WO2009025763A2 - Therapeutic compositions for treatment of inflammation of ocular and adnexal tissues - Google Patents
Therapeutic compositions for treatment of inflammation of ocular and adnexal tissues Download PDFInfo
- Publication number
- WO2009025763A2 WO2009025763A2 PCT/US2008/009776 US2008009776W WO2009025763A2 WO 2009025763 A2 WO2009025763 A2 WO 2009025763A2 US 2008009776 W US2008009776 W US 2008009776W WO 2009025763 A2 WO2009025763 A2 WO 2009025763A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition
- ocular
- inflammatory
- cytokine
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7105—Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K36/00—Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
- A61K36/16—Ginkgophyta, e.g. Ginkgoaceae (Ginkgo family)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K36/00—Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
- A61K36/18—Magnoliophyta (angiosperms)
- A61K36/185—Magnoliopsida (dicotyledons)
- A61K36/25—Araliaceae (Ginseng family), e.g. ivy, aralia, schefflera or tetrapanax
- A61K36/258—Panax (ginseng)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K36/00—Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
- A61K36/18—Magnoliophyta (angiosperms)
- A61K36/185—Magnoliopsida (dicotyledons)
- A61K36/45—Ericaceae or Vacciniaceae (Heath or Blueberry family), e.g. blueberry, cranberry or bilberry
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K36/00—Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
- A61K36/18—Magnoliophyta (angiosperms)
- A61K36/185—Magnoliopsida (dicotyledons)
- A61K36/53—Lamiaceae or Labiatae (Mint family), e.g. thyme, rosemary or lavender
- A61K36/537—Salvia (sage)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K36/00—Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
- A61K36/18—Magnoliophyta (angiosperms)
- A61K36/185—Magnoliopsida (dicotyledons)
- A61K36/82—Theaceae (Tea family), e.g. camellia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K36/00—Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
- A61K36/18—Magnoliophyta (angiosperms)
- A61K36/185—Magnoliopsida (dicotyledons)
- A61K36/87—Vitaceae or Ampelidaceae (Vine or Grape family), e.g. wine grapes, muscadine or peppervine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/06—Tripeptides
- A61K38/063—Glutathione
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/12—Cyclic peptides, e.g. bacitracins; Polymyxins; Gramicidins S, C; Tyrocidins A, B or C
- A61K38/13—Cyclosporins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1816—Erythropoietin [EPO]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/20—Interleukins [IL]
- A61K38/2006—IL-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/21—Interferons [IFN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0048—Eye, e.g. artificial tears
- A61K9/0051—Ocular inserts or implants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/06—Antiglaucoma agents or miotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
Definitions
- This invention relates generally to the field of ophthalmology.
- Inflammation of the ocular and adnexal tissues can occur by a variety of mechanisms and is associated, either primarily or secondarily, with a large number of disease conditions.
- Current treatments for inflammation of these tissues involve the systemic administration of antibiotics, steroids, and immune-system inhibitors.
- the difficulty of using these systemic drugs becomes apparent through damaging long-term side effects in the case of steroids, long-term drug resistance in the case of antibiotics, or insufficient long-term persistence at the target site in the case of signaling inhibitors.
- the systemic inhibition of signaling within the immune system can have deleterious outcomes for individuals already afflicted with disease, whose susceptibility to additional complications is increased as a result of the systemic use of these treatments.
- the present invention overcomes these obstacles by administering a topical composition comprising one or more antagonists of IL-I function, or a combination of EL-I and other inflammatory antagonists, to locally decrease or prevent inflammation of the ocular and adnexal tissues.
- a method for inhibiting or reducing the severity of an ocular inflammatory disorder is carried out by locally administering to an ocular or adnexal tissue of a subject a composition that inhibits an activity of an inflammatory interleukin-1 cytokine such as binding of an inflammatory IL-I cytokine to an IL-I receptor.
- the subject is identified as suffering from a ocular inflammatory disorder by detecting a sign or symptom selected from the group consisting of epithelial overexpression of an inflammatory cytokine, vascular hyperplasia or thickening of lid margin, neovascularization of lid margin or corneal periphery, increase of leukocytes at an ocular or adnexal tissue, or overexpression of a matrix metalloprotease at an ocular or adnexal tissue.
- the method of therapy inhibits or reduces the severity of at least one of these signs or symptoms.
- the inflammatory disorder is blepharitis.
- the method comprises administration of a compound that inhibits binding of an inflammatory IL-I cytokine to an IL-I receptor.
- the composition also contains an antibiotic compound.
- the composition does not comprise tetracycline alone, e.g. in the absence of a functional antagonist that specifically targets IL-I .
- the composition comprises an antibiotic composition administered in combination with a functional antagonist specifically targeting IL-I.
- composition that inhibits binding of an inflammatory IL-I cytokine to an IL-I receptor comprises the amino acid sequence of SEQ ID NO: 16.
- the composition is present in a concentration range of 0.1-10%, with preferred ranges between 1-5%, or 2-2.5% (mg/ml).
- Exemplary liquid formulations for eye drops contain 2-2.5% (mg/ml) of the composition.
- Preferred formulations are in the form of a solid, a paste, an ointment, a gel, a liquid, an aerosol, a mist, a polymer, a film, an emulsion, or a suspension.
- the formulations are administered topically, e.g., the composition is delivered to an ocular or adnexal tissue to directly contact that tissue.
- the method does not involve systemic administration or substantial dissemination of the composition to non-ocular or non-adnexal tissue.
- subcutaneous injection of Kineret see SEQ ID NO: 15 and 16
- Topical administration of Kineret as disclosed herein, temporally and spatially restricts absorption of the drug to a much greater degree than subcutaneous injection.
- the systemic dissemination of a topically administered Kineret composition contributes significantly less drug to the blood serum concentration than a subcutaneous injection.
- the composition further contains a compound selected from the group consisting of a physiological acceptable salt, poloxamer analogs with carbopol, carbopol/hydroxypropyl methyl cellulose (HPMC), carbopol-methyl cellulose, carboxymethylcellulose (CMC), hyaluronic acid, cyclodextrin, and petroleum.
- a physiological acceptable salt poloxamer analogs with carbopol, carbopol/hydroxypropyl methyl cellulose (HPMC), carbopol-methyl cellulose, carboxymethylcellulose (CMC), hyaluronic acid, cyclodextrin, and petroleum.
- the invention comprises a composition that inhibits an activity of an inflammatory interleukin-1 cytokine, the composition being in the form of a solid, a paste, an ointment, a gel, a liquid, an aerosol, a mist, a polymer, a film, an emulsion, or a suspension.
- the composition is present at a concentration of 0.1 - 10% (mg/ml).
- An exemplary composition includes a polypeptide comprising the amino acid sequence of SEQ ID NO: 16.
- a method for inhibiting or reducing the severity of an ocular inflammatory disorder is also carried out by locally administering to an ocular or adnexal tissue of a subject a composition comprising a polynucleotide, a polypeptide, an antibody, a compound, or a small molecule that inhibits the transcription, transcript stability, translation, modification, localization, secretion, or function of a polynucleotide or polypeptide encoding an inflammatory interleukin-1 cytokine (IL-Ia, SEQ ID NO: 1 and 2, or IL-Ib, SEQ ID NO: 3 and 4), an IL-I receptor (type 1, SEQ ID NO: 17 and 18, or type 2, SEQ ID NO: 17-21), an IL-IR binding protein (IL-IRAP, SEQ ID NO: 24-27), or an IL-IR downstream signaling effector (IRAKI, SEQ ID NO: 28-33).
- IL-Ia inflammatory interleukin-1 cytokine
- the composition inhibits or enhances the transcription, transcript stability, translation, modification, localization, secretion, or function of a polynucleotide or polypeptide encoding the IL-I receptor, type 2 (IL- 1R2).
- IL- 1R2 binds IL-I and can inhibit the function of IL-IRl.
- enhancement of IL-I R2 function provides another mechanism by which IL-IRl activity is inhibited.
- the composition alone, or in combination with an enhancer of IL-I R2, inhibits the transcription, transcript stability, translation, modification, localization, secretion, or function of a polynucleotide or polypeptide encoding IL-lRa3, SEQ ID NO: 22 or 23.
- the composition contains one or more regions of a polynucleotide or polypeptide encoding IL-lRa3 to augment IL- 1R2 inhibition.
- the composition of this embodiment comprises the whole polynucleotide or polypeptide encoding IL-lRa3.
- the composition comprises a polynucleotide, a polypeptide, an antibody, a compound, or a small molecule with means to inhibit the transcription, transcript stability, translation, modification, localization, secretion, or function of a polynucleotide or polypeptide encoding an accessory protein of an IL-I Receptor.
- this IL-I receptor accessory protein is IL- IRAP, which directly binds IL-I and IL-IRl, and is defined by the polynucleotide sequence of SEQ ID NO: 24 or 26 and the polypeptide sequence of SEQ ID NO: 25 or 27.
- IL-IRAP belongs to a signaling complex that is required for signal transduction from IL-IRl. Thus, inhibition of IL-IRAP antagonizes IL-IRl function.
- the composition comprises a polynucleotide, a polypeptide, an antibody, a compound, or a small molecule with means to inhibit the transcription, transcript stability, translation, modification, localization, secretion, or function of a polynucleotide or polypeptide encoding an associated kinase to an IL-I receptor.
- IL-I receptor- associated kinase is IRAKI.
- IRAKI is a downstream signaling effector that leads to transcriptional events associated with escalating inflammatory responses and is defined by the polynucleotide sequence of SEQ ID NO: 28, 30, or 32 and the polypeptide sequence of SEQ ID NO: 29, 31, or 33.
- IRAKI Upon IL-I receptor binding by IL-I, IRAKI is recruited to the receptor complex, becomes hyperphosphorylated, and participates in the formation of a new protein complex consisting of hyperphosphorylated IRAKI and TRAF6.
- TNF tumor necrosis factor
- TRAF6 tumor necrosis factor associated factor 6
- NF- ⁇ B nuclear factor- ⁇ B
- the composition comprises a polynucleotide, a polypeptide, an antibody, or a small molecule that binds or modifies the function of IL-l ⁇ , IL-Ib, IL-IRl, IL-1R2, IL-lRa3, IL- IRAP, or IRAKI .
- the composition comprises morpholino antisense oligonucleotides, microRNAs (miRNAs), short hairpin RNA (shRNA), or short interfering RNA (siRNA) to silence gene expression.
- Exemplary compounds to be adapted for topical administration include, but are not limited to, anakinra/Kineret® (recombinant human IL-IRa, rhlL-lRa, and SEQ ID NO: 15 and 16), IL-IR antisense oligomers (U.S. Patent No. 2005033694), IL-lRa-like nucleic acid molecule (Amgen, U.S. Patent No. 2001041792), and polynucleotide encoding a soluble IL- IR accessory molecule (Human Genome Sciences, U.S. Issued Patent No. 6974682).
- anakinra/Kineret® recombinant human IL-IRa, rhlL-lRa, and SEQ ID NO: 15 and 16
- IL-IR antisense oligomers U.S. Patent No. 2005033694
- IL-lRa-like nucleic acid molecule Amgen, U.S. Patent No.
- the composition comprises microRNA molecules adapted for topical administration to ocular or adnexal tissues in order to silence gene expression.
- miRNAs that bind to human IL-l ⁇ include, but are not limited to, miR-30c (SEQ ID NO: 34), miR-30b (SEQ ID NO: 35), miR-30a-5p (SEQ ID NO: 36), and miR-24 (SEQ ID NO: 37).
- miRNAs and corresponding sequences that bind to human IL-IRl include, but are not limited to, miR-135b (SEQ ID NO: 38), miR-326 (SEQ ID NO: 39), miR-184 (SEQ ID NO: 40), miR-214 (SEQ ID NO: 41), miR-203 (SEQ ID NO: 42), miR-331 (SEQ ID NO: 43), and miR-205 (SEQ ID NO: 44).
- Exemplary polypeptides to be adapted for topical administration to ocular or adnexal tissues include, but are not limited to, anakinra/Kineret® (recombinant human IL-IRa, rhIL-IRa, and SEQ ID NO: 15 and 16), AF12198 (binds human IL-IRl, Ac-FEWTPGWYQJYALPL- NH2 where J represents the unnatural amino acid, 2-azetidine-l-carboxylic acid, SEQ ID NO: 45), IL-IR and IL-IRAP peptide antagonists (U.S. Patent No. 20060094663), IL-IR accessory molecule polypeptides (U.S. Patent No. 20050171337), IL-IRa peptides (U.S. Patent No. 2005105830), and IL-lRa-related peptides (Amgen, U.S. Patent No. 2001042304).
- anakinra/Kineret®
- Exemplary antibodies to be adapted for topical administration to ocular or adnexal tissues include, but are not limited to, IL-I TRAP (inline fusion double chain protein of ILlR-gpl30 with MgGFc, Regeneron, U.S. Issued Patent No. 6,927,044), anti-IL-l ⁇ (U.S. Patent No. 20030026806), anti-IL-1 ⁇ (U.S. Patent No. 20030026806 and Yamasaki et al. Stroke. 1995; 26:676-681), and humanized monoclonal anti-IL-lR (Amgen, U.S. Patent No. 2004022718 and Roche, U.S. Patent No. 2005023872).
- IL-I TRAP inline fusion double chain protein of ILlR-gpl30 with MgGFc, Regeneron, U.S. Issued Patent No. 6,927,044
- anti-IL-l ⁇ U.S. Patent No. 200300
- Small molecules are organic or inorganic.
- Exemplary organic small molecules include, but are not limited to, aliphatic hydrocarbons, alcohols, aldehydes, ketones, organic acids, esters, mono- and disaccharides, aromatic hydrocarbons, amino acids, and lipids.
- Exemplary inorganic small molecules comprise trace minerals, ions, free radicals, and metabolites.
- small molecule inhibitors can be synthetically engineered to consist of a fragment, or small portion, or a longer amino acid chain to fill a binding pocket of an enzyme. Typically small molecules are less than one kilodalton.
- ZnPP IL-I blocker zinc protoporphyrin, naturally- occurring metabolite
- the composition does or, alternatively, does not comprise one or more antibiotic compositions to be used in combination with an antagonist of IL-I function.
- the antibiotic and IL-I antagonist compositions are administered simultaneously or sequentially.
- Exemplary antibiotic compositions used for combination-therapy with antagonists of ILl -mediated inflammation include but are not limited to, amikacin, gentamicin, kanamycin, neomycin, netilmicin, streptomycin, tobramycin, teicoplanin, vancomycin, azithromycin, clarithromycin, clarithromycin, dirithromycin, erythromycin, roxithromycin, troleandomycin, amoxicillin, ampicillin, azlocillin, carbenicillin, clozacillin, dicloxacillin, flucozacillin, mezlocillin, nafcillin, penicillin, piperacillin, ticarcillin, bacitracin, colistin, polymyxin B, ciprofloxaci
- the composition comprises an antagonist of an IL-I cytokine or an IL-I receptor, administered simultaneously or sequentially with a second immunosuppressive composition.
