnels selon l'invention, caractérisé en ce qu'il comprend les étapes suivantes : a) la culture dans un milieu et conditions de culture appropriés d'une cellule hôte selon l'invention ; et b) la récupération desdits anticorps, ou l'un de ses fragments fonctionnels, ainsi produits à partir du milieu de culture ou desdites cellules cultivées. Les cellules transformées selon l'invention sont utilisables dans des procédés de préparation de polypeptides recombinants selon l'invention. Les procédés de préparation d'un polypeptide selon l'invention sous forme recombinante, caractérisés en ce qu'ils mettent en œuvre un vecteur et/ou une cellule transformée par un vecteur selon l'invention sont eux-mêmes compris dans la présente invention. De préférence, on cultive une cellule transformée par un vecteur selon l'invention dans des conditions qui permettent l'expression dudit polypeptide et on récupère ledit peptide recombinant.
Ainsi qu'il a été dit, l'hôte cellulaire peut être choisi parmi des systèmes procaryotes ou eucaryotes. En particulier, il est possible d'identifier des séquences nucléotidiques selon l'invention, facilitant la sécrétion dans un tel système procaryote ou eucaryote. Un vecteur selon l'invention portant une telle séquence peut donc être avantageusement utilisé pour la production de protéines recombinantes, destinées à être sécrétées. En effet, la purification de ces protéines recombinantes d'intérêt sera facilitée par le fait qu'elles sont présentes dans le surnageant de la culture cellulaire plutôt qu'à l'intérieur des cellules hôtes. On peut également préparer les polypeptides selon l'invention par synthèse chimique. Un tel procédé de préparation est également un objet de l'invention. L'homme du métier connaît les procédés de synthèse chimique, par exemple les techniques mettant en œuvre des phases solides (voir notamment Steward et al., 1984, Solid phase peptides synthesis, Pierce Chem. Company, Rockford, 111, 2ème éd., (1984)) ou des techniques utilisant des phases solides partielles, par condensation de fragments ou par une synthèse en solution classique. Les polypeptides obtenus par synthèse chimique et pouvant comporter des acides aminés non naturels correspondants sont également compris dans l'invention.
Les anticorps, ou l'un de leurs composés dérivés ou fragments fonctionnels, susceptibles d'être obtenus par un procédé selon l'invention sont également compris dans la présente invention.
Selon encore un autre aspect, la présente invention concerne un anticorps tel que décrit plus haut, caractérisé en ce qu'il est, en outre, bispécifïque, c'est-à-dire capable de se lier spécifiquement sur une protéine humaine ou un récepteur humain autre que CD151.
Les anticorps bispécifiques ou bifonctionnels constituent une seconde génération d'anticorps monoclonaux dans lesquelles deux régions variables différentes sont combinées dans la même molécule (Hollinger and Bohlen 1999 Cancer and metastasis rev. 18 : 411-419). Leur utilité a été mise en évidence tant dans le domaine du diagnostic que dans le domaine de la thérapie de part leur capacité à recruter de nouvelles fonctions effectrices ou à cibler plusieurs molécules à la surface de cellules tumorales. Ces anticorps peuvent être obtenus par des méthodes chimiques (Glennie MJ et al. 1987 J. Immunol. 139, 2367-2375 ; Repp R. et al. 1995 J. Hemat. 377-382) ou somatiques (Staerz U.D. and Bevan MJ. 1986 PNAS 83, 1453-1457 ; Suresh M.R. et al. 1986 Method Enzymol. 121 : 210-228) mais également et préférentiellement par des techniques d'ingénierie génétique qui permettent de forcer l'héterodimérisation et facilitent ainsi le procédé de purification de l'anticorps recherché (Merchand et al. 1998 Nature Biotech. 16 : 677-681).
Ces anticorps bispécifiques peuvent être construits comme des IgG entières, comme des Fab'2 bispécifiques, comme des Fab'PEG ou comme des diabodies ou encore comme des scFv bispécifiques mais également comme un anticorps bispécifique tétravalent où deux sites de fixation sont présents pour chaque antigène ciblé (Park et al. 2000 Mol. Immunol. 37(18) : 1123-30) ou ses fragments comme décrit plus haut.
Outre un avantage économique du fait que la production et l'administration d'un anticorps bispécifique soit moins onéreuse que le production de deux anticorps spécifiques, l'utilisation de tels anticorps bispécifiques a pour avantage de réduire la toxicité du traitement. En effet, l'utilisation d'un anticorps bispécifique permet de diminuer la quantité globale d'anticorps circulants et, par suite, la toxicité éventuelle.
Dans une forme de réalisation préférée de l'invention, l'anticorps bispécifique est un anticorps bivalent ou tétravalent.
Enfin, la présente invention vise l'anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, tel que décrit plus haut à titre de médicament. L'invention concerne également une composition pharmaceutique comprenant à titre de principe actif un composé consistant en un anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'invention. De préférence, ledit anticorps est additionné d'un excipient et/ou d'un véhicule pharmaceutiquement acceptable. Selon encore une autre forme d'exécution, la présente invention concerne également une composition pharmaceutique telle que décrite plus haut qui comprend, en outre, comme produit de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, au moins un autre anticorps, un agent cytotoxique/cytostatique, une toxine cellulaire ou un radioélément.
On entend par "utilisation simultanée", l'administration des deux composés de la composition selon l'invention compris dans une seule et même forme pharmaceutique.
On entend par "utilisation séparée", l'administration, en même temps, des deux composés de la composition selon l'invention, compris dans des formes pharmaceutiques distinctes.
On entend par "utilisation étalée dans le temps", l'administration successive des deux composés de la composition selon l'invention, compris chacun dans une forme pharmaceutique distincte.
D'une façon générale, la composition selon l'invention augmente considérablement l'efficacité du traitement du cancer. En d'autres termes, l'effet thérapeutique de l'anticorps selon l'invention est potentialisé de manière inattendue par l'administration d'un agent cytotoxique. Un autre avantage subséquent majeur produit par une composition selon l'invention, concerne la possibilité d'utiliser des doses efficaces en principe actif plus faibles, ce qui permet d'éviter ou de réduire les risques d'apparition des effets secondaires, en particulier l'effet de l'agent cytotoxique. De plus, cette composition selon l'invention permettrait d'atteindre l'effet thérapeutique escompté plus rapidement.
Par « agents thérapeutiques anti-cancer » ou « agents cytotoxiques », il faut comprendre une substance qui, lorsqu'elle est administrée à un patient, traite ou prévient le développement du cancer chez le patient. A titre d'exemple non limitatif pour de tels agents, il peut être mentionné les agents « alkylant », les antimétabolites, les antibiotiques anti-tumoraux, les inhibiteurs mitotiques, les inhibiteurs de fonction chromatine, les agents anti-angiogénèse, les anti-œstrogène, les anti-androgène ou les immuno -mo dulateur s . De tels agents sont, par exemple, cités dans le VIDAL, à la page consacrée aux composés attachés à la cancérologie et l'hématologie colonne « Cytotoxiques », ces composés cytotoxiques cités par référence à ce document sont cités ici comme agents cytotoxiques préférés. Les « agents alkylants » font référence à toute substance qui peut se coupler de manière covalente ou alkyler toute molécule, préférentiellement un acide nucléique (ex. : ADN), au sein d'une cellule. Comme exemples de tels agents alkylants, il peut être cité les moutardes à l'azote comme la méchloréthamine, le chlorambucil, le melphalan, le chlorhydrate, le pipobroman, la prednimustine, le phosphate disodique ou l'estramustine ; les oxazaphosphorines comme la cyclophosphamide, l' altretamine, la trofosfamide, la sulfofosfamide ou l'ifosfamide ; les aziridines ou ethylènes-imines comme le thiotepa, la triéthylèneamine ou l'altétramine ; les nitrosourées comme la carmustine, la streptozocine, la fotémustine ou la lomustine ; les sulfonates d'alkyle comme le busulfan, le tréosulfan ou l'improsulfan ; les triazènes comme la dacarbazine ; ou encore les complexes du platine comme le cisplatine, l'oxaliplatine ou le carbop latine.
Les « antimétabolites » font référence à des substances qui bloquent la croissance et/ou le métabolisme cellulaire en interférant avec certaines activités, généralement la synthèse d'ADN. A titre d'exemple d'antimétabolite, il peut être mentionné les methotrexate, 5-fluorouracile, floxuridine, 5-fluorodeoxyuridine, capecitabine, cytarabine, fludarabine, cytosine arabinoside, 6-mercaptopurine (6-MP), 6-thioguanine (6-TG), chlorodésoxyadénosine, 5-azacytidine, gemcitabine, cladribine, deoxycoformycine et la pentostatine. Les « antibiotiques anti-tumoraux » font référence aux composés qui peuvent prévenir ou inhiber la synthèse d'ADN, d' ARN et/ou de protéines. Des exemples de tels antibiotiques anti-tumoraux comprennent la doxorubicine, daunorubicine, idarubicine valrubicine, mitoxantrone, dactinomycine, mithramycine, plicamycine, mitomycine C, bleomycine, et la procarbazine. Les « inhibiteurs mitotiques » préviennent la progression normale du cycle cellulaire et de la mitose. En gênerai, les inhibiteurs des microtubules ou « taxoides » comme le paclitaxel et le docétaxel sont capables d'inhiber la mitose. Les alcaloïdes de vinca, comme la vinblsatine, la vincristine, la vindésine et la vinorelbine sont également capables d'inhiber la mitose. Les « inhibiteurs de fonction chromatine » ou « inhibiteurs de topo- isomérases » font référence à des substances qui inhibent la fonction normale des protéines modelant la chromatine comme les topo-isomérases I et IL Des exemples de tels inhibiteurs comprennent, pour la topo-isomérase I, la camptothécine ainsi que ses dérivés comme l'irinotécan ou le topotécan et, pour la topo-isomérase II, l'étoposide, le phosphate d'étiposide et le téniposide.
Les « agents anti-angiogénèse » font références à toute drogue, composé, substance ou agent qui inhibe la croissance des vaisseaux sanguins. Des exemples d'agents anti-angiogénèse comprennent, sans aucune limitation, les razoxin, marimastat, batimastat, prinomastat, tanomastat, ilomastat, CGS-27023A, halofuginone, COL-3, neovastat, BMS-275291, thalidomide, CDC 501, DMXAA, L-651582, squalamine, endostatine, SU5416, SU6668, interferon-alpha, EMD121974, interleukine-12, IM862, angiostatine et la vitaxine. Les « anti-œstrogène » ou « agents anti-oestrogénique » font référence à toute substance qui diminue, antagonise ou inhibe l'action des oestrogènes. Des exemples de tels agents sont les tamoxifène, toremifène, raloxifène, droloxifène, iodoxyfène, anastrozole, letrozole, et l'exemestane.
Les « anti-androgènes » ou « agents anti-androgène » font référence à toute substance qui réduit, antagonise ou inhibe l'action d'un androgène. Des exemples d'anti-androgènes sont les flutamide, nilutamide, bicalutamide, sprironolactone, cyproterone acétate, fmasteride et la cimitidine.
Les immunomodulateurs sont des substances qui stimulent le système immunitaire. Des exemples de tels immunomodulateurs comprennent les interférons, les interleukines comme l'aldesleukine, OCT-43, denileukin diflitox ou l'interleukine-2, les facteurs de nécrose tumorale comme la tasonermine, ou d'autres types d'immunomodulateurs comme le lentinan, le sizofïran, le roquinimex, le pidotimod, la pégadémase, la thymopentine, le poly I :C, ou le levamisole en combinaison avec le 5- fluorouracil. Pour plus de détails, l'homme de l'art pourra se reporter au manuel édité par l'Association Française des Enseignants de Chimie Thérapeutique intitulé « traité de chimie thérapeutique, Vol. 6, Médicaments antitumoraux et perspectives dans le traitement des cancers, édition TEC & DOC, 2003 ».
Dans un mode de réalisation particulièrement préféré, ladite composition comme produit de combinaison selon l'invention est caractérisée en ce que ledit agent cytotoxique est couplé chimiquement audit anticorps pour une utilisation simultanée.
Dans un mode de réalisation particulièrement préféré, ladite composition selon l'invention est caractérisée en ce que ledit agent cytotoxique/cyto statique est choisi parmi les agents inhibiteurs ou stabilisateurs du fuseau, de préférence la vinorelbine et/ou la vinflunine et/ou la vincristine.
Afin de faciliter le couplage entre ledit agent cytotoxique et ledit anticorps selon l'invention, on pourra notamment introduire des molécules espaceurs entre les deux composés à coupler, telles que des poly(alkylènes)glycols comme le polyéthylèneglycol, ou encore des acides aminés, ou, dans un autre mode de réalisation, utiliser des dérivés actifs desdits agents cytotoxiques dans lesquels auront été introduites des fonctions capables de réagir avec ledit anticorps selon l'invention. Ces techniques de couplage sont bien connues de l'homme de l'art et ne seront pas développées dans la présente description.
L'invention est, sous un autre aspect, relative à une composition caractérisée en ce que l'un, au moins, desdits anticorps, ou l'un de leur composé dérivé ou fragment fonctionnel, est conjugué avec une toxine cellulaire et/ou un radioélément
De préférence, ladite toxine ou ledit radioélément est capable d'empêcher la croissance ou la prolifération de la cellule tumorale, notamment d'inactiver totalement ladite cellule tumorale.
De préférence encore, ladite toxine est une toxine d'entérobactéries, notamment l'exotoxine A de Pseudomonas.
Les radioéléments (ou radio-isotopes) préférentiellement conjugués à l'anticorps employés en thérapie sont des radio-isotopes qui émettent des rayons gamma et préférentiellement l'iodine131, l'yttrium90, l'or199, le palladium100, le cuivre67, le bismuth217 et l'antimony211. Les radio-isotopes qui émettent des rayons beta et alpha peuvent également être utilisés en thérapie.
Par toxine ou radioélément conjugué à au moins un anticorps, ou l'un de leur fragment fonctionnel, selon l'invention, on entend désigner tout moyen permettant de lier ladite toxine ou ledit radioélément audit au moins un anticorps, notamment par couplage covalent entre les deux composés, avec ou sans introduction de molécule de liaison.
Parmi les agents permettant une liaison chimique (covalente), électrostatique ou non covalente de tout ou partie des éléments du conjugué, il peut être mentionné tout particulièrement le benzoquinone, le carbodiimide et plus particulièrement l'EDC (1- ethyl-3-[3-dimethylaminopropyl]-carbodiimide hydrochloride), le dimaleimide, l'acide dithiobis-nitrobenzoic (DTNB), le N-succinimidyl S-acetyl thio-acetate (SATA), les agents dits de « bridging » présentant un ou plusieurs groupements, ayant un ou plusieuyrs groupements phenylaside, réagissant avec les ultraviolets (U.V.) et tout préférentiellement le N-[-4-(azidosalicylamino)butyl]-3 '-(2'-pyridyldithio)- propionamide (APDP), le N-succinimid-yl 3-(2-pyridyldithio)propionate (SPDP) et le 6-hydrazino-nicotinamide (HYNIC).
Une autre forme de couplage, tout spécialement pour les radioéléments, peut consister en l'utilisation d'un chélateur d'ions bifonctionnel.
Parmi ces chélateurs, il est possible de mentionner les chélates dérivés de l'EDTA (ethylenediaminetetraacetic acid) ou du DTPA (diethylenetriaminepentaacetic acid) qui ont été développés pour lier des métaux, particulièrement des métaux radioactifs, et des immunoglobulines. Ainsi, le DTPA et ses dérivés peut être substitué par différents groupements sur le chaîne de carbones de manière à augmenter la stabilité et la rigidité du complexe ligand-métal (Krejcarek et al. (1977); Brechbiel et al. (1991); Gansow (1991); US patent 4 831 175). Par exemple, le DTPA (diethylenetriaminepentaacetic acid) et ses dérivés, qui a été très largement utilisé en médecine et en biologie pendant longtemps soit sous sa forme libre, soit sous la forme d'un complexe avec un ion métallique, présente la caractéristique remarquable de former des chélates stables avec des ions métalliques et d'être couplé à des protéines d'intérêt thérapeutique ou diagnostique comme des anticorps pour le développement de radio-immunoconjugués en thérapie du cancer (Meases et al, (1984); Gansow et al. (1990)).
De préférence également, ledit au moins un anticorps formant ledit conjugué selon l'invention est choisi parmi ses fragments fonctionnels, notamment les fragments amputés de leur composante Fc tels que les fragments scFv. La présente invention comprend en outre l'utilisation de la composition selon l'invention pour la préparation d'un médicament destiné à la prévention ou au traitement du cancer.
La présente invention est relative également à l'utilisation d'un anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, de préférence humanisé, et/ou d'une composition selon l'invention pour la préparation d'un médicament destiné à inhiber la prolifération de cellules tumorales. De manière générale, la présente invention a pour objet l'utilisation d'un anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, de préférence humanisé, et/ou d'une composition selon l'invention, pour la préparation d'un médicament destiné à la prévention ou au traitement de cancer
Parmi les cancers qui peuvent être prévenus et/ou traités, on préfère le cancer de la prostate, les ostéosarcomes, le cancer du poumon, le cancer du sein, le cancer de l'endomètre, le cancer du côlon, le myélome multiple ou le cancer des ovaires, le cancer du pancréas ou tout autre cancer.