- the immunosuppressive compound comprises cyclosporin A or analogs thereof a concentration of 0.05 - 4.0 % (mg/ml).
- the immunosuppressive composition comprises a glucocorticoid, a cytostatic agent, an alkylating agent (nitrogen mustards/cyclophosphamide, nitrosoureas, platinum compounds), an antimetabolic agent (methotrexate, any folic acid analog, azathioprine, mercaptopurine, any purine analog, any pyrimidine analog, any inhibitor of protein synthesis), a cytotoxic antibiotic (dactinomycin, an anthracycline, mitomycin C, bleomycin, mithramycin), a polyclonal antibody (Atgam®, Thympglobuline®, any antibody against the antilymphocyte or antithymocyte antigens), a monoclonal antibody (OKT3®, any antibody against the T-cell receptor, any antibody against IL-2, basiliximab/Simulect®, declizumab/Zenapax®), Tacrolimus/PrografTM/FK
- the composition comprises a polynucleotide, a polypeptide, an antibody, or a small molecule that binds or modifies the function of IL-l ⁇ , IL-Ib, IL-IRa, IL-IRl, IL-1R2, Il-lRa3, IL-IRAP, or IRAKI, administered topically with a pharmaceutically appropriate carrier.
- Delivery methods for polynucleotide compositions include, but are not limited to, liposomes, receptor-mediated delivery systems, naked DNA, and engineered viral vectors such as herpes viruses, retroviruses, adenoviruses and adeno-associated viruses, among others.
- Polynucleotide compositions are administered topically with a pharmaceutically acceptable liquid carrier, e.g., a liquid carrier, which is aqueous or partly aqueous.
- a pharmaceutically acceptable liquid carrier e.g., a liquid carrier, which is aqueous or partly aqueous.
- polynucleotide sequences within the composition are associated with a liposome (e.g., a cationic or anionic liposome).
- polynucleotide molecules can be contacted directly onto the tissue site, or modified polynucleotide molecules, designed to specifically target desired cell types (e.g., sequences linked to peptides or antibodies that specifically bind receptors or antigens expressed on the target cell surface).
- a preferred approach uses a recombinant DNA construct in which the short polynucleotide sequence is placed under the control of a strong polymerase III or polymerase II promoter.
- the use of such a construct will result in the transcription of sufficient amounts of polynucleotide that will form complementary base pairs with the endogenous transcripts of nucleic acids of the invention and thereby prevent translation of endogenous mRNA transcripts.
- the invention encompasses the construction of a short polynucleotide using the complementary strand as a template.
- a vector can be introduced in vivo such that it is taken up by a cell and directs the transcription of an interfering RNA or precursor to a double stranded RNA molecule.
- the template for the short polynucleotide transcript is placed under the transcriptional control of a cell-type specific promoter or other regulatory element.
- diffusion or absorption of a topically administered composition beyond the intended ocular or adnexal target tissue does not cause deleterious or systemic side effects.
- the vector remains episomal or becomes chromosomally integrated, as long as it can be transcribed to produce the desired polynucleotide.
- Vectors are constructed by recombinant DNA technology methods standard in the art.
- Vectors can be plasmid, viral, or others known in the art, used for replication and expression in mammalian cells.
- Expression of the sequence encoding the short polynucleotide can be placed under the control of any promoter known in the art to act in mammalian, preferably human cells. Promoters are inducible or constitutive.
- Exemplary promoters include, but are not limited to: the SV40 early promoter region (Bernoist et al., Nature 290:304, 1981); the promoter contained in the 3' long terminal repeat of Rous sarcoma virus (Yamamoto et al., Cell, 22:787-797, 1988); the herpes thymidine kinase promoter (Wagner et al., Proc. Natl. Acad. Sci. USA, 78:1441, 1981); or the regulatory sequences of the metallothionein gene (Brinster et al., Nature, 296:39, 1988).
- Polypeptide compositions are associated with liposomes alone or in combination with receptor-mediated delivery systems, to enable transport across the plasma membrane. Polypeptide compositions are soluble or membrane-bound.
- An exemplary receptor-mediated delivery system involves fusion of a low-density or very-low-density lipoprotein containing particle or vesicle to the low-density lipoprotein (LDL) receptor (LDLR) as observed with Hepatitis C Virus (HCV) infection and HCV-mediated drug delivery methods.
- LDL low-density lipoprotein
- HCV Hepatitis C Virus
- Compositions comprise one or more extracellular or intracellular antibodies, also called intrabodies, raised against one or more of the following: IL-l ⁇ , IL-Ib, IL-IRa, IL-IRl, IL-1R2, Il-lRa3, IL-IRAP, or IRAKI.
- Extracellular antibodies are topically administered with a pharmacologically appropriate aqueous or non-aqueous carrier.
- Sequences encoding intracellular antibodies are subcloned into a viral or mammalian expression vector, packed in a lipophilic device to facilitate transport across the plasma membrane, and topically administered to ocular or adnexal tissue with a pharmacologically appropriate aqueous or non-aqueous carrier.
- intracellular function-blocking antibody targeted against IL-l ⁇ , IL-Ib, IL- IRa, IL-IRl, IL-1R2, Il-lRa3, IL-IRAP, or IRAKI.
- intracellular antibodies prevent post-translational modification or secretion of the target protein.
- intracellular antibodies prevent intracellular signaling events upon receptor engagement by IL-I cytokines.
- the composition comprises an antagonist of IL-I and/or IL-IR function in combination with other inhibitory elements. Antagonists of IL-I and/or IL-IR and other inhibitory elements are administered simultaneously or sequentially.
- the composition comprises an antagonist of IL-I and/or IL-IR function and an antagonist of tumor necrosis factor alpha (TNF ⁇ ).
- TNF ⁇ tumor necrosis factor alpha
- Exemplary functional blockers of TNF ⁇ include, but are not limited to, recombinant and/or soluble TNF ⁇ receptors, monoclonal antibodies, and small molecule antagonists and/or inverse agonists.
- TNF- ⁇ blocking agents are reformulated for topical administration in this embodiment.
- Exemplary commercial TNF- ⁇ blocking agents used for reformulation include, but are not limited to, etanerept/Embrel, infliximab/Remicade, and adalimumab/Humira.
- the composition comprises an antagonist of IL-I and/or IL-IR function and antagonist(s) of one or more interleukin cytokines.
- Exemplary cytokines include, but are not limited to, IL-2, IL-4, IL-5, IL-6, IL-8, IL-12, IL-17, IL-18, and IL-23.
- the composition comprises an antagonist of IL-I and/or IL-IR function and antagonist s) of one or more member(s) of the vascular epithelial growth factor (VEGF) family composed of growth factors and receptors (VEGFR).
- VEGF vascular epithelial growth factor
- Exemplary members include, but are not limited to, VEGF-A, VEGF-C, VEGFR-2, and VEGFR-3.
- the composition comprises an antagonist of IL-I and/or IL-IR function and an antagonist of interferon-gamma.
- the composition comprises an antagonist of IL-I and/or IL-IR function and antagonist(s) of one or more chemokines and their receptors.
- chemokines and receptors comprised by the composition of this embodiment include, but are not limited to, chemokine (C-C motif) receptor 1 (CCRl), chemokine (C-C motif) receptor 2 (CCR2), chemokine (C-C motif) receptor 5 (CCR5), chemokine (C-C motif) receptor 7 (CCR7), and chemokine (C-X-C motif) receptor 3 (CXCR3).
- the respective doses of the IL-I antagonist to the other inflammatory antagonist(s) is a ratio between 1:10 and 10:1 (mass/weight). Alternatively, the ratio is 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, or 9:1.
- the invention also comprises a contact lens device consisting of a composition that inhibits an activity of an inflammatory interleukin-1 cytokine and a pharmaceutically compatible polymer.
- This composition also comprises a combination of antagonists of IL-I or IL-IR function as well as antagonists of other inflammatory agents.
- the composition is incorporated into or coated onto said lens.
- the composition is either chemically bound or physically entrapped by the contact lens polymer.
- the contact lens is either hydrophobic or hydrophilic.
- the invention comprises a drug-delivery device consisting of a composition that inhibits an activity of an inflammatory interleukin-1 cytokine and a pharmaceutically compatible polymer.
- This composition also comprises a combination of antagonists of IL-I or IL-IR function as well as antagonists of other inflammatory agents.
- the composition is incorporated into or coated onto said polymer.
- the composition is either chemically bound or physically entrapped by the polymer.
- the polymer is either hydrophobic or hydrophilic.
- the polymer device comprises multiple physical arrangements. Exemplary physical forms of the polymer device include, but are not limited to, a film, a scaffold, a chamber, a sphere, a microsphere, a stent, or other structure.
- the polymer device has internal and external surfaces.
- the device has one or more internal chambers. These chambers contain one or more compositions.
- the device contains polymers of one or more chemically-differentiable monomers. The subunits or monomers of the device polymerize in vitro or in vivo.
- Exemplary mucoadhesive polyanionic natural or semi-synthethic polymers from which the device is formed include, but are not limited to, polygalacturonic acid, hyaluronic acid, carboxymethylamylose, carboxymethylchitin, chondroitin sulfate, heparin sulfate, and mesoglycan.
- the device comprises a biocompatible polymer matrix that may optionally be biodegradable in whole or in part.
- a hydrogel is one example of a suitable polymer matrix material.
- materials which can form hydrogels include polylactic acid, polyglycolic acid, PLGA polymers, alginates and alginate derivatives, gelatin, collagen, agarose, natural and synthetic polysaccharides, polyamino acids such as polypeptides particularly poly(lysine), polyesters such as polyhydroxybutyrate and poly-.epsilon.- caprolactone, polyanhydrides; polyphosphazines, poly( vinyl alcohols), poly(alkylene oxides) particularly poly(ethylene oxides), poly(allylamines)(PAM), poly(acrylates), modified styrene polymers such as poly(4-aminomethylstyrene), pluronic polyols, polyoxamers, poly(uronic acids), poly(vinylpyrrolidone) and copolymers of the above
- alginate or modified alginate material is alginate or modified alginate material.
- Alginate molecules are comprised of (l-4)-linked ⁇ -D-mannuronic acid (M units) and ⁇ L- guluronic acid (G units) monomers which vary in proportion and sequential distribution along the polymer chain.
- Alginate polysaccharides are polyelectrolyte systems which have a strong affinity for divalent cations (e.g. Ca +2 , Mg +2 , Ba +2 ) and form stable hydrogels when exposed to these molecules. See Martinsen A., et al., Biotech. & Bioeng., 33 (1989) 79-89.
- An embodiment of the invention utilizes an alginate or other polysaccharide of a lower molecular weight, preferably of size which, after dissolution, is at the renal threshold for clearance by humans.
- Polymeric devices are located topically or subcutaneously, though very superficially, wherein either a composition chemically bound or physically entrapped by the polymeric device or the device itself, degrades and must be cleared from the body.
- the alginate or polysaccharide is reduced to a molecular weight of 1000 to 80,000 daltons, more preferably 1000 to 60,000 daltons, particularly preferably 1000 to 50,000 daltons. It is also useful to use an alginate material of high guluronate content since the guluronate units, as opposed to the mannuronate units, provide sites for ionic crosslinking through divalent cations to gel the polymer.
- Internal and external surfaces optionally contain pores. Pores are either created prior to administration into a subject or result from the inclusion of pore-forming agents within the device that perforate surfaces upon administration to a subject.
- Exemplary pore forming agents include, but are not limited to, water soluble compounds such as inorganic salts and sugars. Pore forming agents are added as particulates and comprise between one and thirty percent (weight/weight of polymer). Pore size is sufficient for diffusion of proteins but not large enough cell migration into or out of the device.
- the device is administered topically, subconjuntively, or in the episcleral space, subcutaneously, or intraductally. Specifically, the device is placed on or just below the surface if an ocular or adnexal tissue. Alternatively, the device is placed inside a tear duct or gland. The composition incorporated into or onto the polymer is released or diffuses from the device.
- the invention comprises a method of contacting a composition, with means to inhibit IL- IR activity, to an ocular or adnexal tissue surface of a subject who presents symptoms or associated conditions of posterior blepharitis. Unlike all other treatments for this condition, this method comprises a composition that is topically administered to the subject and affects local disease mechanisms without the side effects present with systemically administered treatments.
- the composition is not only effective immediately, but also safe for long-term administration.
- the invention comprises a method of treating non-infectious eye disease, wherein a composition containing an inhibitor of IL-I or IL-IR function alleviates, prevents, or attenuates a symptom, cause, or mechanism of said disease by contacting said composition to the ocular surface of an affected subject.
- exemplary disease mechanisms comprise inflammation, hyperplasia, neovascularization, leukocyte recruitment, or cytokine production within superficial eye structures and those structures juxtaposed to the ocular surface.
- non-infectious eye disease is caused by obstruction, thickening, inflammation, neovascularization, or atrophy of the meibomian glands.
- non-infectious eye disease is caused by damage to structures other than the meibomian glands.
- exemplary alternative causes include, but are not limited to, oily tear film, papillary hypertrophy of the tarsal conjunctiva, corneal punctate epitheliopathy, vernal keratoconjunctivitis, atopic keratocojunctivitis, chemical burn, trachoma, pterygium, pemphigoid, corneal angiogenesis(growth of new blood vessels), psoriasis, icthyosis, erythema mutiforme, anhydrotic ectodermal dysplasia, systemic retinoid therapy, or exposure to polychlorinated byphenols.
- non-infectious eye disease can also result from a deficient tear lipid layer, an increase in tear evaporation, or the occurrence of an evaporative dry eye.
- the methods treat non-infectious eye disease that is or is not coincident with the presentation of dermatoses comprising acne rosacea, seborrhoeic dermatitis, or atopic dermatitis.
- methods are applicable to treat a primary or secondary non-infectious eye disease that is coincident with chalazia, pannus, phlyctenules, recurrent conjunctivitis, ocular surface damage, ocular rosacea, corneal ulceration, corneal perforation or secondary complications of ocular infection.
- the methods described herein are not intended to treat eye disease that results from an immune response that consequently arises following the transplantation of foreign tissue onto or into an ocular or adnexal tissue. For instance, inflammatory responses occur following host rejection of corneal transplant or as a consequence of infection following surgical procedures.
- the instant application is not intended to treat eye conditions that result directly from tissue rejection or infectious disease.
- immune responses to foreign tissues or to infectious agents can lead to protean secondary complications, such as growth of blood or lymph vessels, or overexpression of molecules that cause tissue injury; in such cases the methods described in the present application are useful as a treatment for reducing inflammation associated with such secondary complications.