De manière préférée, ledit cancer est un cancer choisi parmi le cancer de la prostate, le cancer du poumon, le cancer du colon et/ou le cancer du pancréas. Sous encore un autre aspect, la présente invention a pour objet l'utilisation e l'anticorps selon l'invention dans une méthode de diagnostic, de préférence in vitro, de maladies liées à un taux d'expression de CD151. Plus particulièrement, l'invention vise une méthode de diagnostic in vitro de maladies présentant une sur-expression ou une sous- expression de la protéine CD151 à partir d'un échantillon biologique dont on suspecte la présence anormale en protéine CD151, ladite méthode consistant à mettre en contact ledit échantillon biologique avec un anticorps selon l'invention, ledit anticorps pouvant être le cas échéant marqué.
De préférence, lesdites maladies liées à la protéine CD 151 dans ladite méthode de diagnostic seront des cancers.
Ledit anticorps, ou l'un de ses fragments fonctionnels, peut se présenter sous forme d'immunoconjugué ou d'anticorps marqué afin d'obtenir un signal détectable et/ou quantifiable.
Les anticorps marqués selon l'invention ou leurs fragments fonctionnels incluent par exemple des anticorps dits immunoconjugués qui peuvent être conjugués par exemple avec des enzymes telles que la péroxydase, la phosphatase alkaline, l'α-D- galactosidase, la glucose oxydase, la glucose amylase, l'anhydrase carbonique, l'acétyl- cholinestérase, le lysozyme, la malate déhydrogénase ou la glucose-6 phosphate déhydrogénase ou par une molécule comme la biotine, la digoxigénine ou la 5-bromo- désoxyuridine. Des marqueurs fluorescents peuvent être également conjugués aux anticorps ou leurs fragments fonctionnels selon l'invention et incluent notamment la fluorescéine et ses dérivés, le fluorochrome, la rhodamine et ses dérivés, la GFP (GFP pour « Green Fluorescent Protein »), le dansyl, l'umbelliférone etc.. Dans de tels conjugués, les anticorps de l'invention ou leurs fragments fonctionnels peuvent être préparés par des méthodes connues de l'homme de l'art. Ils peuvent être couplés aux enzymes ou aux marqueurs fluorescents directement ou par l'intermédiaire d'un groupe espaceur ou d'un groupe de liaisons tel qu'un polyaldéhyde, comme le glutaraldéhyde, l'acide éthylènediaminetétraacétique (EDTA), l'acide diéthylènetriaminepentaacétique (DPTA), ou en présence d'agents de couplage tels que ceux mentionnés plus haut pour les conjugués thérapeutiques. Les conjugués comportant des marqueurs de type fluorescéine peuvent être préparés par réaction avec un isothiocyanate.
D'autres conjugués peuvent inclure également des marqueurs chimioluminescents tels que le luminol et les dioxétanes, des marqueurs bioluminescents tels que la luciférase et la luciférine, ou encore des marqueurs radioactifs tels que l'iodine123, l'iodine125, l'iodine126, l'iodine133, le bromine77, le technetium99m, l'indium111, l'indium113m, le gallium67, le gallium68, le ruthénium95, le ruthénium97, le ruthénium103, le ruthénium105, le mercure107, le mercure203, le rhenium99m, le rhénium101, le rhénium105, le scandium47, le tellurium121m, le tellurium122m, le tellurium125m, le thulium165, le thulium167, le thulium168, la fluorine18, l'yttrium199, l'iodine131. Les procédés connus de l'homme de l'art existant pour coupler les radio-isotopes aux anticorps, soit directement, soit via un agent chélateur comme l'EDTA OU le DTPA mentionné plus haut, peuvent être utilisés pour les radioéléments en diagnostic. Il est donc également possible de mentionner le marquage au [I125]Na par la technique de la chloramine T [Hunter W.M. and Greenwood F. C. (1962) Nature 194:495] ou également avec le technetium99m par la technique de Crockford et al. (US patent 4 424 200) ou fixé via le DTPA comme décrit par Hnatowich (US patent 4 479 930).
L'invention a également pour objet l'utilisation d'un anticorps selon l'invention, pour la préparation d'un médicament destiné au ciblage spécifique d'un composé bio logiquement actif vers des cellules exprimant ou surexprimant la protéine CD 151.
On entend désigner ici par composé biologiquement actif tout composé capable de moduler, notamment d'inhiber, l'activité cellulaire, en particulier leur croissance, leur prolifération, la transcription ou la traduction de gènes.
L'invention a aussi pour objet un réactif de diagnostic in vivo comprenant un anticorps selon l'invention, ou l'un de ses fragments fonctionnels, de préférence marqué, notamment radiomarqué, et son utilisation en imagerie médicale, en particulier pour la détection de cancer lié à l'expression ou à la surexpression par une cellule de la protéine CD151. L'invention est également relative à une composition comme produit de combinaison ou à un conjugué anti-CD151/toxine ou radioélément, selon l'invention, à titre de médicament.
De préférence, ladite composition comme produit de combinaison ou ledit conjugué selon l'invention sera additionné d'un excipient et/ou d'un véhicule pharmaceutiquement acceptable.
Dans la présente description, on entend désigner par véhicule pharmaceutiquement acceptable, un composé ou une combinaison de composés entrant dans une composition pharmaceutique ne provoquant pas de réactions secondaires et qui permet par exemple la facilitation de l'administration du ou des composés actifs, l'augmentation de sa durée de vie et/ou de son efficacité dans l'organisme, l'augmentation de sa solubilité en solution ou encore l'amélioration de sa conservation.
Ces véhicules pharmaceutiquement acceptables sont bien connus et seront adaptés par l'homme de l'art en fonction de la nature et du mode d'administration du ou des composés actifs choisis.
De préférence, ces composés seront administrés par voie systémique, en particulier par voie intraveineuse, par voie intramusculaire, intradermique, intrapéritonéale ou sous-cutanée, ou par voie orale. De manière plus préférée, la composition comprenant les anticorps selon l'invention, sera administrée à plusieurs reprises, de manière étalée dans le temps.
Leurs modes d'administration, posologies et formes galéniques optimaux peuvent être déterminés selon les critères généralement pris en compte dans l'établissement d'un traitement adapté à un patient comme par exemple l'âge ou le poids corporel du patient, la gravité de son état général, la tolérance au traitement et les effets secondaires constatés.
L'invention concerne donc l'utilisation d'un anticorps, ou l'un de ses fragments fonctionnels pour la préparation d'un médicament destiné au ciblage spécifique d'un composé bio logiquement actif vers des cellules exprimant ou surexprimant CD151.
D'autres caractéristiques et avantages de l'invention apparaissent dans la suite de la description avec les exemples et les figures dont les légendes sont représentées ci- après. LEGENDES DES FIGURES
La figure 1 montre les séquences nucléotidiques et protéiques de la protéine CD151, séquences sur lesquelles sont mises en évidences les boucles ECl et EC2. La figure 2 est un schéma illustrant la structure des tétraspanines dont fait partie la protéine CD151, et tout particulièrement les deux boucles extra-cellulaires ECl et EC2.
La figure 3 montre les séquences respectives des chaînes lourdes et légères de l'anticorps 203B6 selon l'invention. Les CDRs définis selon le système IMGT apparaissent soulignés et en gras alors que les CDRs définis selon Kabat apparaissent encadrés.
La figure 4 montre les séquences respectives des chaînes lourdes et légères de l'anticorps 205H8 selon l'invention. Les CDRs définis selon le système IMGT apparaissent soulignés et en gras alors que les CDRs définis selon Kabat apparaissent encadrés.
La figure 5 montre les séquences respectives des chaînes lourdes et légères de l'anticorps 211F3 selon l'invention. Les CDRs définis selon le système IMGT apparaissent soulignés et en gras alors que les CDRs définis selon Kabat apparaissent encadrés. La figure 6 montre les séquences respectives des chaînes lourdes et légères de l'anticorps 214B2 selon l'invention. Les CDRs définis selon le système IMGT apparaissent soulignés et en gras alors que les CDRs définis selon Kabat apparaissent encadrés.
La figure 7 illustre l'expression de la molécule CD151 chez des patients atteints de cancer de la prostate. Chaque lettre correspond à l'étude d'un patient et pour chaque patient le panel supérieur correspond au tissu normal adjacent à la tumeur et le panel inférieur correspond au tissu tumoral.
La figure 8 illustre l'expression de la molécule CD151 chez des patients atteints de cancer du poumon. Chaque lettre correspond à l'étude d'un patient et pour chaque patient le panel supérieur correspond au tissu normal adjacent à la tumeur et le panel inférieur correspond au tissu tumoral.
La figure 9 montre l'analyse par cytométrie de flux de la reconnaissance de CD151 par l'anticorps 203B6 à la surface des cellules NIH 3T3-CD151, PC3 et A549. La figure 10 montre l'analyse par cytométrie de flux de la reconnaissance de CD151 par l'anticorps 205H8 à la surface des cellules NIH 3T3-CD151, PC3 et A549.
La figure 1 1 montre l'analyse par cytométrie de flux de la reconnaissance de CD151 par l'anticorps 211F3 à la surface des cellules NIH 3T3-CD151, PC3 et A549. La figure 12 montre l'analyse par cytométrie de flux de la reconnaissance de
CD151 par l'anticorps 214B2 à la surface des cellules NIH 3T3-CD151, PC3 et A549.
La figure 13 présente les résultats de l'évaluation de la spécificité des anticorps 203B6, 205H8, 211F3 et 214B2 par western blot.
La figure 14 illustre l'activité anti-tumorale d'anticorps monoclonaux anti- CD151 dans le modèle de xénogreffe de tumeur de la prostate PC3. Des souris Swiss
Nude (n=6) ont été greffées par voie sous cutanée avec les cellules PC3. Cinq jours après la greffe des cellules, les souris reçoivent, par voie i.p., une dose d'appel de 2 mg/souris de l'anticorps à tester suivie de deux administrations par semaine d'une dose de 1 mg/souris de cet anticorps. Le volume tumoral est évalué par la formule π/6 x Longueur x largeur x épaisseur.
La figure 15 montre l'analyse des anticorps 203B6 et 214B2 radiomarqués à l'iode 125 avec (A) Autoradiographie après électrophorèse SDS-PAGE en conditions réductrices, et (B) Analyse par chromatographie de tamisage moléculaire.
La figure 16 illustre l'étude de la fixation de l'anticorps 203B6 radiomarqué sur cellules PC3 : Détermination de la constante d'affinité à l'équilibre avec (A) Courbe de saturation et (B) Scatchard plot.
La figure 17 illustre l'étude de la fixation de l'anticorps 214B2 radiomarqué sur cellules PC3 : Détermination de la constante d'affinité à l'équilibre avec (A) Courbe de saturation et (B) Scatchard plot. La figure 18 montre l'effet des anticorps anti-CD151 sur les fonctions plaquettaires avec (A) Agrégation plaquettaire et (B) Activation plaquettaire (libération de sérotonine).
La figure 19 montre l'effet d'anticorps anti-CD151 sur la croissance tumorale in vivo des cellules NCI-H441 La figure 20 illustre le phénotype A) et marqueurs de différentiation B) des cellules THP-I cultivées en absence ou en présence de PMA. C) Effet d'anticorps anti- CD151 (214B2 et 203B6) sur la sécrétion de TNF par les cellules THP-I cultivées en absences ou en présence de PMA. L'anticorps 9G4 est utilisé comme isotype contrôle et le LPS comme témoin positif d'activation.
La figure 21 montre l'effet des anticorps 241B2 et 203 B6 sur la présentation antigénique. A) témoin de prolifération polyclonale, B) prolifération antigène- spécifique
EXEMPLES
Exemple 1 : Etude de l'expression de la molécule CD151
L'expression de la protéine CD151 a été recherchée par immunohistochimie (IHC) dans des échantillons de tissus humains issus de patients atteints de cancers de la prostate ou de cancer du poumon. Pour ces patients des lames de tissus normaux adjacents à la tumeur étaient disponibles et ont donc été incluses pour calibrer le niveau d'expression dans les tissus tumoraux versus normaux.
Pour ces expériences, des lames de type « Tissue array » commerciales sont utilisées. Après déparaffïnage, un démasquage antigénique est effectué à 300C à l'aide d'une solution enzymatique contenant de la pepsine (Labvision réf. AP-9007-005). Cette étape est suivie par une étape d'élimination des peroxydases endogènes par incubation des coupes dans une solution de peroxyde d'hydrogène (Sigma) à 0,3% dans l'eau. Une saturation des sites non spécifiques est alors effectuée avec une solution d'Ultra- V-Block (Labvision, réf. TA-125-UB) et le marquage est effectué à l'aide d'un anticorps murin anti-CD151 commercial (Serotech, Réf. MCA 1856) utilisé à une concentration finale de 5 μg/ml. Un anticorps isotype contrôle IgGl murin (DakoCytomation, Réf. X0931) est utilisé comme contrôle négatif d'expérience. La révélation du marquage se fait avec le système de révélation Envision Dual Link (DakoCytomation, Réf. K4061) et la référence de la DAB, substrat des peroxydases est S3309 de DakoCytomation.
Les résultats présentés dans la figure 7 montrent que plusieurs patients développant des tumeurs de la prostate présentent une sur-expression de la molécule CD151. Cette sur-expression peut être très significative pour 20% des patients étudiés (patients A et C) ou modérée (patients A et D). Il est à noter que, excepté au niveau des cellules endothéliales, les tissus normaux prostatiques correspondant n'expriment pas ou peu le CD151 et que, en cas d'expression, celle-ci semble être limitée à des structures de type glandulaires. Le patient E présente un exemple de tumeur n'exprimant pas CD 151.
Dans le cas du cancer du poumon (Figure 8), une expression modérée (patient A) à forte (patient B) est observée au niveau de certaines cellules du tissu pulmonaire normal. Cependant le tissu tumoral présente une très grande densité de cellules fortement marquées (patients A et B). Le patient C présente un exemple de tumeur n'exprimant pas CD 151.
Exemple 2 : Génération et sélection des anticorps
Des souris BALB/c ont été immunisées par voie sous-cutanée à l'aide de 20.106 cellules NIH 3T3 exprimant CD151 humain à leur surface, cellules générées par transfection avec le gène de CD151. La première immunisation a été réalisée en présence d'adjuvant complet de Freund, puis les 2 suivantes en présence d'adjuvant incomplet de Freund. Trois jours avant la fusion, une injection de rappel finale de 10.106 cellules NIH 3T3-CD151 a été réalisée par voie intra-péritonéale. Les cellules de la rate d'une souris ont ensuite été fusionnées à des cellules de myélome SP2/0-Agl4 dans un rapport 1/1 par les techniques classiquement décrites par Kôhler et Milstein.
Les anticorps sécrétés dans les surnageants des hybridomes résultant de la fusion ont ensuite été criblés pour leur capacité à reconnaître la boucle extracellulaire recombinante EC2 de CD151 par ELISA, et CD151 exprimé à la surface de la lignée tumorale humaine de cancer de la prostate PC3 par cytométrie de flux.
Pour l'ELISA, des plaques 96 puits sont sensibilisées pendant 1 nuit à +4°C avec la boucle extracellulaire recombinante EC2 à 5μg/ml dans du PBS. Après lavage par du PBS, les puits sont saturés par une solution de gélatine à 0,5% dans du PBS pendant 1 h à 37°C puis lavés à nouveau par du PBS. Les surnageant de culture des hybridomes sont évalués sans dilution (incubation 1 h à 37°C). Les anticorps fixés sur la boucle EC2 immobilisée sont détectés par incubation successives avec un anticorps polyclonal de chèvre anti-IgG de souris conjugué à la péroxydase (Jackson/USA, dilution au l/5000ème, 1 h à 37°C) puis avec un substrat de la péroxydase (TMB, Interchim/France, 10 min à température ambiante). La réaction est stoppée par addition d'acide sulfurique IM et la densité optique (DO) est mesurée à 450nm. Les analyses par cytométrie de flux sont réalisées sur des plaques 96 puits. Les surnageants d'hybridome non dilués sont ajoutés à 100000 cellules PC3 préalablement introduites dans les puits. Après une incubation de 20 min à +4°C suivie d'un lavage, un anticorps polyclonal de chèvre anti-IgG de souris marqué à l'Alexa488 (Molecular Probes, dilution au l/500eme) est ajouté. L'intensité de fluorescence (MFI) est déterminée à l'aide d'un cytofluorimètre après une nouvelle incubation de 20 min à +4°C.
A l'issue de ce criblage, les 4 hybridomes suivants ont été sélectionnés (critères de sélection : DO > 0,5 pour l'ELISA et MFI > 50 pour la cytométrie de flux) : 203B6, 205H8, 211F3 et 214B2. Les résultats obtenus pour ces 4 hybridomes sont présentés dans le tableau 4 ci-dessous :
Figure imgf000050_0001
Tableau 4
Après clonage, un clone de chaque hybridome sélectionné a été amplifié. L 'isotype des anticorps produits a été déterminé pour chaque surnageant de culture à l'aide d'un kit d'isotypage des anticorps murins (SBA clonotyping System, Southern Biotech), puis une caractérisation finale a été réalisée par ELISA (boucle extracellulaire EC2) et par cytométrie de flux sur la lignée murine NIH 3T3 et le transfectant stable NIH 3T3-CD151, puis sur des lignées tumorales humaines de cancer du poumon A549, de la prostate DU 145 et du pancréas BxPC3 dans les conditions décrites précédemment. La concentration en anticorps des surnageants a été ajustée à 5μg/ml pour l'ELISA et à lOμg/ml pour les analyses par cytométrie de flux Les résultats obtenus sont présentés dans le tableau 5 ci-dessous :
Figure imgf000051_0001
Tableau 5