- the methods and devises comprising the instant application are not intended to treat conditions arising from autoimmune responses, e.g. immune responses raised against healthy host tissues.
- the non-infectious eye disease comprises blepharitis and/or posterior blepharitis that is or is not coincident with inflammation of the posterior lid margin, inflammation of the ocular surface, burning, irritation, or patient discomfort.
- the present invention is intended to treat blepharitis that is coincident with meibomian gland dysfunction.
- the methods alleviate symptoms of non-infectious eye disease.
- Exemplary symptoms include, but are not limited to, dryness, discomfort, burning, itching, irritation, inflammation, skin abnormalities surrounding the eye, photophobia, blurred vision, and contact lens intolerance.
- the present invention comprises a composition with variable physical and chemical forms; however, the composition is topically administered and contacts an ocular or adnexal tissue directly.
- the composition is administered as a solid, a paste, an ointment, a gel, a liquid, an aerosol, a mist, a polymer, a film, an emulsion, or a suspension.
- the composition is incorporated into or coated onto a contact lens, from which one or more molecules diffuse away from the lens or are released in a temporally-controlled manner.
- the contact lens composition either remains on the ocular surface, e.g. if the lens is required for vision correction, or the contact lens dissolves as a function of time simultaneously releasing the composition into closely juxtaposed tissues.
- the present invention comprises a composition with means to inhibit the transcription, transcript stability, translation, modification, localization, secretion, or receptor binding of IL- 1 ⁇ , IL- 1 ⁇ , or a combination of both cytokines.
- the composition comprises a polynucleotide capable of binding to a region of the IL- l ⁇ mRNA transcript, defined by SEQ ID NO: 1.
- the composition comprises a polynucleotide capable of binding to a region of the IL- l ⁇ mRNA transcript, defined by SEQ ID NO: 3.
- the composition is capable of increasing the abundance of the naturally-occuring IL-I Receptor antagonist (IL-IRa).
- the composition comprises a polynucleotide, a polypeptide, an antibody, a compound, or a small molecule that binds to a region of the IL-IRa gene, mRNA transcript defined by SEQ ID NO: 5, 7, 9, 11, or 13, a polypeptide isoform of IL-IRa defined by SEQ ID NO: 6, 8, 10, 12, or 14, or a recombinant IL- IRa protein defined by SEQ ID NO: 16.
- the composition contains mRNA transcripts or polypeptides encoding a region or the entirety of the IL-IRa gene.
- the composition comprises an antagonist or inverse agonist of a receptor for IL- l ⁇ or IL-l ⁇ , specifically, IL-IRl.
- an antagonist is defined as a binding partner, or ligand, of an IL-IR that inhibits the function of an agonist, IL-I, or inverse agonist by blocking its binding to the receptor.
- An inverse agonist is defined as a molecule which binds to the same IL-IR binding-site as an agonist, for instance, IL-I, but exerts the opposite pharmacological effect.
- the composition contains a polynucleotide, a polypeptide, an antibody, a compound, or a small molecule that binds to a region of the IL-IRl defined by the polynucleotide and polypeptide sequences SEQ ID NO: 17-21.
- the composition comprises a molecule with means to inhibit IL-IR transcription, transcript stability, translation, modification, localization, secretion, ligand binding, or association with an accessory protein of an IL-IR (IL-IRAP).
- IL-IRAP is defined by the polynucleotide sequence of SEQ ID NO: 24 or 26 and the amino acid sequence of SEQ ID NO: 25 or 27.
- composition comprises a molecule with means to inhibit IL- l ⁇ - or IL- ⁇ -mediated modulation of matrix metalloproteinase (MMP) overexpression, which degrades collagen matrices within tissues and retards wound healing.
- MMP matrix metalloproteinase
- the composition comprises a human recombinant IL- IR antagonist either in pure form, or as a component of a mixture.
- the human recombinant IL- IR antagonist is combined with balanced saline, carboxymethylcellulose (CMC), or hyaluronic acid (HA), or other vehicles prior to the composition contacting the ocular or lid surface.
- the human recombinant IL-IR antagonist comprises at least 0.1%, 2.0%, 2.5%, 5%, or at most 10% of the total volume administered.
- Preferred aqueous formulations contain 2- 2.5% of the purified antagonist.
- Purified is defined as the antagonist in the absence of unrelated polynucleotides, polypeptides, cellular organelles, or lipids. Purified is defines a degree of sterility that is safe for administration to a human subject, e.g. lacking infectious or toxic agents.
- Affected subjects to which this invention is administered are identified by a variety of methods. The following examinations are used individually or combinatorially to assess the presence or absence of non-infectious eye disease (for explanation of examinations, see Examples). Subjects are identified by a break-up time of less than 10 seconds following a standard Tear Film Break-up Time (TFBT) test. Subjects are identified by a significant corneal fluorescein staining of tear film and/or conjunctival lissamine green or rose bengal staining. Subjects are identified by a result of 10mm or less for the Schrimer test with or without anesthesia.
- TFBT Tear Film Break-up Time
- Subjects are identified by significantly viscous tear excreta and/or a decrease in the number of meibomian glands or meibomian gland orifices capable of excreting tears. Subjects are identified by shades of red discoloration of the lid margin, palpebral conjunctiva, and/or bulbar conjunctiva indicating increasing extreme vascular injection (erythema). Subjects are also classified as presenting increasingly severe non-infectious eye disease with the increasing abundance and severity of the above factors. [47] The compositions and methods provided herein are used modify intraocular pressure. In one aspect of the invention, the compositions and methods provided herein are used to decrease intraocular pressure.
- Inhibitors or antagonists of IL-I cytokines and/ or IL-I receptors are used alone or in combination with other compounds to modify intraocular pressure.
- inhibitors or antagonists of IL-I cytokines and/ or IL-I receptors are used alone or in combination with other compounds to decrease intraocular pressure.
- inhibitors or antagonists of IL-I cytokines and/ or IL-I receptors are used alone or in combination with other compounds to treat ocular hypertension.
- Exemplary compounds to be used in combination with IL-I cytokines and/ or IL-I receptors include, but are not limited to, prostaglandin analogs (such as latanoprost (Xalatan), bimatoprost (Lumigan) and travoprost (Travatan) which increase uveoscleral or trabecular outflow of aqueous humor); topical beta-adrenergic receptor antagonists (such as timolol, levobunolol (Betagan), and betaxolol, which decrease aqueous humor production by the ciliary body); Alpha2-adrenergic agonists (such as brimonidine (Alphagan), which work by a dual mechanism, decreasing aqueous production and increasing uveo-scleral outflow); less-selective sympathomimetics (such as epinephrine and dipivefrin (Propine), which increase outflow of aqueous humor through
- the invention also provides compositions and methods for treating individuals or subjects with ocular hypertension including administrating to these subjects a composition comprising an IL-I or IL-IR inhibitor or antagonist.
- a composition comprising an IL-I or IL-IR inhibitor or antagonist.
- the IL-I or IL-IR inhibitor or antagonist is administered topically to the ocular surface as a liquid.
- the IL-I or IL-IR inhibitor or antagonist is administered intraocularly by injection.
- the invention also provides compositions and methods for preventing glaucoma in individuals or subjects with ocular hypertension including administrating to these subjects a composition comprising an IL-I or IL-IR inhibitor or antagonist.
- a composition comprising an IL-I or IL-IR inhibitor or antagonist.
- the IL-I or IL-IR inhibitor or antagonist is administered topically to the ocular surface as a liquid.
- the IL-I or IL-IR inhibitor or antagonist is administered intraocularly by injection.
- the invention provides a method for reducing intraocular pressure, including identifying a subject suffering from or at risk of a condition associated with above-normal intra-ocular pressure and locally administering to the subject a composition that inhibits an activity of an inflammatory interleukin-1 cytokine.
- the condition is glaucoma.
- subjects are identified by measuring their intraocular pressure and determining if the measured intraocular pressure is elevated above normal levels.
- normal level is meant to describe value within an acceptable range of values that one of ordinary skill in the art and/or a medical professional would expect a healthy subject of similar physical characteristics and medical history to have.
- IOP normal intraocular pressure
- subjects are identified as those individuals who are at risk for developing elevated intraocular pressure based upon non-limiting factors such as medical history (for instance, diabetes), side effects of medications, lifestyle and/or diet, medical intervention (such as surgery to the eye), trauma/injury, hormone changes, and aging.
- Compositions of the invention are administered to these subjects for preventative means.
- polynucleotides and polypeptides of the invention are purified and/or isolated.
- an "isolated” or “purified” nucleic acid molecule, polynucleotide, polypeptide, or protein can be substantially free of other cellular material, or culture medium when produced by recombinant techniques, or chemical precursors or other chemicals when chemically synthesized.
- Publications, U.S. patents and applications, Genbank/NCBI accession numbers, and all other references cited herein, are herby incorporated by reference.
- Figure 1 is the Ocular Surface Disease Index (OSDI) 12-item questionnaire.
- Figure 2 the Oxford Schema for grading corneal and conjunctival staining.
- Figure 3 is a graph representing the effect of IL-Ia on intraocular pressure (IOP).
- Figure 4 is a schematic representation of signaling pathways that are transduced from the IL-IR and the downstream effectors involved in carrying these intracellular signals (drawing reproduced from BioCarta website).
- Figure 5 is a questionnaire given to subjects of a study to diagnose Meibomian Gland Dysfunction (Posterior Blepharitis).
- Figure 6 is a flow diagram showing the sequence of clinical tests performed on study subjects during the screening process described in Example 8.
- Posterior blepharitis is a common chronic eyelid condition that is described as generalized inflammation of the posterior lid margin and associated with inflammation of the ocular surface and with symptoms of burning, irritation, and discomfort.
- Posterior blepharitis is associated with various disorders of the meibomian glands, known collectively as meibomian gland dysfunction (MGD). It is associated either with obstruction and inflammation of the meibomian glands or, less commonly, atrophy of the meibomian glands (Foulks, G. et al. 2003. Ocul Surf. 107-26; Bron, AJ. et al. 2004. Ocul Surf. 2:149-65).
- MGD often presents with inspissated meibomian glands, oily tear film, as well as inflammation and vascularization of the meibomian gland orifices.
- Papillary hypertrophy of the tarsal conjunctiva and corneal punctate epitheliopathy are often present, and there are prominent associations with dermatoses, such as acne rosacea, seborrhoeic dermatitis, and atopic dermatitis.
- MGD myeloma
- vernal keratoconjunctivitis atopic keratoconjunctivitis
- chemical burns trachoma
- pemphigoid psoriasis
- icthyosis erythema multiforme
- anhydrotic ectodermal dysplasia and systemic retinoid therapy.
- exposure to polychlorinated biphenyls through ingestion of contaminated cooking oils, causes a chronic form of MGD with gross and extensive acneiform skin changes (Fu, Y. A. 1984. Am J Ind Med. 5:127-32).
- MGD of sufficient extent and degree is associated with a deficient tear lipid layer, an increase in tear evaporation, and the occurrence of an evaporative dry eye.
- MGD is considered to be the most common cause of evaporative dry eye (Foulks, G. et al. 2003. Ocul Surf. 107-26).
- Individuals with MGD often complain of significant discomfort, including burning, itching, irritation, and photophobia. They may also have other associated symptoms of dry eye and may be plagued by blurred vision, gradual contact lens intolerance.
- these patients may become functionally handicapped by the negative impact of dry eye on their crucial daily activities such as working, reading, using computer, and driving (Goto, E. et al. 2002. Am J Opthalmol. 133:181-186; Miljanovic, B. et al. 2007. Am J Opthalmol. 143: 409-15 ).
- Posterior blepharitis has traditionally been managed with eyelid hygiene, topical antibiotics (erythromycin or bacitracin ointments), oral tetracyclines (tetracycline, doxycycline, or minocycline) and corticosteroids which are often time consuming, frustrating, and frequently ineffective or variably effective.
- posterior blepharitis are limited, in part, by their inability to target the underlying pathophysiologic processes.
- posterior blepharitis is the result of an underlying cytokine and inflammatory-mediated process affecting both the meibomian glands and the ocular surface (Kocak-Altintas, A.G. et al. 2003. Eur J Opthalmol. 13:351-359; McCulley, J.P. et al. 2000. Cornea. 19:650-658).
- T-cells are the prime orchestrator driving the infiltration of other inflammatory cells into the conjunctiva, as well as the upregulation of chemokines (Fukushima, A. et al. 2003. Invest. Opthalmol. Vis. Sci. 44:4366-4374).
- IL-Ia interleukin-Ia
- Flow cytometry and impression cytology of conjunctival epithelium in ocular rosacea has demonstrated a significantly higher level of intercellular adhesion molecule- 1 (ICAM-I) which is known to play a significant role in inflammation associated with dry eye disease.
- ICM-I intercellular adhesion molecule- 1
- ICAM-I could be due to the liberation of one or more pro-inflammatory cytokines such as IL-l ⁇ or interferon- ⁇ (Pisella, P.J. et al. 2000. Opthalmology. 107:1841-9).
- pro-inflammatory cytokines such as IL-l ⁇ or interferon- ⁇ (Pisella, P.J. et al. 2000. Opthalmology. 107:1841-9).
- tetracycline antibiotics have long been recognized as effective therapies for ocular surface inflammatory diseases.
- the semisynthetic tetracycline, doxycycline has been reported to successfully treat the common dry eye condition acne rosacea.
- One of the mechanisms of action of doxycycline in MGD and dry eye may be the downregulation of the IL- 1 -mediated inflammatory cascade in the corneal epithelium (Solomon, A. et al. 2000. Invent. Opthalmol. Vis. Sci. 41:2544-57).
- MGD is also associated with aqueous deficiency dry eye patients, especially those with Sjogren syndrome (SS) (McCulley, J.P. et al.1977. A, J Opthalmol. 84:788-93; Shimazaki, J. et al. 1998. Opthalmology. 105: 1485- 1488).
- SS Sjogren syndrome
- SS affects the exocrine glands, not the sebaceous glands such as the meibomian glands. Underlying inflammation as well as desiccation and keratinization of ocular surface epithelia occurs in chronic dry eye disease and plays a role in pathogenesis of MGD.
- Ocular tissues or compartments that contact the compositions comprised by the present invention include, but are not limited to, the cornea, aqueous humor, iris, and sclera.
- the term "adnexal" is defined in general terms as the appendages of an organ. In the present invention, adnexal defines a number of tissues or surfaces that are in immediate contact with the ocular surface but are not, by definition, comprised by the ocular surface. Exemplary adnexal tissues include, but are not limited to, the eyelids, lacrimal glands, and extraocular muscles.