Les figures 9, 10, 11 et 12 montrent les profils de reconnaissance par cytométrie de flux des cellules NIH 3T3-CD151, PC3 et A549 obtenus pour les anticorps 203B6, 205H8, 211F3 et 214B2. Ces profils sont comparables à ceux obtenus avec l'anticorps anti-CD151 50-6 (ATCC CRL-2696) et démontrent la spécificité de ces anticorps pour CD151.
Les hybridomes ont ensuite été déposés à la CNCM, Collection Nationale de Cultures de Microorganismes, Institut Pasteur, 25 Rue du Docteur Roux, 75724 PARIS Cedex 15.
Exemple 3 : Spécificité des anticorps
La spécificité des anticorps 203B6, 205H8, 211F3 et 214B2 a été évaluée par western blot.
La boucle EC2 de CD151 a été clonée dans le vecteur pET22b pour une expression sous forme soluble dans le périplasme de Escherichia coli. La protéine produite comporte les acides aminés 130 à 221 de la séquence peptidique de CD151 humain, auxquels a été ajoutée une queue Poly-His en position C-terminale pour faciliter la purification. La protéine EC2 recombinante a été purifiée par chromatographie d'affinité sur métaux immobilisés (IMAC) sur support Chelating Sepharose HP (GE Healthcare).
Des quantités croissantes de la protéine recombinante EC2 CD151 (1, 2, 4 et 8 μg) et de lysat de cellules HT-29 (10, 20 et 50 μg de protéines totales) ont été déposées sur un gel d'acrylamide 4-12% (BioRad). Après électrophorèse (conditions non réductrices), les protéines ont été transférées sur membrane de nitrocellulose. Les membranes de transfert ont ensuite été incubées avec les anticorps 203B6, 205H8, 211F3 et 214B2 purifiés (0,5 μg/ml), puis avec un anticorps polyclonal de lapin anti-Ig de souris couplé à la péroxydase (GE Healthcare) avant révélation par chimio luminescence.
Les anticorps 203B6, 205H8, 211F3 et 214B2 reconnaissent la protéine CD151 complète et la boucle EC2 recombinante par western blot (Figure 13). L'anticorps 205H8 présente une réactivité inférieure pour la protéine CD151 complète dans les conditions d'analyse. Comparativement au signal observé pour les anticorps 203B6, 211F3 et 214B2, le signal obtenu pour l'anticorps 205H8 s'avère plus faible. Cette différence n'est pas observée pour la reconnaissance de la protéine EC2 recombinante.
Exemple 4 : Activité antitumorale d'anticorps anti-CD151 dans le modèle de xénogreffe PC3 Matériel et méthodes
Une surexpression de CD151 dans les tissus tumoraux de cancer de la prostate ayant été observée par immunohistochimie sur une série de tissus array humains, l'évaluation d'anticorps anti-CD151 sur une xénogreffe de cellules de cancer de la prostate PC3 a été envisagée. La lignée PC3 est une lignée prostatique androgéno- indépendante originaire de l'ATCC et cultivée en milieu F12K (Invitrogen Corporation, Ecosse, Royaume-Uni), 10% FCS (Invitrogen Corporation). Les cellules sont divisées deux jours avant la greffe de telle sorte qu'elles soient en phase de croissance exponentielle. Cinq millions de cellules PC3 sont greffées en sous-cutané sur des souris mâle Swiss Nude âgées de six semaines. Cinq jours après l'implantation, les volumes tumoraux sont mesurés, les souris sont randomisées pour constituer des lots non statistiquement différents et le traitement est initié par l'injection i.p. d'une dose d'appel de 2 mg d'anticorps par souris. Les animaux sont ensuite traités deux fois par semaine avec une dose de 1 mg d'anticorps par souris et les tumeurs mesurées 2 fois par semaine. Les animaux du groupe contrôle reçoivent une injection de PBS. Les volumes tumoraux sont calculés selon la formule π/6 x longueur x largeur x hauteur. Une analyse statistique est effectuée à chaque mesure en utilisant un test de Mann-Whitney.
Résultats Les résultats présentés en Figure 14 montrent que les anticorps 203B6, 214B2 et 211F3 indiquent des inhibitions significatives de la croissance tumorale in vivo des cellules PC3. L'anticorps 205H8, bien qu'inhibiteur, montre une activité antitumorale plus modeste dans ce modèle.
Exemple 5 : Etude de la fixation des anticorps anti-CD151 sur cellules PC3
Les anticorps anti-CD151 203B6 et 214B2 ont, dans un premier temps, été marqués à l'iode 125 par la méthode utilisant la chloramine T. Après marquage, les anticorps ont été purifiés par chromatographie de tamisage moléculaire sur colonne PD- 10 (GE Healthcare) afin d'éliminer l'iode 125 libre. La pureté radiochimique des anticorps radiomarqués a été déterminée, après purification, par chromatographie sur couche mince de silice, chromatographie de tamisage moléculaire analytique sur colonne Superdex 200 (GE Healthcare) et par autoradiographie après électrophorèse SDS-PAGE. La figure 15 montre que les chaînes lourdes (~50 kDa) et légères (~25 kDa) des 2 anticorps sont marquées de manière équivalente (15A) et confirme l'absence d'iode 125 libre après purification (15B). L'activité spécifique des anticorps radiomarqués a été déterminée à l'aide d'un compteur gamma (Wallace Wizard 1480, Perkin Elmer).
Les caractéristiques physico-chimiques des anticorps 203B6 et 214B2 radiomarqués à l'iode 125, [125I]-203B6 et [125I]-214B2, sont résumées dans le tableau 6 ci-dessous :
Figure imgf000053_0001
Tableau 6
L'affinité des 2 anticorps radiomarqués pour leur cible CD151 à la surface cellulaire a ensuite été mesurée sur des cellules de cancer de la prostate PC3. La constante de dissociation KD des anticorps a été déterminée par la méthode de Scatchard. Les cellules PC3 (1.106 cellules / 50 μl de tampon PBS contenant 0,5% BSA) ont été incubées en présence de concentrations croissantes des anticorps radiomarqués comprises entre 6 ng/ml et 27 μg/ml pendant 1 h à 4°C (volume final : 150 μl). Après incubation, la radioactivité totale associée aux cellules (anticorps radiomarqué fixé) a été mesurée à l'aide d'un compteur gamma. La fixation non spécifique a été déterminée, pour chaque concentration testée, en présence d'un excès d'anticorps non radiomarqué (x 100). La fixation spécifique est calculée par soustraction de la radioactivité non spécifique à la radioactivité totale. Les courbes de saturation sont présentées sur les figures 16A et 17A, respectivement pour les anticorps [125I]-203B6 et [125I]-214B2. Les courbes de Scatchard obtenues (Figures 16B et 17B) après traitement des données avec logiciel Prism permettent de déterminer la constante de dissociation KD des 2 anticorps (Pente = - 1/KD) :
- 203B6 KD = 12,85 ± 0,99 nM
- 214B2 KD = 6,38 ± 0,45 nM
Exemple 6 : Effet des anticorps anti-CD151 sur les fonctions plaquettaires
L'agrégation est une fonction essentielle des plaquettes lors du processus de coagulation sanguine, en réponse à une lésion vasculaire par exemple. Ce phénomène est généralement précédé par l'activation des plaquettes, qui se traduit par l'exposition de certaines protéines à leur surface et la sécrétion du contenu de leurs granules de stockage (granules alpha et granules denses). CDl 51 étant exprimé sur les plaquettes (Goschnick and Jackson, 2007, Mini-Rev. Med. Chem. 7: 1236-1247), l'effet des anticorps anti-CD151 sur les fonctions plaquettaires a été évalué in vitro à l'aide de tests d'agrégation et d'activation plaquettaires.
Pour cette étude, le sang de donneurs à jeun a été prélevé en utilisant le citrate trisodique comme agent anticoagulant. Une centrifugation à 100 g pendant 10 min à 200C permet d'obtenir un plasma riche en plaquettes (PRP), alors qu'un plasma pauvre en plaquettes (PPP) est obtenu par centrifugation à 1500 g pendant 10 min à 200C. L'agrégation plaquettaire a été mesurée sur les PRP de 10 donneurs, après ajustement à 300000 plaquettes/mm3, selon le principe de Born (modification de la lumière transmise) avec une agitation de 500 tours/min à 37°C. La durée de la mesure était de 5 min pour la thrombine et l'ADP (contrôles positifs) et de 15 min pour les anticorps testés. L'activation des plaquettes a été mesurée sur les PPP de 10 donneurs, par mesure de la sécrétion de sérotonine (5-hydroxytryptamine ou 5-HT) par HPLC avec détection fluorimétrique. L'effet des anticorps sur les fonctions plaquettaires a été déterminé pour une concentration de 10 μg/ml. Plusieurs anticorps contrôles ont été utilisés : PM6/248 (anti-CD41, intégrine (Xm,) et 14A2.H1 (anti-CD151) comme anticorps contrôles positifs, et 9G4 comme contrôle isotypique (IgGl). L'agrégation plaquettaire induite par les différents composés testés est estimée, pour chaque donneur, en pourcentage de l'agrégation induite par la thrombine prise comme référence (100%). La figure 18A présente les valeurs moyennes d'agrégation obtenues pour chaque composé testé. L'ADP et l'anticorps PM6/248, agents inducteurs moins puissants que la thrombine, entraînent des agrégations comparables, respectivement de 30,1 ± 10,5 % et 47,6 ± 12,7 %. Les écarts obtenus sont classiquement observés en hémostase et résultent de la variabilité inter-individuelle. Comme attendu, l'anticorps 9G4 n'induit pas l'agrégation des plaquettes : cet anticorps permet de définir un seuil de détection (5 nM). L'agrégation induite par les anticorps anti-CD151 203B6 et 214B2, respectivement de 7,3 ± 3,2 % et 4,9 ± 1,6 %, est relativement faible et proche du seuil de détection. Ces 2 anticorps induisent une agrégation inférieure à celle de l'anticorps contrôle 14A2.H1.
La figure 18B présente les valeurs moyennes de sérotonine libérée par les plaquettes (en nM) en présence des différents composés testés. Les résultats obtenus pour ce test d'activation plaquettaire sont comparables à ceux décrits précédemment. L'anticorps 9G4 n'induit pas l'activation des plaquettes alors que la thrombine provoque une très forte libération de sérotonine (-430 nM). Les quantités de sérotonine libérées sont inférieures en présence d'ADP, du PM6/248 et du 14A2.H1 (valeurs moyennes respectives de 72,6 nM, 34,6 nM et 21,6 nM), mais ces composés peuvent être considérés comme activateurs plaquettaires. La libération de sérotonine induite par les anticorps anti-CD151 203B6 et 214B2 est très faible : en effet, les valeurs moyennes déterminées pour ces 2 anticorps sont respectivement 2,4 et 3,6 fois plus faibles que celle de l'anticorps contrôle anti-CD151 14A2.H1.
En conclusion, les 2 tests confirment que les anticorps contrôles anti-intégrine dm, PM6/248 et anti-CD151 14A2.H1 sont capables de provoquer in vitro l'agrégation des plaquettes et d'induire leur activation (Roberts et al., 1995, Br. J. Haematol. 89: 853-860 ; Hornby et al., 1991, Br. J. Haematol. 79: 277-285). A la différence de l'anticorps 14A2.H1, les anticorps anti-CD151 203B6 et 214B2 induisent des niveaux d'agrégation et d'activation plaquettaire très faibles et non significatifs en clinique humaine.
Exemple 7 : Etude de l'activité des anticorps anti-CD151 sur la croissance in vivo des tumeurs NCI-H441
Les cellules NCI-H441 provenant de l'ATCC sont cultivées en milieu RPMI 1640 supplémenté de 10% FCS et de 1% L-Glutamine. Les cellules sont divisées deux jours avant la greffe de façon à obtenir des cellules en phase exponentielles de croissance le jour de la greffe. Dix million de cellules NCI-H441 sont implantées en localisation sous cutanée sur des souris Nude athymiques. Cinq jours après la greffe, les tumeurs sont mesurables et les animaux portant des tumeurs d'une taille comparable sont répartis en groupe de 6. Les souris sont traitées par voie i.p. avec une dose d'appel d'anticorps de 2 mg/souris, puis, 2 fois par semaine avec une dose de 1 mg d'anticorps par souris. Le volume tumoral est évalué 2 fois par semaine et calculé à l'aide de la formule: π/6 X longueur X largeur X hauteur. L'analyse spécifique des données est effectuée à chaque mesure en utilisant un test Mann-Whitney.
Les résultas présentés en figure 19 démontrent que les anticorps 203B6 et 214B2 sont capables d'inhiber signifîcativement (p<0.05) la croissance in vivo des cellules NCI-H441.
Exemple 8 : Evaluation de l'activité de deux anticorps anti-CD151 sur la fonction macrophagique
L'évaluation de l'expression de CD151 sur les cellules du sang démontre que cette molécule est exprimée de façon significative sur les lymphocytes et les monocytes. Afin d'anticiper d'éventuels problèmes de toxicité, les anticorps 214B2 et 203B6 ont été testés pour un effet potentiel sur l'activation des macrophages. La sécrétion de TNFα étant un marqueur de l'activation des macrophages, la concentration de TNFα de surnageant de culture de cellules THP-I, cultivés en présence ou en absence des anticorps à tester, on été évalués, par ELISA. La lignées cellulaire THP-I est une lignée de leucémie monocytaire capable de se différencier en lignée macrophagique en présence d'agents de type PMA ou la 25-Dihydroxyvitamin D3. Ce processus d'activation s'accompagne d 'une sécrétion très significative de TNFα. Pour l'évaluation des anticorps, les cellules THP-I sont ensemencées en plaques 6 puits en présence ou en absence de PMA (250 nM) durant 72 heures. Après ce temps d'incubation, une partie des cellules sont récupérées afin de contrôler la différenciation en présence de PMA par observation microscopique ou par analyse au FACS des marqueurs CD14/CDl lb. Les anticorps à tester (241B2 et 203B6) sont ajoutés aux autres puits pour un temps additionnel de 24 heures. L'anticorps 9G4 est utilisé dans les même conditions comme isotype contrôle. Le LPS (1 μg/ml) est utilisé comme témoin positif de l'expérience. Les surnageant de culture sont alors prélevés, centrifugés et stockés à -800C avant d'être dosés pour leur contenu en TNFα par un test ELISA.
Les résultats présentés en figure 2OA montrent qu'en absence de PMA, les cellules THP-I sont non adhérentes, réfringentes et rondes. En présence de PMA, ces cellules deviennent adhérentes ce qui signe clairement une différenciation des monocytes en macrophages. Les analyses au FACS (figure 20B) montrent qu'en absence de PMA moins de 20% des cellules THP-I expriment CDl Ib ou CD14. La différenciation cellulaire induite par le PMA est, comme attendu, associée à une augmentation significative des cellules exprimant CDl Ib qui passent de 9 à 65%. L'expression de CD 14 est également notablement augmentée avec un nombre de cellules positives passant de 20 à 37% . Ces données démontrant la validité du modèle d'évaluation mis en place, une évaluation des anticorps anti-CD151 a été effectuée dans ce test. La figure 2OC montre qu'aucune production de TNFα n'est observée lorsque les cellules THP-I sont cultivées en absence d'inducteur de différenciation. En revanche, une production très significative (100 à 200 pg/ml) de TNFα est observée. Comme attendu le LPS introduit comme témoin positif d'expérience entraîne également la sécrétion d'un taux élevé de cytokine en ce, en présence ou en absence d'inducteur de différenciation, présence de PMA Aucun des anticorps anti-CD151 évalué n'entraîne de sécrétions de TNFα quelque soit l'état de différenciation cellulaire.
Exemple 9 : Evaluation de deux anticorps anti-CD151 sur la fonction de présentation antigénique. La molécule CD 151 étant largement exprimée sur les cellules présentatrices d'antigène, une étude a été effectuée afin de vérifier l'impact potentiel d'une thérapie dirigée contre CD151 sur la fonction de présentation antigénique. L'expérience effectuée consiste à suivre la prolifération lymphocytaire spécifique de l'antigène TT lorsque la protéine tétanus toxoid est introduite sur des PBMC. Dans cette conformation, la protéine doit être processée par les cellules présentatrice d'antigène et présentée par ces mêmes cellules en association avec les molécules du CMH. Cette présentation antigénique aux lymphocytes CD4+ ou CD 8+ entraînera une prolifération des clones spécifiques de l'antigène. Tout impact sur la présentation antigénique se soldera donc par une modulation de la prolifération lymphocytaire. Pour cette expérience, des PBMC sont isolés par centrifugation du sang total sur gradient de Ficoll. Les cellules lavées deux fois en PBS, sont comptées et resuspendues à raison de 0.25.106 cellules/ml en milieu RPMI 1640 supplémentées avec 10% de SVF et 1% de glutamine. Cent micro litres de la suspension cellulaire sont ensemencés dans chaque puits d'une plaque 96 puits en présence de l'antigène et des anticorps à tester. Les anticorps 214B2 et 203B6 sont évalués à la concentration finale de 10 μg/ml. L'anticorps 9G4 est introduit à la même concentration finale comme isotype contrôle d'expérience. La PHA (2.5 μg/ml dans le puits), activateur polyclonal de la prolifération lymphocytaire est utilisée comme contrôle positif de prolifération. Tetanus toxoid (TT) a été sélectionné comme antigène test et est utilisé à la concentration finale de 100 μg/ml. Les plaques sont incubées à 37°C durant 96 heures à l'issue desquelles 0.25 μCi de H-Thymidine sont ajoutés dans chaque puits pour un temps additionnel de 24 h. Après incubation les cellules sont collectées sur des filtres et la radioactivité évaluée. Les résultats présentés en figure 21 A montrent que, comme attendu, la PHA utilisée comme contrôle positif entraîne une très forte prolifération lymphocytaire. L'intensité du signal est bien en accord avec une activation polyclonale de la prolifération des cellules. Le 9G4 introduit dans l'expérience comme isotype contrôle n'a aucun impact sur la prolifération des cellules en absence ou en présence de PHA. De même les deux anticorps anti-CD151 testés ne modifient en aucun cas la prolifération . L'antigène TT induit une prolifération significative d'une partie de la population lymphocytaire (figure 21B). Cette prolifération n'est pas impactée en présence de 9G4 ou des deux anticorps anti-CD151 testés indiquant que dans les conditions de l'expérience la présentation antigénique n'est pas affectée par les composés testés.