- Topical administration of the presently invented compositions contact the following tissues and structures within the eyelid: skin, subcutaneous tissue, orbicularis oculi, orbital septum, tarsal plates, palpebral conjuntiva, and meibomian glands.
- the adnexal tissues comprise all subdivisions of the lacrimal glands, including the orbital and palpebral portions, as well as all tissues contacted by these glands.
- Extraocular muscles belonging to this category of adnexal tissues include, but are not limited to, the superior and inferior rectus, lateral and medial rectus, and superior and inferior oblique muscles.
- Compositions comprised by the present invention are applied topically and contact these tissues either alone, or in combination with ocular tissues.
- Intraocular pressure is maintained by the liquid aqueous humor, which is produced by the ciliary body of the eye.
- Aqueous humor normally does not go into the posterior segment of the eye; it is kept out of this area by the lens and the Zonule of Zinn. Instead, it stays only in the anterior segment, which is divided into the anterior and posterior chambers. While the anterior and posterior chambers are very similarly named to the anterior and posterior segments, they are not synonymous. The anterior and posterior chambers are both parts of the anterior segment.
- the ciliary bodies produce the aqueous humor, it first flows into the posterior chamber (bounded by the lens and the iris). It then flows through the pupil of the iris into the anterior chamber (bounded by the iris and the cornea). From here, it flows through a structure known as the trabecular meshwork to enter the normal body circulation.
- the two main mechanisms of ocular hypertension are an increased production of aqueous humor, or a decreased outflow of aqueous humor.
- Ocular hypertension is intraocular pressure higher than normal in the absence of optic nerve damage or visual field loss.
- Current consensus in ophthalmology defines normal intraocular pressure (IOP) as that between 10 mmHg and 21 mmHg.
- IOP intraocular pressure
- Elevated IOP is the most important risk factor for glaucoma, so those with ocular hypertension are frequently considered to have a greater chance of developing the condition.
- Intraocular pressure can increase when a patient lies down.
- some glaucoma patients e.g., normal tension glaucoma patients
- IOP intraocular pressure that is elevated enough to cause problems when they are lying down.
- Intraocular pressure may become elevated due to anatomical problems, inflammation of the eye, genetic factors, as a side-effect from medication, or during exercise. Intraocular pressure usually increases with age and is genetically influenced.
- Hypotony or ocular hypotony, is typically defined as intraocular pressure equal to or less than 5 mmHg. Such low intraocular pressure could indicate fluid leakage and deflation of the eyeball. Glaucoma
- Glaucoma is a leading cause of irreversible blindness.
- a primary risk factor for glaucoma is elevated intraocular pressure (IOP), which can contribute to significant optic nerve damage and vision loss. Elevated IOP due to reduction in aqueous outflow facility is a major causal risk factor.
- the main aqueous outflow pathway of the eye consists of a series of endothelial-cell- lined channels in the angle of the anterior chamber comprising the trabecular meshwork (TM), Schlemm's canal, the collector channels and the episcleral venous system.
- Glaucoma is a group of diseases of the optic nerve involving loss of retinal ganglion cells in a characteristic pattern of optic neuropathy. Although raised intraocular pressure is a significant risk factor for developing glaucoma, there is no set threshold for intraocular pressure that causes glaucoma. Untreated glaucoma leads to permanent damage of the optic nerve and resultant visual field loss, which can progress to blindness. Loss of visual field often occurs gradually over a long time and may only be recognized when it is already quite advanced. Once lost, this damaged visual field can never be recovered. Worldwide, it is the second leading cause of blindness. Glaucoma affects one in two hundred people aged fifty and younger, and one in ten over the age of eighty.
- Ocular hypertension is the largest risk factor in most glaucomas. Though, in some populations only 50% of patients with primary open angle glaucoma have elevated ocular pressure. Diabetics and those of African descent are three times more likely to develop primary open angle glaucoma. Higher age, thinner corneal thickness, and myopia are also risk factors for primary open angle glaucoma. People with a family history of glaucoma have about a six percent chance of developing glaucoma. Asians are prone to develop angle-closure glaucoma, and Inuit have a twenty to forty times higher risk than Caucasians of developing primary angle closure glaucoma. Women are three times more likely than men to develop acute angle-closure glaucoma due to their shallower anterior chambers. Use of steroids can also cause glaucoma.
- POAG Primary open angle glaucoma
- Interleukin-1 Interleukin-1
- IL-I Interleukin-1 receptor antagonist
- IL-IRa such as human recombinant forms (anakinra/Kineret) suppresses IL-I -mediated cell injury in TM, enhances outflow facility, and reduces IOP in glaucomatous eyes.
- the IL-I family is a group of cytokines that function as major mediators of inflammation and immune response (Dinarello, CA. 1996. Blood. 15:2095-2147). This family is composed of three forms: two proinflammatory forms, IL- l ⁇ and IL- 16, each having a precursor form, and an anti -inflammatory form, IL-I receptor antagonist (IL-IRa).
- the proinflammatory cytokine IL-I plays an important role in inflammation and immunity by increasing chemokine production, adhesion factors, macrophage infiltration and activity, and lymphocyte proliferation.
- IL-I has been implicated in the pathogenesis of human inflammatory diseases, such as rheumatoid arthritis, septic shock, and periodontitis (Jiang, Y. et al. 2000. Arthritis Rheum. 43:1001-1009; Okusawa, S. et al. 1988. J Clin Invest. 81: 1162-1172; McDevitt, MJ. et al. 2000. J. Periodontal. 71:156-163).
- IL-I cytokines play an important role in the regulation of inflammation and wound healing in the corneal and ocular surface diseases (Fabre, EJ. et al. 1991. Curr Eye Res. 10:585- 592; Rosenbaum, J.T. et al. 1995. Invest Opthalmol Vis Sci. 36: 2151-2155). Both IL-l ⁇ and IL- IB have been found to modulate matrix metalloproteinase (MMP) expression by corneal stromal fibroblasts (Fini, M.E. et al. 1990. Invest Opthalmol Vis Sci. 31:1779-1788).
- MMP matrix metalloproteinase
- IL-l ⁇ and IL-IB Increased levels of IL-l ⁇ and IL-IB have been shown in patients with Sjogren syndrome and ocular rosacea (Pflugfelder, S.C. et al. 1999. Curr Eye Res. 19:201-211; Solomon, A. et al. 2001. Invest Opthalmol Vis Sci. 42:2283-2292).
- Levels ofproinflammatory forms of IL-I are directly correlated with the intensity of corneal fluorescein staining and are inversely correlated with conjunctival goblet cell density.
- IL-I induces ocular surface disease, e.g., the chronic subclinical ocular surface inflammation of MGD and dry eye.
- the compositions and methods described herein inhibit the activity of human IL-l ⁇ and/or IL-I ⁇ , as defined by the ability to induce signal transduction or initiate/activate a downstream signaling cascade from an IL-I receptor.
- Compositions that contain an inhibitor of human IL- l ⁇ or IL-I ⁇ function antagonize the activity of an IL-I receptor.
- the composition comprises a polynucleotide, a polypeptide, an antibody, a compound, or a small molecule with means to inhibit the transcription, transcript stability, translation, modification, localization, secretion, or function of a polynucleotide or polypeptide encoding human IL-l ⁇ or IL-I ⁇ .
- the inhibitory polynucleotide or polypeptide composition binds to one or more region(s) of IL-l ⁇ or IL- l ⁇ comprised by SEQ ID NO: 1 and SEQ ID NO: 2 (IL-l ⁇ ) or SEQ ID NO: 3 and SEQ ID NO: 4 (IL-I ⁇ ).
- the inhibitory polynucleotide or polypeptide composition binds to one or more fragments of IL-l ⁇ or IL-I ⁇ comprised by SEQ ID NO: 1 and SEQ ID NO: 2 (IL-l ⁇ ) or SEQ ID NO: 3 and SEQ ID NO: 4 (IL-I ⁇ ).
- a fragment in the case of these sequences and all others provided herein, is defined as a part of the whole that is less than the whole. Moreover, a fragment ranges in size from a single nucleotide or amino acid within a polynucleotide or polypeptide sequence to one fewer nucleotide or amino acid than the entire polynucleotide or polypeptide sequence. Finally, a fragment is defined as any portion of a complete polynucleotide or polypeptide sequence that is intermediate between the extremes defined above.
- Human IL-l ⁇ is encoded by the following mRNA sequence (NCBI Accession No. NM_000575 and SEQ ID NO: 1): (For all mRNA transcripts incorporated into the present application, the initiator methionine, encoded by the codon "atg," is bolded and capitalized to delineate the start of the coding region.) accaggcaacaccattgaaggctcatatgtaaaaatccatgccttccttctcccaatctccattcccaa acttagccactggcttctggctgaggccttacgcatacctcccggggcttgcacacaccttcttctacag aagacacaccttgggcatatcctacagaagaccaggcttctctctggtctggtagagggctactttac tgtaacagggccagggtggtggtggt
- Human IL-l ⁇ is encoded by the following amino acid sequence (NCBI Accession No. NM_000575 and SEQ ID NO: 2):
- Human IL-I ⁇ is encoded by the following mRNA sequence (NCBI Accession No. NM_000576 and SEQ ID NO: 3): accaaacctcttcgaggcacaaggcacaacaggctgctctgggattctcttcagccaatcttcattgctc aagtgtctgaagcagccATGgcagaagtacctgagctcgccagtgaaatgatggcttattacagtggcaa tgaggatgacttgttctttgaagctgatggccctaaacagatgaagtgctccttccaggacctggacctc tgccctctggatggcggcatccagctacgaatctccgaccaccactacagcaagggcttcaggcagtttt
- Human IL-I ⁇ is encoded by the following amino acid sequence (NCBI Accession No. NM_000576 and SEQ ID NO: 4):
- Interleukin-1 Receptor (type 1) antagonist IL-IRa
- IL-IRa is an endogenous receptor antagonist which is primarily produced by activated monocytes and tissue macrophages, inhibits the activities of the proinflammatory forms of IL-I by competitively binding to IL-I receptor. (Gabay, C. et al. 1997. 159: 5905-5913). IL-IRa is an inducible gene that is typically upregulated in inflammatory conditions, such as rheumatoid arthritis (Arend, W.P. 1993. Adv Immunol. 54: 167-223).
- compositions comprise one or more regions of IL-IRa transcripts 1, 2, 3, or 4, intacellular IL-IRa (icIL-IRa), or their corresponding polypeptide isoforms.
- compositions comprise the entirety ofIL-IRa transcripts 1, 2, 3, or 4, intacellular IL-IRa (icIL-IRa), or their corresponding polypeptide isoforms.
- Compositions comprising any form ofhuman IL-IRa, or fragments thereof, inhibit the function ofIL-IRl.
- Human IL-IRa, transcript 1 is encoded by the following mRNA sequence (NCBI Accession No. NM_173842 and SEQ ID NO: 5): atttctttataaaccacaactctgggcccgcaatggcagtccactgccttgctgcagtcacagaATGgaa atctgcagaggcctccgcagtcacctaatcactctcctctctctgttccattcagagacgatctgcc gaccctctgggagaaaatccagcaagatgccttcagaatctgggatgttaaccagaagaccttcta tctgaggaacaaccactagttgctggatacttgcaaggaccaaatgtcaatttagaagaaaagatagat gtggtacccattgagcctcatgc
- Human IL-IRa, transcript 1 is encoded by the following amino acid sequence (NCBI Accession No. NM_173842 and SEQ ID NO: 6):
- Human IL-IRa, transcript 2 is encoded by the following mRNA sequence (NCBI Accession No. NM_173841 and SEQ ID NO: 7): gggcagctccaccctgggagggactgtggcccaggtactgcccgggtgctactttatgggcagcagctca gttgagttagagtctggaagacctcagaagacctcctgtcctatgaggccctccccATGgctttagctga cttgtatgaagaaggaggtggaggaggagaaggtgaagacaatgctgactcaaaggagacgatctgc cgaccctctgggagaaaatccagcaagatgcaagccttcagaatctgggatgttaaccagaagaccttct atctgaggaacaacca
- Human IL-IRa, transcript 2 is encoded by the following amino acid sequence (NCBI Accession No. NM 173841 and SEQ ID NO: 8):
- Human IL-IRa, transcript 3 is encoded by the following mRNA sequence (NCBI Accession No. NM_000577 and SEQ ID NO: 9): gggcagctccaccctgggagggactgtggcccaggtactgcccgggtgctactttatgggcagcagctca gttgagttagagtctggaagacctcagaagacctcctgtcctatgaggccctcccATGgctttagagac gatctgccgaccctctgggagaaaatccagcaagatgcaagccttcagaatctgggatgttaaccagaag accttctgaggaaaggacctctatctgaggaaatgtggttaaccagaag acctctatctgaggaacaaccaaactagttgctggat
- Human IL-IRa transcript 3 is encoded by the following amino acid sequence (NCBI Accession No. NM_000577 and SEQ ID NO: 10):
- Human IL-IRa, transcript 4 is encoded by the following mRNA sequence (NCBI Accession No. NM_173843 and SEQ ID NO: 11): gggcagctccaccctgggagggactgtggcccaggtactgcccgggtgctactttatgggcagcagctca gttgagttagagtctggaagacctcagaagacctcctgtcctatgaggccctcccatggctttaggggg attataaaactaatcatcaaagccaagaaggcaagagcaagcatgtaccgctgaaaacacaagataactg cataagtaatgactttcagtgcagattcatagctaacccataaactgctggggcaaaaatcatcttggaaggctctgaacctcagaaaggattcacacaagacgatctaacc
- Human IL-IRa transcript 4 is encoded by the following amino acid sequence (NCBI Accession No. NM_173843 and SEQ ID NO: 12):
- Human intracellular IL-IRa is encoded by the following mRNA sequence (NCBI Accession No.
- IL-IRa Human intracellular IL-IRa, icIL-IRa, is encoded by the following amino acid sequence (NCBI Accession No. M55646 and SEQ ID NO: 14):
- rHuIL-IRa human IL-IRa
- Anakinra Anakinra
- Kineret® differs from the native nonglycosylated IL-IRa by the addition of an N-terminal methionine. It binds to IL- IR type I with the same affinity as IL-IB.
- Kineret® consists of 153 amino acids and has a molecular weight of 17.3 kilodaltons. It is produced by recombinant DNA technology using an E. coli bacterial expression system.
- Anakinra has been approved by the FDA for the reduction in signs and symptoms of moderately to severely active rheumatoid arthritis in patients 18 years of age or older who have failed one or more disease-modifying antirheumatic drugs. Considering its high safety profile, administration of Anakinra has also been used in the treatment of arthritis in patients with Juvenile rheumatoid arthritis (Reiff, A. 2005. Curr Rheumatol Rep. 7:434-40). Other indications include prevention of graft- versus-host disease (GVHD) after bone marrow transplantation (Antin, J.H. et al. 1994.
- GVHD graft- versus-host disease
- Topical human recombinant IL- 1 Ra has been successfully used for prevention of corneal transplant rejection (Yamada, J. et al. 2000. Invest Opthalmol Vis Sci. 41 :4203-8) and allergic conjunctivitis (Keane-Myers, A.M. et al. 1999. Invest Opthalmol Vis Sci. 40:3041-6) in experimental animal models.
- using topical IL-IRa significantly decreases corneal inflammation and leads to enhanced corneal transparency in the rat model of corneal alkali injury (Yamada, J. et al. 2003. Exp Eye Res. 76:161-7).
- rHuIL-IRa human IL-IRa
- This form of rHuIL-IRa also known as Anakinra or Kineret® (Amgen Inc.), differs from the native nonglycosylated IL-IRa by the addition of an N-terminal methionine. It binds to human IL-IR, type 1, (IL-IRl) with the same affinity as IL-I ⁇ .
- Kineret® consists of 153 amino acids (see SEQ ID NO: 16) and has a molecular weight of 17.3 kilodaltons.
- composition comprises one or more regions of SEQ ID NO: 15 or SEQ ID NO: 16. Furthermore, this composition comprises the entire sequence of either SEQ ID NO: 15 or SEQ ID NO: 16.
- Anakinra/Kineret® is encoded by the following mRNA sequence (NCBI Accession No. M55646 and SEQ ID NO: 15): agctccaccctgggagggactgtggcccaggtactgcccgggtgctactttatgggcagcagctcagttg agttagagtctggaagacctcagaagacctcctgtcctatgaggccctccccATGgctttagagacgatc tgccgaccctctgggagaaaatccagcaagatgcaagccttcagaatctgggatgttaaccagaagacct tctatctgaggaacaaccaactagttgctggatacttgcaaggaccaaatgtcaatttagaagaaaaagatgtggtacccattgagc
- composition of the present invention comprises a polynucleotide, a polypeptide, an antibody, a compound, or a small molecule with means to inhibit the transcription, transcript stability, translation, modification, localization, secretion, or function of a polynucleotide or polypeptide encoding the IL-I receptor, either type 1 or 2.
- IL-I Receptor type 1 (IL-IRl)
- IL-IRl is defined by the polynucleotide sequence of SEQ ID NO: 17 or the polypeptide sequence of SEQ ID NO: 18.
- IL-I Receptor type 2 (IL- 1R2), transcript variants 1 and 2
- IL-1R2 can function as a "decoy" receptor which binds IL-I cytokines and inhibits IL-IRl.
- Polynucleotide or polypeptide compositions bind to one or more region(s) of IL-IRl or IL-1R2, and associated isoforms, comprised by SEQ ID NO: 17-21.
- IL-IRl is encoded by the following mRNA sequence (NCBI Accession No. NM 000877 and SEQ ID NO: 17): tagacgcaccctctgaagatggtgactccctcctgagaagctggaccccttggtaaaagacaaggccttc tccaagaagaatATGaaagtgttactcagacttatttgtttcatagctctactgatttcttctctctggagg ctgataaatgcaaggacgtgtgaagaaaaataattttagtgtcatctgcaaatgaaattgatgttcgtccccttaacccaaatgaacacaaaggcactataacttggtataaagatgacagcaagacacctgta tctacagaacaagcctccaggattcat
- IL-IRl is encoded by the following amino acid sequence (NCBI Accession No. NM_000877 and SEQ ID NO: 18):
- IL- 1R2, transcript variant 1 is encoded by the following mRNA sequence (NCBI Accession No. NM_004633 and SEQ ID NO: 19): cccgtgaggaggaaaaggtgtgtccgctgccacccagtgtgagcgggtgacaccacccggttaggaaatc ccagctcccaagagggtataaatccctgctttactgctgagctcctgctggaggtgaaagtctggcctgg cagccttccccaggtgagcagcaacaaggccacgtgctgctgggtctcagtcctccacttccccgtgtcct ct ctggaagttgtcaATGttgcgcttgtgtggtaatgggagttttt
- IL- 1R2, transcript variant 2 is encoded by the following mRNA sequence (NCBI Accession No. NM l 73343 and SEQ ID NO: 20): gggatgggagatactgttgtggtcacctctggaaaatacattctgctactcttaaaaactagtgacgctc atacaaatcaacagaaagagcttctgaaggaagactttaaagctgcttctgccacgtgctgctgggtctc agtctccactttccccgtgtctctggaagttgtcaggagcaATGttgcgcttgtgtggtaatggg agtttctgccttcacccttcagcctgcggcacacaggggctgccagaagct
- IL- 1R2, transcript variants 1 and 2 are encoded by the following amino acid sequence (NCBI Accession No. NM_004633, NM_173343, and SEQ ID NO: 21):
- the present invention comprises compositions with means to inhibit or enhance the activity of the human IL- 1R2.
- Compositions that comprise the IL- 1R2 antagonist, IL-lRa3, have either agonist or antagonist activity regarding the efficacy of IL-IRl function.
- the composition comprises a polynucleotide, a polypeptide, an antibody, a compound, or a small molecule with means to inhibit the transcription, transcript stability, translation, modification, localization, secretion, or function of a polynucleotide or polypeptide encoding IL-lRa3.
- the inhibitory polynucleotide or polypeptide composition binds to one or more region(s) of IL-lRa3 comprised by SEQ ID NO: 22 and SEQ ID NO: 23.
- IL-lRa3 is encoded by a region or the entirety of the following mRNA sequence (NCBI Accession No. AF_057168 and SEQ ID NO: 22): (for this sequence, the bolded and capitalized codon does not encode methionine, but rather represents the codon that encodes the first amino acid of the corresponding polypeptide) cagaagacctcctgtcctatgaggccctccccatggctttaggtaagctccttccactctctcattttttca cctgagaaatgagagaggaaaatgtctacaattggtgtttatcaaatgctttcaggctctggtgagcaag cgtccaggaaaatgtcaagcgcatggagctccaggccctgtgggggatctgggcacggggaggcatcca tgggagaccatg
- One or more isoforms ofIL-lRa3 comprise the following amino acid sequence (NCBI).
- Interleukin-1 Receptor Accessory Protein IL- IRAP
- compositions that inhibit the activity of human IL-IRAP inhibit IL-IRAP binding to an
- compositions that comprise an inhibitor of IL-IRAP function antagonize the activity of an IL-I receptor.
- the composition comprises a polynucleotide, a polypeptide, an antibody, a compound, or a small molecule with means to inhibit the transcription, transcript stability, translation, modification, localization, secretion, or function of a polynucleotide or polypeptide encoding IL-IRAP.
- the inhibitory polynucleotide or polypeptide composition binds to one or more region(s) of IL-IRAP, and associated isoforms, comprised by SEQ ID NO: 24-27.
- IL-IRAP transcript variant 1
- mRNA sequence NCBI Accession No. NM_002182 and SEQ ID NO: 24
- IL-IRAP transcript variant 1
- NBI Accession No. NM_002182 and SEQ ID NO: 25 amino acid sequence (NCBI Accession No. NM_002182 and SEQ ID NO: 25):
- IL-IRAP transcript variant 2
- mRNA sequence NCBI Accession No. NM_134470 and SEQ ID NO: 26
- IL-IRAP transcript variant 2
- NBI Accession No. NM_134470 and SEQ ID NO: 27 amino acid sequence
- Interleukin-1 Receptor Associated Kinase 1 IRAKI
- the invention also comprises compositions and methods to inhibit the activity of human
- compositions that comprise an inhibitor of IRAKI antagonize downstream signaling from an IL-I receptor.
- the composition comprises a polynucleotide, a polypeptide, an antibody, a compound, or a small molecule with means to inhibit the transcription, transcript stability, translation, modification, localization, secretion, or function of a polynucleotide or polypeptide encoding IRAKI .
- the inhibitory polynucleotide or polypeptide composition binds to one or more region(s) of IRAKI, and associated isoforms, comprised by SEQ ID NO: 28-33.
- IRAKI, transcript variant 1 is encoded by the following mRNA sequence (NCBI Accession No. NM_001569 and SEQ ID NO: 28): cgcggacccggccggcccaggcccgcgccgcggcctgagaggccccggcaggtcccggccggcggcggcagccATGgccggggggccgggcccgggggagcccgcagccccccggcgcccagcacttcttgtacg aggtgccgccctgggtcatgtgccgcttctacaaagtgatggacgccctggagcccgcgactggtgcca gttcgcccctgatcgtgcgcgaccagaccgagctgcggctgtgcgagcgcgcgcgcgaccagacc
- IRAKI transcript variant 1
- NMJ NMJ Accession No. NMJ01569 and SEQ ID NO: 29
- IRAKI transcript variant 2
- mRNA sequence NCBI Accession No. NM_001025242 and SEQ ID NO: 30
- IRAKI, transcript variant 2 is encoded by the following amino acid sequence (NCBI Accession No. NM_001025242 and SEQ ID NO: 31): MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELR LCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPP APLPSPGTTAPR PSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSST KPGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAV
- IRAKI, transcript variant 3 is encoded by the following mRNA sequence (NCBI Accession No. NM_ 001025243 and SEQ ID NO: 32): cgcggacccggccggcccaggcccgcgcccgcggcctgagaggccccggcaggtcccggccggcggcggcagccATGgccggggggccgggccccgggggagcccgcagccccccggcgcccagcacttcttgtacg aggtgccgccctgggtcatgtgccgcttctacaaagtgatggacgccctggagcccgcgactggtgcca gttcgcccctgatcgtgcgcgaccagaccgagctgcggctgtgcgagccgagccgacca
- IRAKI, transcript variant 3 is encoded by the following amino acid sequence (NCBI Accession No. NM_ 001025243 and SEQ ID NO: 33):
- MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELR LCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPR PSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSST KPGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAV KRLKENADLEWTA VKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSL EDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLG DFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVWLET LAGQPXA VKTHGARTKYLVYERLEKLQA VVAG
- the present invention comprises compositions with means to inhibit the activity of IL- l ⁇ , IL-Ib, IL-IRl, IL-1R2, Il-lRa3, IL-IRAP, or IRAKI, by delivering microRNA (miRNA) molecules to an ocular or adnexal tissue with an appropriate pharmaceutical carrier.
- compositions that comprise an miRNA targeted to either IL-lcc, IL-Ib, IL-IRl, IL-1R2, II- lRa3, IL-IRAP, or IRAKI antagonize the function of IL-IRl.
- the composition comprises one or more miRNA(s) that bind to one or more regions of IL-l ⁇ , IL-Ib, IL-IRl, IL-1R2, Il-lRa3, IL-IRAP, or IRAKI.
- the following table contains exemplary miRNAs that have been shown to partially or completely silence the expression of human IL-l ⁇ or IL-IRl.
- Table 1 Summary of miRNAs, their human target genes, nucleotide sequences, and their se uence identifier numbers.
- inhibition, prevention, diminution, reduction, decrease, repression, or interruption intracellular signaling initiated, communicated, or transduced from an IL-I receptor is achieved by preventing or decreasing binding of an IL-I cytokine to an IL- IR.
- transduction of intracellular signaling from an IL-IR is prevented by removing, silencing, or mutating a downstream effector or target within a signaling cascade.
- the expression and/or function or activity of downstream effectors and/or targets are removed (e.g. deleted, knocked-out, sequestered, denatured, degraded, etc.), silenced (degraded, transcriptionally or translationally repressed), or mutated (nucleotide or amino acid sequence encoding the active product is altered to encode a non-functional product) by genetic modification or administration of a therapeutic compound.
- Exemplary downstream effectors and/or targets include, but are not limited to, one or more isoforms or homologs of an IL-I (interleukin 1), an IL- l ⁇ (interleukin 1 alpha), an IL- l ⁇ (interleukin 1 beta), an IL-IR (interleukin 1 receptor, type I), an IL-IRa (HL- IR antagonist), an IL-IRAcP (IL-IR accessory protein), a TOLLIP (TOLL interacting protein), an IRAKI (IL- IR associated kinase 1), an IRAK2 (IL-IR associated kinase 2), an IRAK 3 (IL-IR associated kinase 3), a MYD88 (myeloid differentiation primary response gene 88), an ECSIT (evolutionarily conserved signaling intermediate in Toll pathways), a TRAF6 (TNF-receptor associated factor 6), a MEKKl (MAP ERK kinase kinase 1)
- the inhibition of an activity of an inflammatory interleukin- 1 cytokine is determined by sampling an ocular or adnexal tissue or fluid and determining the abundance of a polynucleotide or polypeptide which encodes for component of an IL-IR signaling cascade.
- An increase or decrease in the abundance of a polynucleotide or polypeptide which encodes for component of an IL-IR signaling cascade following administration of a therapeutic composition of the invention compared to the abundance of the component of an IL-IR signaling cascade prior to the administration indicates inhibition of an activity of an inflammatory interleukin- 1 cytokine.
- Figure 4 shows the functional interrelationships between components of two exemplary signaling cascades.
- the arrows between components in this figure indicate that the component preceding the arrow activates the component following the arrow.
- the blunted lines indicated that the component preceding the blunted line inhibits the activity or function of the component following the blunted line.
- IL-IR IL-I receptor accessory protein
- IL-IRAcP IL-I receptor accessory protein
- IL-I binding causes activation of two kinases, IRAK-I and IRAK-2, associated with the IL-I receptor complex.
- IRAK-I IL-I Receptor Associated Kinase
- TRAF6 activates and recruits TRAF6 to the IL-I receptor complex.
- TRAF6 activates two pathways, one leading to NF-kB activation and another leading to c-jun activation.
- the TRAF associated protein ECSIT leads to c-Jun activation through the Map kinase/JNK signaling system.
- TRAF6 also signals through the TABl /TAKl kinases to trigger the degradation of I-kB, and activation of NF-kB.
- a decrease in the abundance or absence of the processed form of MEKKl a decrease in the abundance or absence of phosphorylated I ⁇ B ⁇ , a decrease in the abundance or absence of phosphorylated c-JUN, a decrease in the abundance or absence of ICAM-I, or a decrease in the abundance or absence of IL-6, TNF ⁇ , IFN ⁇ , IFN ⁇ , TGF ⁇ in an ocular or adnexal tissue or fluid is indicative of inhibition of an inflammatory interleukin-1 cytokine.
- a decrease or absence of activity or function of any of the above-listed components is indicative of inhibition of an inflammatory interleukin-1 cytokine.