Claims

REVENDICATIONS
1. Anticorps isolé, ou l'un de ses composés dérivés ou fragments fonctionnels, capable de se lier à la protéine CD 151, caractérisé en ce qu'il comprend : i) une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3, avec
- CDR-Ll choisi parmi les CDRs de séquence SEQ ID No. 1 ou 59 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 1 ou 59 ;
- CDR- L2 choisi parmi les CDRs de séquence SEQ ID No. 2 ou 60 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 2 ou 60 ;
- CDR-L3 de séquence SEQ ID No. 3, ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 3; et/ou ii) une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR- H2 et CDR-H3, avec
- CDR-Hl choisi parmi les CDRs de séquence SEQ ID No. 4 ou 61 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 4 ou 61 ;
- CDR-H2 choisi parmi les CDRs de séquence SEQ ID No. 5 ou 62 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 5 ou 62 ;
- CDR-H3 choisi parmi les CDRs de séquence SEQ ID No. 6 ou 63 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 6 ou 63.
2. Anticorps selon la revendication 1, caractérisé en ce qu'il comprend une chaîne légère de séquence comprenant la séquence d'acide aminé SEQ ID No. 7 et/ou une chaîne lourde de séquence comprenant la séquence d'acide aminé SEQ ID No. 8.
3. Hybridome murin déposé à la CNCM (Collection Nationale de Cultures de Microorganismes), Institut Pasteur, Paris (France) le 22 février 2008 sous le numéro I-
3920.
4. Anticorps isolé, ou l'un de ses composés dérivés ou fragments fonctionnels, capable de se lier à la protéine CD 151, caractérisé en ce qu'il comprend : i) une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3, avec
- CDR-Ll choisi parmi les CDRs de séquence SEQ ID No. 17 ou 69 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 17 ou 69 ;
- CDR-L2 choisi parmi les CDRs de séquence SEQ ID No. 18 ou 70 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 18 ou 70 ;
- CDR-L3 de séquence SEQ ID No. 19, ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 19; et/ou ii) une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR- H2 et CDR-H3, avec
- CDR-Hl choisi parmi les CDRs de séquence SEQ ID No. 20 ou 71 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 20 ou 71 ;
- CDR- H2 choisi parmi les CDRs de séquence SEQ ID No. 21 ou 72 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 21 ou 72 ;
- CDR-H3 choisi parmi les CDRs de séquence SEQ ID No. 22 ou 73 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 22 ou 73.
5. Anticorps selon la revendication 4, caractérisé en ce qu'il comprend une chaîne légère de séquence comprenant la séquence d'acide aminé SEQ ID No. 23 et/ou une chaîne lourde de séquence comprenant la séquence d'acide aminé SEQ ID No. 24.
6. Hybridome murin déposé à la CNCM (Collection Nationale de Cultures de Microorganismes), Institut Pasteur, Paris (France) le 22 février 2008 sous le numéro 1-3921.
7. Anticorps isolé, ou l'un de ses composés dérivés ou fragments fonctionnels, capable de se lier à la protéine CD 151, caractérisé en ce qu'il comprend : i) une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3, avec - CDR-Ll choisi parmi les CDRs de séquence SEQ ID No. 33 ou 79 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 33 ou 79 ;
- CDR- L2 choisi parmi les CDRs de séquence SEQ ID No. 2 ou 60 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 2 ou 60 ;
- CDR- L3 de séquence SEQ ID No. 3 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 3 ; et/ou ii) une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR- H2 et CDR-H3, avec
- CDR-Hl choisi parmi les CDRs de séquence SEQ ID No. 4 ou 61 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 4 ou 61 ;
- CDR-H2 choisi parmi les CDRs de séquence SEQ ID No. 34 ou 80 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 34 ou 80 ;
- CDR-H3 choisi parmi les CDRs de séquence SEQ ID No. 35 ou 81 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 35 ou 81.
8. Anticorps selon la revendication 7, caractérisé en ce qu'il comprend une chaîne légère de séquence comprenant la séquence d'acide aminé SEQ ID No. 36 et/ou une chaîne lourde de séquence comprenant la séquence d'acide aminé SEQ ID No. 37.
9. Hybridome murin déposé à la CNCM (Collection Nationale de Cultures de Microorganismes), Institut Pasteur, Paris (France) le 21 février 2008 sous le numéro 1-3918.
10. Anticorps isolé, ou l'un de ses composés dérivés ou fragments fonctionnels, capable de se lier à la protéine CD 151 et, caractérisé en ce qu'il comprend : i) une chaîne légère comprenant au moins un CDR choisi parmi les CDR-Ll, CDR-L2 et CDR-L3, avec
- CDR-Ll choisi parmi les CDRs de séquence SEQ ID No. 43 ou 85 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 43 ou 85 ; - CDR-L2 choisi parmi les CDRs de séquence SEQ ID No. 44 ou 86 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 44 ou 86 ;
- CDR-L3 de séquence SEQ ID No. 45 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 45 ; et/ou ii) une chaîne lourde comprenant au moins un CDR choisi parmi les CDR-Hl, CDR- H2 et CDR-H3, avec
- CDR-Hl choisi parmi les CDRs de séquence SEQ ID No. 46 ou 87 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 46 ou 87 ;
- CDR- H2 choisi parmi les CDRs de séquence SEQ ID No. 47 ou 88 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 47 ou 88 ;
- CDR-H3 choisi parmi les CDRs de séquence SEQ ID No. 48 ou 89 , ou au moins une séquence qui présente au moins 80 % d'identité après alignement optimal avec la séquence SEQ ID No. 48 ou 89.
11. Anticorps selon la revendication 10, caractérisé en ce qu'il comprend une chaîne légère de séquence comprenant la séquence d'acide aminé SEQ ID No. 49 et/ou une chaîne lourde de séquence comprenant la séquence d'acide aminé SEQ ID No. 50.
12. Hybridome murin déposé à la CNCM (Collection Nationale de Cultures de Microorganismes), Institut Pasteur, Paris (France) le 21 février 2008 sous le numéro 1-3919.
13. Acide nucléique isolé caractérisé en ce qu'il est choisi parmi les acides nucléiques suivants : a) un acide nucléique, ADN ou ARN, codant pour un anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'une des revendications 1, 2, 4, 5, 7, 8, 10 ou 11; b) un acide nucléique complémentaire d'un acide nucléique tel que défini en a) ; c) un acide nucléique d'au moins 18 nucléotides capable d'hybrider dans des conditions de forte stringence avec au moins l'une des séquences d'acide nucléique SEQ ID No. 9-16, 25-32, 38-42, 51-58, 64-68, 74-78, 82-84 ou 90-94 ou avec une séquence présentant au moins 80 %, de préférence 85 %, 90 %, 95 % et 98 %, d'identité après alignement optimal avec lesdites séquences.
14. Vecteur comprenant un acide nucléique selon la revendication 13.
15. Cellule hôte comprenant un vecteur selon la revendication 14.
16. Animal transgénique à l'exception de l'Homme comprenant une cellule selon la revendication 15.
17. Procédé de production d'un anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, selon l'une des revendications 1, 2, 4, 5, 7, 8, 10 ou 11, caractérisé en ce qu'il comprend les étapes suivantes : a) la culture dans un milieu et conditions de culture appropriés d'une cellule selon la revendication 15 ; et b) la récupération desdits anticorps, ou l'un de ses fragments fonctionnels, ainsi produits à partir du milieu de culture ou desdites cellules cultivées.
18. Anticorps, ou l'un de ses composés dérivés ou fragments fonctionnels, susceptible d'être obtenu par un procédé selon la revendication 17.
19. Composition comprenant à titre de principe actif un composé consistant en un anticorps, ou l'un de ses fragments fonctionnels, selon l'une des revendications 1, 2, 4, 5, 7, 8, 10, 11 ou 18 ou produit par l'hybridome selon les revendications 3, 6, 9 ou 12.
20. Composition selon la revendication 19, caractérisée en ce qu'elle comprend, en outre, comme produit de combinaison pour une utilisation simultanée, séparée ou étalée dans le temps, un anticorps, un agent cytotoxique/cyto statique, une toxine cellulaire ou un radioélément.
21. Composition selon l'une des revendications 19 ou 20, à titre de médicament.
22. Utilisation d'un anticorps, ou l'un de ses fragments fonctionnels, selon l'une des revendications 1, 2, 4, 5, 7, 8, 10, 11 ou 18 ou produit par l'hybridome selon les revendications 3, 6, 9 ou 12 et/ou d'une composition selon l'une quelconque des revendications 19 à 21 pour la préparation d'un médicament destiné à la prévention ou au traitement de cancer.
23. Utilisation selon la revendication 22, caractérisée en ce que ledit cancer est un cancer choisi parmi le cancer de la prostate, le cancer du poumon, le cancer du côlon ou le cancer du pancréas.
24. Méthode de diagnostic in vitro de maladies présentant une sur-expression ou une sous- expression de la protéine CD 151 à partir d'un échantillon biologique dont on suspecte la présence anormale en protéine CD 151, caractérisée en ce qu'on met en contact ledit échantillon biologique avec un anticorps selon l'une des revendications 1, 2, 4, 5, 7, 8, 10, 11 ou 18 ou produit par l'hybridome selon les revendications 3, 6, 9 ou 12, ledit anticorps pouvant être, le cas échéant, marqué.
PCT/FR2009/050612 2008-04-11 2009-04-08 Nouveaux anticorps utiles pour le traitement du cancer WO2009136070A1 (fr)

Priority Applications (17)

Application Number Priority Date Filing Date Title
MX2010011147A MX2010011147A (es) 2008-04-11 2009-04-08 Anticuerpos novedosos usados para tratar el cancer.
AU2009245587A AU2009245587B2 (en) 2008-04-11 2009-04-08 Novel antibodies used to treat cancer
JP2011503478A JP2011517565A (ja) 2008-04-11 2009-04-08 癌の処置に用いられる新規な抗体
NZ588887A NZ588887A (en) 2008-04-11 2009-04-08 Cd151 antibodies used to treat cancer
CA2720904A CA2720904A1 (fr) 2008-04-11 2009-04-08 Nouveaux anticorps utiles pour le traitement du cancer
EP09742268A EP2268671A1 (fr) 2008-04-11 2009-04-08 Nouveaux anticorps utiles pour le traitement du cancer
BRPI0909016A BRPI0909016A2 (pt) 2008-04-11 2009-04-08 anticorpos úteis para o tratamento do câncer
UAA201013336A UA105630C2 (uk) 2008-04-11 2009-04-08 Нові антитіла, які використовуються при лікуванні раку
CN2009801169974A CN102027014A (zh) 2008-04-11 2009-04-08 用于治疗癌症的新抗体
US12/576,824 US8198413B2 (en) 2008-04-11 2009-10-09 Anti-CD151 antibodies and their use in the treatment of cancer
TNP2010000460A TN2010000460A1 (fr) 2009-04-08 2010-10-08 Nouveaux anticorps utiles pour le traitement du cancer
IL208595A IL208595A0 (en) 2008-04-11 2010-10-10 Novel antibodies used to treat cancer
ZA2010/07751A ZA201007751B (en) 2008-04-11 2010-10-29 Novel antibodies used to treat cancer
MA33315A MA32288B1 (fr) 2008-04-11 2010-11-03 Nouveaux anticorps utiles pour le traitement du cancer
US13/306,839 US20120171114A1 (en) 2008-04-11 2011-11-29 Anti-cd151 antibodies and their use in the treatment of cancer
US13/440,259 US8697855B2 (en) 2008-04-11 2012-04-05 Anti-CD151 antibodies and their use in the treatment of cancer
US14/049,617 US20140193329A1 (en) 2008-04-11 2013-10-09 Anti-cd151 antibodies and their use in the treatment of cancer

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR0801985A FR2929946B1 (fr) 2008-04-11 2008-04-11 Nouveaux anticorps anti-cd151 et leur utilisation pour le traitement du cancer
FR0801985 2008-04-11

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US12/576,824 Continuation-In-Part US8198413B2 (en) 2008-04-11 2009-10-09 Anti-CD151 antibodies and their use in the treatment of cancer
US12/576,824 A-371-Of-International US8198413B2 (en) 2008-04-11 2009-10-09 Anti-CD151 antibodies and their use in the treatment of cancer
US13/440,259 Division US8697855B2 (en) 2008-04-11 2012-04-05 Anti-CD151 antibodies and their use in the treatment of cancer

Publications (1)

Publication Number Publication Date
WO2009136070A1 true WO2009136070A1 (fr) 2009-11-12