- Exemplary compounds incorporated to facilitate and expedite transdermal delivery of topical compositions into ocular or adnexal tissues include, but are not limited to, alcohol (ethanol, propanol, and nonanol), fatty alcohol (lauryl alcohol), fatty acid (valeric acid, caproic acid and capric acid), fatty acid ester (isopropyl myristate and isopropyl n-hexanoate), alkyl ester (ethyl acetate and butyl acetate), polyol (propylene glycol, propanedione and hexanetriol), sulfoxide (dimethylsulfoxide and decylmethylsulfoxide), amide (urea, dimethylacetamide and pyrrolidone derivatives), surfactant (sodium lauryl sulfate, cetyltrimethylammonium bromide, polaxamers, spans, tweens, bile salts and lec
- the composition further contains a compound selected from the group consisting of a physiological acceptable salt, poloxamer analogs with carbopol, carbopol/hydroxypropyl methyl cellulose (HPMC), carbopol-methyl cellulose, carboxymethylcellulose (CMC), hyaluronic acid, cyclodextrin, and petroleum.
- a physiological acceptable salt poloxamer analogs with carbopol, carbopol/hydroxypropyl methyl cellulose (HPMC), carbopol-methyl cellulose, carboxymethylcellulose (CMC), hyaluronic acid, cyclodextrin, and petroleum.
- the invention comprises a contact lens and a composition that inhibits an activity of an inflammatory interleukin-1 cytokine.
- the composition is incorporated into or coated onto said lens.
- the composition is chemically bound or physically entrapped by the contact lens polymer.
- a color additive is chemically bound or physically entrapped by the polymer composition that is released at the same rate as the therapeutic drug composition, such that changes in the intensity of the color additive indicate changes in the amount or dose of therapeutic drug composition remaining bound or entrapped within the polymer.
- an ultraviolet (UV) absorber is chemically bound or physically entrapped within the contact lens polymer.
- the contact lens is either hydrophobic or hydrophilic.
- Exemplary materials used to fabricate a hydrophobic lens with means to deliver the compositions of the present invention include, but are not limited to, amefocon A, amsilfocon A, aquilafocon A, arfocon A, cabufocon A, cabufocon B, carbosilfocon A, crilfocon A, crilfocon B, dimefocon A, enflufocon A, enflofocon B, erifocon A, flurofocon A, flusilfocon A, flusilfocon
- Exemplary materials used to fabricate a hydrophilic lens with means to deliver the compositions of the present invention include, but are not limited to, abafilcon A, acofilcon A, acof ⁇ lcon B, acquaf ⁇ lcon A, alofilcon A, alphafilcon A, amfilcon A, astifilcon A, atlafilcon A, balafilcon A, bisfilcon A, buf ⁇ lcon A, comfilcon A, crofilcon A, cyclofilcon A,bal ⁇ lcon A, deltafilcon A, deltafilcon B, dimefilcon A, droxfilcon A, elastofilcon A, epsilf ⁇ lcon A, esterifilcon A, etafilcon A, focofilcon A, galyfilcon A, genfilcon A, govafilcon A, hefilcon A, hefilcon B, hefilcon C, hilafilcon A, hilafilcon B, hioxif ⁇
- the Ocular Surface Disease Index is a 12-item questionnaire that provides a rapid assessment of the symptoms of ocular irritation consistent with ocular surface disease, including posterior blepharitis and dry eye disease, and their impact on vision-related functioning ( Figure 1).
- the 12 items of the OSDI questionnaire are graded on a scale of 0 to 4, where 0 indicates none of the time; 1, some of the time; 2, half of the time; 3, most of the time; and 4, all of the time.
- the OSDI is scored on a scale of O to 100, with higher scores representing greater disability.
- a negative change from baseline indicates an improvement in vision-related function and the ocular inflammatory disorders described herein.
- treatment is considered more effective than control (vehicle) as indicated by a mean change (decrease) from baseline for the OSDI of >10 units compared to control.
- Therapeutic treatment is considered more effective than the vehicle as indicated by a mean change from baseline of average score (0 -100) for the Ocular Surface Disease Index (OSDI) of >10 units better than vehicle.
- OSDI Ocular Surface Disease Index
- the standard TBUT measurement is performed by moistening a fluorescein strip with sterile non-preserved saline and applying it to the inferior tarsal conjunctiva. After several blinks, the tear film is examined using a broad beam of the slit lamp with a blue filter. The time lapse between the last blink and the appearance of the first randomly distributed dark discontinuity in the fluorescein stained tear film is measured three times and the mean value of the measurements is calculated. The tear break-up time is evaluated prior to the instillation of any eye drops and before the eyelids are manipulated in any way. Break-up times less than 10 seconds are considered abnormal. A positive change from baseline indicates improvement in symptoms of the ocular inflammatory disorders described herein. The treatment described herein, leads to an improvement in TBUT significantly greater than that observed from treatment with vehicle alone.
- Corneal staining is a measure of epithelial disease, or break in the epithelial barrier of the ocular surface, typically seen with ocular surface disorders such as posterior blepharitis and dry eye, among others. Importantly, corneal staining can exist even without clinically evident dry eye, if there is significant lid disease, such as posterior blepharitis. Corneal staining is highly correlated with ocular discomfort in many, though not all patients; in general corneal staining is associated with high scores in the OSDI, as described above.
- saline-moistened fluorescein strips or 1% sodium fluorescein solution are used to stain the tear film.
- the entire cornea is then examined using slit-lamp evaluation with a yellow barrier filter (#12 Wratten) and cobalt blue illumination (staining is more intense when it is observed with a yellow filter). Staining is graded according to the Oxford Schema ( Figure 2).
- Conjunctival staining is a measure of epithelial disease or break in the epithelial barrier of the ocular surface, typically seen with ocular surface disorders such as posterior blepharitis and dry eye, among others.
- conjunctival staining similar to corneal staining, can exist even without clinically evident dry eye, if there is significant lid disease, such as posterior blepharitis.
- Conjunctival staining can also correlate with symptoms of ocular irritation and high OSDI scores as described above. Conjunctival staining is performed under the slit-lamp using lissamine green.
- Therapeutic treatment is considered more effective than vehicle as indicated by a mean change from baseline in average score (0-5 scale) for corneal and conjunctival staining of > 1 unit better than vehicle, e.g. as detected using the Oxford Schema.
- the Schirmer test is performed in the presence and in the absence of anesthesia by placing a narrow filter-paper strip (5 x 3 5mm strip of Whatman #41 filter paper) in the inferior cul-de-sac. This test is conducted in a dimly lit room. The patient gently closes his/her eyes until five minutes have elapsed and the strips are removed. Because the tear front will continue advancing a few millimeters after it has been removed from the eyes, the tear front is marked with a ball-point pen at precisely five minutes. Aqueous tear production is measured by the length in millimeters that the strip wets during 5 minutes. Results of 10 mm or less for the Schirmer test without anesthesia and 5 mm or less for the Schirmer test with anesthesia are considered abnormal. A positive change from baseline indicates improvement of one or more symptoms of an ocular inflammatory disorder described herein.
- Posterior blepharitis is associated with lid inflammation and alterations in the quantity and/or quality of the meibomian gland secretions, with severe disease associated with quality grades 2-3, as described above.
- the treatment described herein leads to improvement in meibomian secretion characterized by a decrease in this score; for example, from 3 to 2, or from 2 to 1.
- An improvement is indicated by a mean change from baseline (0-3 scale) for meibomian gland secretion quality of > 1 unit better than vehicle.
- Lid margin vascular injection is defined as a red discoloration, compared to the surrounding eyelid skin and is graded as follows:
- Lid telangiectasia is defined as the presence of at least two blood vessels along the eyelid margin.
- Moderate (2) pink color, confined to palpebral or bulbar conjunctiva
- Severe (3) red color of the palpebral and/or bulbar conjunctiva
- Very Severe (4) marked dark redness of the palpebral and/or bulbar conjunctiva The presence or absence of tarsal papillary hypertrophy is also noted.
- EXAMPLE 8 Topical Administration of IL-IRa for Treating Posterior Blepharitis
- a solution comprising a known, and commercially-available, recombinant IL-I receptor antagonist, Anakinra (Kineret®), versus vehicle to subjects with inflammatory conditions affecting one or more ocular and/or adnexal tissues.
- Subjects who present signs or reported symptoms consistent with inflammatory disease affecting an ocular or adnexal tissue are further evaluated prior to treatment using the above- described Ocular Surface Disease Index (OSDI).
- OSDI Ocular Surface Disease Index
- Exemplary subjects are Male and female patients with signs and symptoms of posterior blepharitis (provided that not more than 7 glands are not expressible) with or without aqueous deficiency excluding those patients with end-stage lacrimal gland (Schirmer reading without anesthesia ⁇ 3 mm/5 min or if their dry eye disease is the result of destruction of conjunctival goblet cells or scarring).
- a subject is included in the following study if he or she meets the following criteria: male or female; at least 18 years of age; has not worn contact lenses for at least 2 weeks prior to the study and agrees to not wear contact lenses during study.; patient is in generally good & stable overall health, patient must have a diagnosis of posterior blepharitis as defined in Figure 5; a negative urine pregnancy test result for women of childbearing potential; women of childbearing potential must agree to use adequate contraception (hormonal or barrier method of birth control) prior to study entry and for the duration of study participation; normal lid position and closure; ability to understand and provide informed consent to participate in this study; and willingness to follow study instructions and likely to complete all required visits.
- contraception hormoneal or barrier method of birth control
- Subjects are excluded if they had used topical steroids or the commercially-available drug, Restasis, within the past 2 weeks as well as tetracycline compounds (tetracycline, doxycycline, and minocycline) within the last month or isotretinoin (Accutane) within the past 6 months.
- Subjects who report any previous treatment with Anakinra (Kineret®) or any therapeutic agent targeted at IL-I blockade are similarly excluded.
- a subject is excluded from the following study if he or she: has a history of Stevens- Johnson syndrome or ocular pemphigoid; has a history of eyelid surgery; has had intra-ocular surgery or ocular laser surgery within 3 months; has a history of microbial keratitis, including herpes; has active ocular allergies; has a corneal epithelial defect > lmm 2 ; has used topical steroids or Restasis within the past 2 weeks;_has experienced any change in dosage of tetracycline compounds (tetracycline, doxycycline, and minocycline) within the last month; has used isotretinoin (Accutane) within the past 6 months; has had any previous treatment with Anakinra (Kineret®) or any therapeutic agent targeted at IL-I blockade; is a pregnant or lactating woman; has signs of current infection, including fever and current treatment with antibiotics; has liver, renal, or hematologic disease; has a
- each patient who qualifies to continue in the study is instructed to instill one drop of the randomly assigned masked treatment three times a day in both eyes.
- the topical solution of 2.5% (25 mg/ml) concentration of Kineret is formulated and prepared from commercially available preservative- free solution of Kineret® (Amgen, Thousand Oaks, CA) by the MEEI hospital pharmacy using aseptic technique.
- vehicle [Refresh Liquigel (1% Carboxymethylcellulose)] is used three times a day in both eyes.
- patients are instructed to instill 1 drop of study medication three times a day for 3 months; 1 drop in each eye upon waking in the morning, at noon, and at bedtime.
- primary efficacy variables Meibomian gland secretion quality; Tear Break-up time; Cornea and Conjunctival staining score; and the OSDI questionnaire score.
- secondary efficacy variables are used to determine the therapeutic value of administration of compositions of the invention.
- Nonlimiting examples of secondary efficacy variables include: Meibomian gland occlusion; Schirmer test without anesthesia; Schirmer test with anesthesia. Primary and/or secondary efficacy variables are considered.
- the treatment with topical IL-IRa is considered efficacious if the 2.5% solution shows a mean change from baseline (0-3 scale) for meibomian gland secretion quality of > 1 unit better than vehicle at the week- 12 visit.
- the treatment with topical IL- IRa is considered efficacious if the 2.5% solution shows a mean change from baseline in average score (0-5 scale) for corneal and conjunctival staining of > 1 unit better than vehicle at the week- 12 visit.
- the primary safety variable monitored is the occurrence of adverse events.
- the severity of each adverse event observed is rated from mild (awareness of sign or symptom, but easily tolerated) to severe (incapacitating with inability to work or do usual activity).
- the relationship of the event to the study medication is assessed by the investigator as none, unlikely, possible, probable, or definite.
- Safety variables are evaluated at baseline and at all study visits.
- This method uses large sample theory to incorporate clustering effects to ordinal outcomes such as the clinical scoring scales used here. It can be implemented with standard software (e.g. SAS PROC RANK), and provides a valid test for either balanced or unbalanced clustered data in the presence or absence of tied rankings in datasets in which there are >20 clusters per group. The test may be used in place of the cluster-mean procedure (e.g. as would result from analysis using SAS PROC MIXED), and provides unbiased p-values where the standard Wilcoxon test is inappropriate. These analyses are then extended to control for potential confounding by variables using the stratified version of the test. A logical cut-point for stratification of continuous variables would be the median level among the vehicle treated group.
- IL-IRa was administered to one eye of wild type BALB/c mice and the mean intraocular pressure (IOP) of the both the treated and the non-treated (contralateral eye) were measured. Data from these experiments show that administration of IL-IRa is sufficient to reduce IOP by a statistically significant amount over the course of one day, and particularly, over the duration of one night (Table 4, below, and Figure 3). IOP is a risk factor for the development of glaucoma.
- the compositions and methods used were effective on wild type, or normal, subjects. As such, this example is proof-of-concept that the compositions and methods of the invention are effective for treating elevated intraocular pressure or ocular hypertension that has been caused by a variety of mechanisms, including, but not limited to IL-I -mediated inflammation.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Natural Medicines & Medicinal Plants (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Botany (AREA)
- Medical Informatics (AREA)
- Alternative & Traditional Medicine (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Ophthalmology & Optometry (AREA)
- Molecular Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Marine Sciences & Fisheries (AREA)
- Biochemistry (AREA)
- Endocrinology (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Materials For Medical Uses (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2010521046A JP5894364B2 (ja) | 2007-08-16 | 2008-08-15 | 眼および付属器組織の炎症を処置するための治療組成物 |
| EP08795360.0A EP2187900B1 (en) | 2007-08-16 | 2008-08-15 | Therapeutic compositions for treatment of inflammation of ocular and adnexal tissues |
| CA2640986A CA2640986C (en) | 2007-08-16 | 2008-08-15 | Therapeutic compositions for treatment of inflammation of ocular and adnexal tissues |
| AU2008289552A AU2008289552B2 (en) | 2007-08-16 | 2008-08-15 | Therapeutic compositions for treatment of inflammation of ocular and adnexal tissues |
| US12/298,380 US10105441B2 (en) | 2007-08-16 | 2008-08-15 | Method for inhibiting or reducing dry eye disease by IL-1Ra |
| US13/795,327 US20130273065A1 (en) | 2007-08-16 | 2013-03-12 | Therapeutic Compositions For Treatment Of Inflammation Of Ocular And Adnexal Tissues |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US96513507P | 2007-08-16 | 2007-08-16 | |
| US60/965,135 | 2007-08-16 | ||
| US13068708P | 2008-06-02 | 2008-06-02 | |
| US61/130,687 | 2008-06-02 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/795,327 Continuation US20130273065A1 (en) | 2007-08-16 | 2013-03-12 | Therapeutic Compositions For Treatment Of Inflammation Of Ocular And Adnexal Tissues |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2009025763A2 true WO2009025763A2 (en) | 2009-02-26 |
| WO2009025763A3 WO2009025763A3 (en) | 2009-04-23 |
Family
ID=40378866
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2008/009776 Ceased WO2009025763A2 (en) | 2007-08-16 | 2008-08-15 | Therapeutic compositions for treatment of inflammation of ocular and adnexal tissues |
Country Status (5)
| Country | Link |
|---|---|
| US (2) | US10105441B2 (https=) |
| EP (1) | EP2187900B1 (https=) |
| JP (2) | JP5894364B2 (https=) |
| AU (1) | AU2008289552B2 (https=) |
| WO (1) | WO2009025763A2 (https=) |
Cited By (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2011106697A1 (en) | 2010-02-25 | 2011-09-01 | Schepens Eye Research Institute | Therapeutic compositions for the treatment of dry eye disease |
| WO2012000904A1 (en) * | 2010-06-28 | 2012-01-05 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Pharmaceutical composition for use in the treatment of glaucoma |
| WO2012118863A1 (en) * | 2011-02-28 | 2012-09-07 | The Schepens Eye Research Institute, Inc. | Therapies that target autoimmunity for treating glaucoma and optic neuropathy |
| WO2012148547A1 (en) * | 2011-02-24 | 2012-11-01 | The Schepens Eye Research Institute, Inc. | Compositions and methods for treating inflammatory conditions of the ocular surface |
| JP2013536457A (ja) * | 2010-06-30 | 2013-09-19 | ジョンソン・アンド・ジョンソン・ビジョン・ケア・インコーポレイテッド | ケモカインアンタゴニストを含有する眼科用装置 |
| JP2014518261A (ja) * | 2011-06-30 | 2014-07-28 | ジョンソン・アンド・ジョンソン・ビジョン・ケア・インコーポレイテッド | 眼の炎症状態を治療するためのエステル |
| US8853150B2 (en) | 2010-07-29 | 2014-10-07 | Eleven Biotherapeutics, Inc. | Chimeric IL-1 receptor type I antagonists |
| KR20150126345A (ko) * | 2013-03-13 | 2015-11-11 | 산텐 세이야꾸 가부시키가이샤 | 마이봄 기능부전의 치료제 |
| US9359405B2 (en) | 2011-03-14 | 2016-06-07 | Phlogo Aps | Antagonists of the interleukin-1 receptor |
| CN105833234A (zh) * | 2016-05-20 | 2016-08-10 | 刘传彬 | 一种纯天然加热外敷治疗筋骨伤痛的中药组合物 |
| WO2016174082A1 (en) | 2015-04-28 | 2016-11-03 | Swedish Orphan Biovitrum Ab (Publ) | Compositions comprising anakinra |
| US9812730B2 (en) | 2011-08-02 | 2017-11-07 | Johnson & Johnson Vision Care, Inc. | Biocompatible wire battery |
| US10117906B2 (en) | 2009-01-09 | 2018-11-06 | The Schepens Eye Research Institute, Inc. | Methods for reducing corneal nerves damage, corneal lymphangiogenesis or immunity to corneal antigens in dry-eye associated ocular surface diseases by IL-1Ra |
| US10345620B2 (en) | 2016-02-18 | 2019-07-09 | Johnson & Johnson Vision Care, Inc. | Methods and apparatus to form biocompatible energization elements incorporating fuel cells for biomedical devices |
| US10361405B2 (en) | 2014-08-21 | 2019-07-23 | Johnson & Johnson Vision Care, Inc. | Biomedical energization elements with polymer electrolytes |
| US10361404B2 (en) | 2014-08-21 | 2019-07-23 | Johnson & Johnson Vision Care, Inc. | Anodes for use in biocompatible energization elements |
| US10367233B2 (en) | 2014-08-21 | 2019-07-30 | Johnson & Johnson Vision Care, Inc. | Biomedical energization elements with polymer electrolytes and cavity structures |
| US10374216B2 (en) | 2014-08-21 | 2019-08-06 | Johnson & Johnson Vision Care, Inc. | Pellet form cathode for use in a biocompatible battery |
| US10381687B2 (en) | 2014-08-21 | 2019-08-13 | Johnson & Johnson Vision Care, Inc. | Methods of forming biocompatible rechargable energization elements for biomedical devices |
| US10386656B2 (en) | 2014-08-21 | 2019-08-20 | Johnson & Johnson Vision Care, Inc. | Methods and apparatus to form separators for biocompatible energization elements for biomedical devices |
| US10451897B2 (en) | 2011-03-18 | 2019-10-22 | Johnson & Johnson Vision Care, Inc. | Components with multiple energization elements for biomedical devices |
| CN110437043A (zh) * | 2019-08-24 | 2019-11-12 | 黄泳华 | 由白藜芦醇与前列腺素类似物剂构成的共晶及其在制备抗肿瘤药物中的用途 |
| US10558062B2 (en) | 2014-08-21 | 2020-02-11 | Johnson & Johnson Vision Care, Inc. | Methods and apparatus to form biocompatible energization primary elements for biomedical device |
| US10598958B2 (en) | 2014-08-21 | 2020-03-24 | Johnson & Johnson Vision Care, Inc. | Device and methods for sealing and encapsulation for biocompatible energization elements |
| US10627651B2 (en) | 2014-08-21 | 2020-04-21 | Johnson & Johnson Vision Care, Inc. | Methods and apparatus to form biocompatible energization primary elements for biomedical devices with electroless sealing layers |
| US10775644B2 (en) | 2012-01-26 | 2020-09-15 | Johnson & Johnson Vision Care, Inc. | Ophthalmic lens assembly having an integrated antenna structure |
| US10799589B2 (en) | 2013-03-13 | 2020-10-13 | Buzzard Pharmaceuticals AB | Chimeric cytokine formulations for ocular delivery |
| US11596641B2 (en) | 2020-03-24 | 2023-03-07 | Hovione Scientia Limited | Methods and compositions for treating meibomian gland dysfunction |
| US12268706B2 (en) | 2019-01-31 | 2025-04-08 | i.com medical GmbH | Hyaluronic acid for relief of idiopathic ocular pain |
| US12296008B2 (en) | 2014-12-22 | 2025-05-13 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| US12303527B2 (en) | 2018-04-18 | 2025-05-20 | i.com medical GmbH | High molecular weight hyaluronic acid for treatment and prevention of severe ocular surface disease |
Families Citing this family (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2187900B1 (en) * | 2007-08-16 | 2016-11-09 | The Schepens Eye Research Institute, Inc. | Therapeutic compositions for treatment of inflammation of ocular and adnexal tissues |
| US20120014970A1 (en) * | 2009-01-09 | 2012-01-19 | Reza Dana | Therapeutic Compositions for Treatment of Corneal Disorders |
| WO2011050164A1 (en) | 2009-10-21 | 2011-04-28 | Avedro, Inc. | Eye therapy |
| US20110237999A1 (en) | 2010-03-19 | 2011-09-29 | Avedro Inc. | Systems and methods for applying and monitoring eye therapy |
| SG187770A1 (en) | 2010-08-12 | 2013-03-28 | Univ Nanyang Tech | A liposomal formulation for ocular drug delivery |
| US9044308B2 (en) | 2011-05-24 | 2015-06-02 | Avedro, Inc. | Systems and methods for reshaping an eye feature |
| WO2012167260A2 (en) | 2011-06-02 | 2012-12-06 | Avedro, Inc. | Systems and methods for monitoring time based photo active agent delivery or photo active marker presence |
| CA2840626A1 (en) * | 2011-06-29 | 2013-01-03 | Insite Vision Incorporated | Methods of treating recurrent meibomian glands disorder and thereby decreasing the frequency of recurrence |
| US20130297023A1 (en) * | 2012-05-07 | 2013-11-07 | Hee-Jeong Im Sampen | Methods and Devices For Treating Intervertebral Disc Disease |
| WO2013059837A2 (en) | 2012-07-16 | 2013-04-25 | Avedro, Inc. | Systems and methods for corneal cross-linking with pulsed light |
| WO2014093870A2 (en) * | 2012-12-13 | 2014-06-19 | The Schepens Eye Research Institute, Inc. | Use of c-c chemokine receptor type 7 (ccr7) inhibitors |
| AU2014209141B2 (en) | 2013-01-24 | 2018-05-10 | Palvella Therapeutics, Inc. | Compositions for transdermal delivery of mTOR inhibitors |
| WO2014179568A2 (en) * | 2013-05-02 | 2014-11-06 | Odin Biotech | Two-layer ocular implant |
| EP3858356A3 (en) * | 2013-05-19 | 2021-12-01 | Avedro, Inc. | Systems, methods, and compositions for cross-linking |
| US9498114B2 (en) | 2013-06-18 | 2016-11-22 | Avedro, Inc. | Systems and methods for determining biomechanical properties of the eye for applying treatment |
| WO2014205145A1 (en) | 2013-06-18 | 2014-12-24 | Avedro, Inc. | Systems and methods for determining biomechanical properties of the eye for applying treatment |
| US9956195B2 (en) | 2014-01-07 | 2018-05-01 | Nanyang Technological University | Stable liposomal formulations for ocular drug delivery |
| KR102416876B1 (ko) | 2014-10-27 | 2022-07-05 | 아베드로 인코퍼레이티드 | 눈의 교차-결합 처리를 위한 시스템 및 방법 |
| US10114205B2 (en) | 2014-11-13 | 2018-10-30 | Avedro, Inc. | Multipass virtually imaged phased array etalon |
| WO2016145237A1 (en) * | 2015-03-11 | 2016-09-15 | Yu Fu-Shin X | Composition and methods to promote wound healing |
| EP3285704B1 (en) | 2015-04-24 | 2020-11-18 | Avedro Inc. | Systems for photoactivating a photosensitizer applied to an eye |
| US10028657B2 (en) | 2015-05-22 | 2018-07-24 | Avedro, Inc. | Systems and methods for monitoring cross-linking activity for corneal treatments |
| US11207410B2 (en) | 2015-07-21 | 2021-12-28 | Avedro, Inc. | Systems and methods for treatments of an eye with a photosensitizer |
| EP3871682A1 (en) * | 2016-10-14 | 2021-09-01 | i.com Medical GmbH | Method for establishing, restoring, and preserving homeostasis of the ocular surface |
| EP3565520B1 (en) | 2017-01-06 | 2026-02-25 | Palvella Therapeutics, Inc. | Anhydrous compositions of mtor inhibitors and methods of use |
| CA3066918A1 (en) | 2017-06-12 | 2018-12-20 | Bluefin Biomedicine, Inc. | Anti-il1rap antibodies and antibody drug conjugates |
| US12064237B2 (en) | 2018-03-13 | 2024-08-20 | Menicon Co., Ltd. | Determination system, computing device, determination method, and program |
| CN108707195B (zh) * | 2018-05-31 | 2019-03-15 | 苏州大学 | 翘嘴鳜IFN-α3基因、重组蛋白、制备方法及应用 |
| US11000513B2 (en) | 2018-07-02 | 2021-05-11 | Palvella Therapeutics, Inc. | Anhydrous compositions of mTOR inhibitors and methods of use |
| WO2020058504A1 (en) * | 2018-09-22 | 2020-03-26 | Novaliq Gmbh | Ophthalmic compositions for treatment of ocular surface damage and symptoms of dryness |
| CN116144668A (zh) * | 2023-02-13 | 2023-05-23 | 杭州吉倍思生物制药有限公司 | 人il-1r1基因、蛋白、同源二聚体蛋白质与用途 |
Family Cites Families (52)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5075222A (en) * | 1988-05-27 | 1991-12-24 | Synergen, Inc. | Interleukin-1 inhibitors |
| KR0148009B1 (ko) | 1988-05-27 | 1998-08-01 | 그래고리 비. 아보트 | 인터루킨-1 억제제 |
| US6858409B1 (en) * | 1988-05-27 | 2005-02-22 | Amgen Inc. | Nucleic acids encoding interleukin-1 inhibitors and processes for preparing interleukin-1 inhibitors |
| US6159460A (en) * | 1988-05-27 | 2000-12-12 | Amgen Inc. | Method for treating interleukin-1 mediated diseases |
| EP0502956B1 (en) * | 1989-11-29 | 1997-04-23 | Amgen Boulder Inc. | Production of recombinant human interleukin-1 inhibitor |
| WO1993007863A1 (en) * | 1991-10-15 | 1993-04-29 | Mullarkey Michael F | Methods and compositions for treating allergic reactions |
| US5340572A (en) * | 1993-02-08 | 1994-08-23 | Insite Vision Incorporated | Alkaline ophthalmic suspensions |
| US5895812A (en) * | 1995-05-01 | 1999-04-20 | The University Of Virginia Alumni Patent Foundation | Diagnostic for Sjogren's syndrome |
| US6096728A (en) * | 1996-02-09 | 2000-08-01 | Amgen Inc. | Composition and method for treating inflammatory diseases |
| US6416753B1 (en) * | 1996-03-15 | 2002-07-09 | The General Hospital Corporation | Method for modulating apoptosis |