Family

ID=39645493

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/FR2009/050612 WO2009136070A1 (fr) 2008-04-11 2009-04-08 Nouveaux anticorps utiles pour le traitement du cancer

Country Status (23)

Country Link
US (3) US8198413B2 (fr)
EP (1) EP2268671A1 (fr)
JP (1) JP2011517565A (fr)
KR (1) KR20110010708A (fr)
CN (1) CN102027014A (fr)
AR (1) AR071304A1 (fr)
AU (1) AU2009245587B2 (fr)
BR (1) BRPI0909016A2 (fr)
CA (1) CA2720904A1 (fr)
CL (1) CL2009000862A1 (fr)
CO (1) CO6311009A2 (fr)
FR (1) FR2929946B1 (fr)
GE (1) GEP20135826B (fr)
IL (1) IL208595A0 (fr)
MA (1) MA32288B1 (fr)
MX (1) MX2010011147A (fr)
NZ (1) NZ588887A (fr)
RU (1) RU2010145063A (fr)
SA (1) SA109300216B1 (fr)
TW (1) TW201002347A (fr)
UA (1) UA105630C2 (fr)
WO (1) WO2009136070A1 (fr)
ZA (1) ZA201007751B (fr)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102597004A (zh) * 2009-10-09 2012-07-18 皮埃尔法布雷医药公司 Cd151特异性嵌合抗体及其在癌症治疗中的用途

Families Citing this family (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2907341B1 (fr) * 2006-10-18 2012-08-17 Pf Medicament Utilisation d'un anticorps anti-cd151 pour le traitement du cancer
FR2929519B1 (fr) * 2008-04-04 2010-04-23 Pf Medicament Utilisation d'un anticorps anti-cd151 pour le traitement precoce des cancers.
CA2827007A1 (fr) * 2011-02-11 2012-08-16 Research Corporation Technologies, Inc. Molecules de matrice a domaine ch2 issues de la greffe rationnelle de boucles de donneur sur des echafaudages ch2
WO2012131680A2 (fr) 2011-03-28 2012-10-04 Yeda Research And Development Co. Ltd. Compositions et procédés pour le traitement de l'inflammation
FR3017936B1 (fr) 2014-02-21 2019-03-15 Thales Systeme de regulation thermique d'au moins un module electronique embarque a bord d'un aeronef
BR112018008904A2 (pt) 2015-11-03 2018-11-27 Janssen Biotech Inc anticorpos que se ligam especificamente a tim-3 e seus usos
ITUB20154769A1 (it) 2015-11-04 2017-05-04 Centro Di Riferimento Oncologico Cro Irccs Aviano Anticorpo monoclonale anti-BARF1
CN115925952A (zh) * 2018-03-13 2023-04-07 东莞凡恩世生物医药有限公司 抗叶酸受体1抗体及其用途
AU2019358060A1 (en) * 2018-10-09 2021-04-29 Ibex Biosciences, Inc. Antibodies directed to filamin-A and therapeutic uses thereof
WO2023235666A2 (fr) * 2022-05-31 2023-12-07 Vanderbilt University Anticorps humains contre bordetella pertussis et leurs utilisations
CN114790240B (zh) * 2022-06-10 2023-06-06 郑州大学 SARS-CoV-2中和性单克隆抗体及应用

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999066027A1 (fr) * 1998-06-15 1999-12-23 The Research Foundation Of State University Of New York Anticorps monoclonaux reconnaissant des antigenes associes a une metastase tumorale

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20070054278A1 (en) * 2003-11-18 2007-03-08 Applera Corporation Polymorphisms in nucleic acid molecules encoding human enzyme proteins, methods of detection and uses thereof
US20080003605A1 (en) * 2006-05-24 2008-01-03 The University Of Chicago Microarray analysis of light chain variable gene expression and methods of use
FR2907341B1 (fr) * 2006-10-18 2012-08-17 Pf Medicament Utilisation d'un anticorps anti-cd151 pour le traitement du cancer

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999066027A1 (fr) * 1998-06-15 1999-12-23 The Research Foundation Of State University Of New York Anticorps monoclonaux reconnaissant des antigenes associes a une metastase tumorale

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
GEARY S M ET AL: "Differential tissue expression of epitopes of the tetraspanin CD151 recognised by monoclonal antibodies", TISSUE ANTIGENS, MUNKSGAARD, COPENHAGEN, DK, vol. 58, no. 3, 1 September 2001 (2001-09-01), pages 141 - 153, XP002435970, ISSN: 0001-2815 *
SERRU V ET AL: "Selective tetraspan-integrin complexes (CD81/alpha4beta1, CD151/alpha3beta1, CD151/alpha6beta1) under conditions disrupting tetraspan interactions", BIOCHEMICAL JOURNAL, THE BIOCHEMICAL SOCIETY, LONDON, vol. 340, no. PART 1, 15 May 1999 (1999-05-15), pages 103 - 111, XP002435969, ISSN: 0264-6021 *
TESTA J E ET AL: "EUKARYOTIC EXPRESSION CLONING WITH AN ANTIMETASTATIC MONOCLONAL ANTIBODY IDENTIFIES A TETRASPANIN (PETA-3/CD151) AS AN EFFECTOR OF HUMAN TUMOR CELL MIGRATION AND METASTASIS", CANCER RESEARCH, AMERICAN ASSOCIATION FOR CANCER RESEARCH, BALTIMORE, MD, vol. 59, no. 15, 1 August 1999 (1999-08-01), pages 3812 - 3820, XP008064694, ISSN: 0008-5472 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102597004A (zh) * 2009-10-09 2012-07-18 皮埃尔法布雷医药公司 Cd151特异性嵌合抗体及其在癌症治疗中的用途
EP2486057A1 (fr) * 2009-10-09 2012-08-15 Pierre Fabre Médicament Anticorps chimériques spécifiques pour cd151 et leur utilisation dans le traitement du cancer

Also Published As

Publication number Publication date
AU2009245587A1 (en) 2009-11-12
AR071304A1 (es) 2010-06-09
BRPI0909016A2 (pt) 2015-12-22
JP2011517565A (ja) 2011-06-16
ZA201007751B (en) 2011-08-31
AU2009245587B2 (en) 2014-11-27
US20120284810A1 (en) 2012-11-08
FR2929946B1 (fr) 2010-05-28
US8198413B2 (en) 2012-06-12
RU2010145063A (ru) 2012-05-20
MA32288B1 (fr) 2011-05-02
KR20110010708A (ko) 2011-02-07
TW201002347A (en) 2010-01-16
CN102027014A (zh) 2011-04-20
CL2009000862A1 (es) 2009-08-14
GEP20135826B (en) 2013-05-27
US20140193329A1 (en) 2014-07-10
EP2268671A1 (fr) 2011-01-05
FR2929946A1 (fr) 2009-10-16
NZ588887A (en) 2012-10-26
MX2010011147A (es) 2011-10-10
IL208595A0 (en) 2010-12-30
UA105630C2 (uk) 2014-06-10
US20100150902A1 (en) 2010-06-17
US8697855B2 (en) 2014-04-15
SA109300216B1 (ar) 2013-04-20
CO6311009A2 (es) 2011-08-22
CA2720904A1 (fr) 2009-11-12

Similar Documents

Publication Publication Date Title
EP2268671A1 (fr) Nouveaux anticorps utiles pour le traitement du cancer
KR101671039B1 (ko) 항 ｃｘｃｒ4 항체 및 그들의 암의 치료를 위한 용도
KR101504770B1 (ko) 내성 항원에 대항하는 활성 항체의 생산 방법, 상기 방법에 의해 생산된 항체 및 이의 용도
EP2079482B1 (fr) Utilisation d&#39;un anticorps anti-cd151 pour le traitement de cancer primaire
WO2010137654A1 (fr) Composition pharmaceutique contenant un antagoniste d&#39;un ligand de la famille de l&#39;egf en tant que composant
FR2909092A1 (fr) Nouveaux anticorps anti-proliferation
CA2759836A1 (fr) Anticorps axl humanises
EP1461359A2 (fr) Anticorps anti-igf-ir et leurs applications
FR2873699A1 (fr) Nouveaux anticorps anti igf ir rt leurs utilisations
EP2270053A1 (fr) Anticorps AXL humanisés
EP2673298A1 (fr) Anticorps anti-gb3 utiles dans le traitement des maladies associées à l&#39;angiogénèse
FR2834990A1 (fr) Nouveaux anticorps anti-igf-ir et leurs applications
FR2834991A1 (fr) Nouveaux anticorps anti-igf-ir et leurs applications
EP2308897A1 (fr) Anticorps chimères spécifiques de CD151 et leurs utilisations pour le traitement du cancer
US20120171114A1 (en) Anti-cd151 antibodies and their use in the treatment of cancer
TW202408584A (zh) 抗體-藥物結合物與抗SIRPα抗體之組合
WO2009136031A1 (fr) Utilisation d&#39;un anticorps anti-cd151 pour le traitement precoce des cancers

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200980116997.4

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09742268

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 12010502233

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 2720904

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2011503478

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: MX/A/2010/011147

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 7548/DELNP/2010

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 588887

Country of ref document: NZ

Ref document number: 2009245587

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 20107024503

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2009742268

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: DZP2010000685

Country of ref document: DZ

WWE Wipo information: entry into national phase

Ref document number: 11995

Country of ref document: GE

WWE Wipo information: entry into national phase

Ref document number: 2010145063

Country of ref document: RU

Ref document number: 10141712

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2009245587

Country of ref document: AU

Date of ref document: 20090408

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: PI0909016

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20101011