| US6974682B1 (en) * | 1996-08-26 | 2005-12-13 | Human Genome Sciences, Inc. | Soluble interleukin-1 receptor accessory molecule |
| WO1998022130A1 (en) | 1996-11-19 | 1998-05-28 | The Schepens Eye Research Institute, Inc. | Local use of il-1ra in corneal transplant rejection or disorders of the eye |
| ES2312179T3 (es) * | 1996-12-06 | 2009-02-16 | Amgen Inc. | Terapia combinada que utiliza un inhibidor del il-1 para el tratamiento de enfermedades mediadas por el il-1. |
| US6455583B1 (en) | 1998-05-08 | 2002-09-24 | The University Of Miami | Method for treating meibomian gland disease |
| US6432934B1 (en) * | 1998-08-06 | 2002-08-13 | Advanced Vision Research | Methods and compositions for topical treatment of eye surface inflammation and related dry eye disease |
| US6927044B2 (en) * | 1998-09-25 | 2005-08-09 | Regeneron Pharmaceuticals, Inc. | IL-1 receptor based cytokine traps |
| US20060262813A1 (en) | 1998-12-18 | 2006-11-23 | Digital Networks North America, Inc. | Multi-channel video pump |
| US6471961B1 (en) * | 1999-02-24 | 2002-10-29 | Edward L. Tobinick | Interleukin antagonists for the treatment of neurological, retinal and muscular disorders |
| JP3363832B2 (ja) * | 1999-05-13 | 2003-01-08 | アルプス電気株式会社 | 薄膜構造体およびその製造方法 |
| US20030007971A1 (en) * | 2000-01-31 | 2003-01-09 | Hideaki Hara | Remedies for ophthalmic diseases |
| JP2002154985A (ja) * | 2000-01-31 | 2002-05-28 | Santen Pharmaceut Co Ltd | 眼疾患治療剤 |
| US20010041792A1 (en) * | 2000-02-03 | 2001-11-15 | Donda Russell S. | Extraction of growth factors from tissue |
| WO2003070918A2 (en) | 2002-02-20 | 2003-08-28 | Ribozyme Pharmaceuticals, Incorporated | Rna interference by modified short interfering nucleic acid |
| US6623736B2 (en) * | 2000-05-02 | 2003-09-23 | Edward L. Tobinick | Interleukin antagonists for the treatment of neurological, retinal and muscular disorders |
| US20030026806A1 (en) * | 2000-10-27 | 2003-02-06 | Amgen Inc. | Antibodies and other selective IL-1 binding agents that allow binding to IL-1 receptor but not activation thereof |
| US7087224B2 (en) * | 2000-10-31 | 2006-08-08 | Amgen Inc. | Method of treating anemia by administering IL-1ra |
| US20050143333A1 (en) * | 2001-05-18 | 2005-06-30 | Sirna Therapeutics, Inc. | RNA interference mediated inhibition of interleukin and interleukin receptor gene expression using short interfering nucleic acid (SINA) |
| EP1432724A4 (en) * | 2002-02-20 | 2006-02-01 | Sirna Therapeutics Inc | RNA inhibition mediated inhibition of MAP KINASE GENES |
| AU2003226428A1 (en) * | 2002-04-18 | 2003-11-03 | Northwestern University | Encapsulation of nanotubes via self-assembled nanostructures |
| US7029712B1 (en) * | 2002-07-17 | 2006-04-18 | Biosyntrx Inc | Treatment for dry eye syndrome |
| WO2004060911A2 (en) | 2002-12-30 | 2004-07-22 | Amgen Inc. | Combination therapy with co-stimulatory factors |
| US20050033694A1 (en) * | 2003-06-03 | 2005-02-10 | United States Postal Service. | System and method for fleet card management |
| US20050023872A1 (en) * | 2003-07-28 | 2005-02-03 | Hetzel Thomas R. | Modular seat cushion with interlocking human support and base portions and method of creating and using a seat cushion |
| KR100543466B1 (ko) * | 2003-11-13 | 2006-01-20 | 삼성전자주식회사 | 영상 보간 장치 및 방법 |
| GB0404693D0 (en) * | 2004-03-02 | 2004-04-07 | Univ London | Pharmaceutical preparations for the treatment of ocular surface and other disorders |
| RS57852B1 (sr) | 2004-04-02 | 2018-12-31 | Swedish Orphan Biovitrum Ab Publ | Postupci za smanjenje agregacije il-1ra |
| US8618054B2 (en) * | 2004-05-05 | 2013-12-31 | Valorisation-Rechereche Société en Commandite | Interleukin-1 receptor antagonists, compositions, and methods of treatment |
| US8541413B2 (en) * | 2004-10-01 | 2013-09-24 | Ramscor, Inc. | Sustained release eye drop formulations |
| EP1858533A4 (en) * | 2005-02-22 | 2009-09-09 | Univ Johns Hopkins Med | USE OF THE AMNIOTIC FLUID FOR THE TREATMENT OF DISORDERS AND OCULAR LESIONS |
| KR101396731B1 (ko) * | 2005-03-31 | 2014-05-19 | 산텐 세이야꾸 가부시키가이샤 | 프로스타글란딘 F2a 유도체를 유효 성분으로서 함유하는망막신경세포 보호제 |
| CN101160128B (zh) * | 2005-04-13 | 2010-08-18 | 宇部兴产株式会社 | 含有吲唑衍生物作为有效成分的视网膜神经细胞保护剂 |
| WO2006119292A2 (en) * | 2005-04-29 | 2006-11-09 | Henkin, Robert | Methods for detection of biological substances |
| WO2007047969A2 (en) * | 2005-10-21 | 2007-04-26 | Amgen Inc. | Methods of decreasing vascular calcification using il-1 inhibitors |
| WO2007056812A1 (en) * | 2005-11-16 | 2007-05-24 | Apollo Life Sciences Limited | A molecule and chimeric molecules thereof |
| KR20110079922A (ko) | 2006-04-14 | 2011-07-11 | 노파르티스 아게 | 안과 장애 치료를 위한 il-1 항체의 용도 |
| CA2654565A1 (en) | 2006-06-12 | 2007-12-21 | Therakine Limited | Topical treatment for diseases of eye surface |
| US20080132475A1 (en) * | 2006-12-05 | 2008-06-05 | Charles Gerald Connor | Treatment for dry eye |
| BRPI0808410A2 (pt) * | 2007-02-28 | 2015-06-23 | Aciex Therapeutics Inc | Métodos e composições para normalizar secreções da glândula meibomiana |
| US7758190B2 (en) * | 2007-06-20 | 2010-07-20 | Tearscience, Inc. | Tear film measurement |
| EP2187900B1 (en) * | 2007-08-16 | 2016-11-09 | The Schepens Eye Research Institute, Inc. | Therapeutic compositions for treatment of inflammation of ocular and adnexal tissues |
| EP2242504B1 (en) * | 2008-01-09 | 2021-07-14 | The Schepens Eye Research Institute, Inc. | Therapeutic compositions for treatment of ocular inflammatory disorders |
| US20120014970A1 (en) * | 2009-01-09 | 2012-01-19 | Reza Dana | Therapeutic Compositions for Treatment of Corneal Disorders |
-
2008
- 2008-08-15 EP EP08795360.0A patent/EP2187900B1/en active Active
- 2008-08-15 JP JP2010521046A patent/JP5894364B2/ja active Active
- 2008-08-15 AU AU2008289552A patent/AU2008289552B2/en active Active
- 2008-08-15 US US12/298,380 patent/US10105441B2/en active Active
- 2008-08-15 WO PCT/US2008/009776 patent/WO2009025763A2/en not_active Ceased
-
2013
- 2013-03-12 US US13/795,327 patent/US20130273065A1/en not_active Abandoned
-
2015
- 2015-11-20 JP JP2015227544A patent/JP2016065089A/ja active Pending
Non-Patent Citations (3)
| Title |
|---|
| BRON, A.J. ET AL., OCUL SURF., vol. 2, 2004, pages 149 - 65 |
| FOULKS, G. ET AL., OCUL SURF., 2003, pages 107 - 26 |
| See also references of EP2187900A4 |
Cited By (61)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10117906B2 (en) | 2009-01-09 | 2018-11-06 | The Schepens Eye Research Institute, Inc. | Methods for reducing corneal nerves damage, corneal lymphangiogenesis or immunity to corneal antigens in dry-eye associated ocular surface diseases by IL-1Ra |
| US9328162B2 (en) | 2010-02-25 | 2016-05-03 | Schepens Eye Research Institute | Therapeutic compositions for the treatment of dry eye disease |
| US10179160B2 (en) | 2010-02-25 | 2019-01-15 | Schepens Eye Research Institute | Therapeutic compositions for the treatment of dry eye disease |
| US10940179B2 (en) | 2010-02-25 | 2021-03-09 | Schepens Eye Research Institute | Therapeutic compositions for the treatment of dry eye disease |
| WO2011106697A1 (en) | 2010-02-25 | 2011-09-01 | Schepens Eye Research Institute | Therapeutic compositions for the treatment of dry eye disease |
| US9011861B2 (en) | 2010-02-25 | 2015-04-21 | Schepens Eye Research Institute | Therapeutic compositions for the treatment of dry eye disease |
| WO2012000904A1 (en) * | 2010-06-28 | 2012-01-05 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Pharmaceutical composition for use in the treatment of glaucoma |
| US9095591B2 (en) | 2010-06-28 | 2015-08-04 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Pharmaceutical composition for use in the treatment of glaucoma |
| JP2013536457A (ja) * | 2010-06-30 | 2013-09-19 | ジョンソン・アンド・ジョンソン・ビジョン・ケア・インコーポレイテッド | ケモカインアンタゴニストを含有する眼科用装置 |
| US8853150B2 (en) | 2010-07-29 | 2014-10-07 | Eleven Biotherapeutics, Inc. | Chimeric IL-1 receptor type I antagonists |
| US9458216B2 (en) | 2010-07-29 | 2016-10-04 | Eleven Biotherapeutics, Inc. | Nucleic acid encoding chimeric IL-1 receptor type I antagonists |
| US9670277B2 (en) | 2011-02-24 | 2017-06-06 | The Schepens Eye Reasearch Institute, Inc. | Compositions and methods for treating inflammatory conditions of the ocular surface |
| US20140147449A1 (en) * | 2011-02-24 | 2014-05-29 | Reza Dana | Compositions and Methods for Treating Inflammatory Conditions of the Ocular Surface |
| WO2012148547A1 (en) * | 2011-02-24 | 2012-11-01 | The Schepens Eye Research Institute, Inc. | Compositions and methods for treating inflammatory conditions of the ocular surface |
| WO2012118863A1 (en) * | 2011-02-28 | 2012-09-07 | The Schepens Eye Research Institute, Inc. | Therapies that target autoimmunity for treating glaucoma and optic neuropathy |
| US9359405B2 (en) | 2011-03-14 | 2016-06-07 | Phlogo Aps | Antagonists of the interleukin-1 receptor |
| US10451897B2 (en) | 2011-03-18 | 2019-10-22 | Johnson & Johnson Vision Care, Inc. | Components with multiple energization elements for biomedical devices |
| US10383839B2 (en) | 2011-06-30 | 2019-08-20 | Johnson & Johnson Vision Care, Inc. | Esters for treatment of ocular inflammatory conditions |
| US11311510B2 (en) | 2011-06-30 | 2022-04-26 | Johnson & Johnson Vision Care, Inc. | Esters for treatment of ocular inflammatory conditions |
| US10588887B2 (en) | 2011-06-30 | 2020-03-17 | Johnson & Johnson Vision Care, Inc. | Esters for treatment of ocular inflammatory conditions |
| JP2014518261A (ja) * | 2011-06-30 | 2014-07-28 | ジョンソン・アンド・ジョンソン・ビジョン・ケア・インコーポレイテッド | 眼の炎症状態を治療するためのエステル |
| US12364679B2 (en) | 2011-06-30 | 2025-07-22 | Johnson & Johnson Vision Care, Inc. | Esters for treatment of ocular inflammatory conditions |
| US11096919B2 (en) | 2011-06-30 | 2021-08-24 | Johnson & Johnson Vision Care, Inc. | Esters for treatment of ocular inflammatory conditions |
| US9812730B2 (en) | 2011-08-02 | 2017-11-07 | Johnson & Johnson Vision Care, Inc. | Biocompatible wire battery |
| US10775644B2 (en) | 2012-01-26 | 2020-09-15 | Johnson & Johnson Vision Care, Inc. | Ophthalmic lens assembly having an integrated antenna structure |
| EP2974728A4 (en) * | 2013-03-13 | 2016-10-26 | Santen Pharmaceutical Co Ltd | THERAPEUTIC FOR MEXICO DRY SYNTHESIS |
| RU2709542C2 (ru) * | 2013-03-13 | 2019-12-18 | Сантен Фармасьютикал Ко., Лтд. | Терапевтическое средство против дисфункции мейбомиевых желез |
| CN105073112A (zh) * | 2013-03-13 | 2015-11-18 | 参天制药株式会社 | 睑板腺功能障碍的治疗剂 |
| US11951098B2 (en) | 2013-03-13 | 2024-04-09 | Santen Pharmaceutical Co., Ltd. | Therapeutic agent for meibomian dysfunction |
| KR20150126345A (ko) * | 2013-03-13 | 2015-11-11 | 산텐 세이야꾸 가부시키가이샤 | 마이봄 기능부전의 치료제 |
| US10799589B2 (en) | 2013-03-13 | 2020-10-13 | Buzzard Pharmaceuticals AB | Chimeric cytokine formulations for ocular delivery |
| US11612590B2 (en) | 2013-03-13 | 2023-03-28 | Santen Pharmaceutical Co., Ltd. | Therapeutic agent for meibomian dysfunction |
| EP3689348A1 (en) * | 2013-03-13 | 2020-08-05 | Santen Pharmaceutical Co., Ltd. | Therapeutic agent for meibomian gland dysfunction |
| CN105073112B (zh) * | 2013-03-13 | 2017-12-29 | 参天制药株式会社 | 睑板腺功能障碍的治疗剂 |
| US10386656B2 (en) | 2014-08-21 | 2019-08-20 | Johnson & Johnson Vision Care, Inc. | Methods and apparatus to form separators for biocompatible energization elements for biomedical devices |
| US10374216B2 (en) | 2014-08-21 | 2019-08-06 | Johnson & Johnson Vision Care, Inc. | Pellet form cathode for use in a biocompatible battery |
| US10558062B2 (en) | 2014-08-21 | 2020-02-11 | Johnson & Johnson Vision Care, Inc. | Methods and apparatus to form biocompatible energization primary elements for biomedical device |
| US10361404B2 (en) | 2014-08-21 | 2019-07-23 | Johnson & Johnson Vision Care, Inc. | Anodes for use in biocompatible energization elements |
| US10598958B2 (en) | 2014-08-21 | 2020-03-24 | Johnson & Johnson Vision Care, Inc. | Device and methods for sealing and encapsulation for biocompatible energization elements |
| US10367233B2 (en) | 2014-08-21 | 2019-07-30 | Johnson & Johnson Vision Care, Inc. | Biomedical energization elements with polymer electrolytes and cavity structures |
| US10627651B2 (en) | 2014-08-21 | 2020-04-21 | Johnson & Johnson Vision Care, Inc. | Methods and apparatus to form biocompatible energization primary elements for biomedical devices with electroless sealing layers |
| US10381687B2 (en) | 2014-08-21 | 2019-08-13 | Johnson & Johnson Vision Care, Inc. | Methods of forming biocompatible rechargable energization elements for biomedical devices |
| US10361405B2 (en) | 2014-08-21 | 2019-07-23 | Johnson & Johnson Vision Care, Inc. | Biomedical energization elements with polymer electrolytes |
| US12599664B2 (en) | 2014-12-22 | 2026-04-14 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| US12485173B2 (en) | 2014-12-22 | 2025-12-02 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| US12296008B2 (en) | 2014-12-22 | 2025-05-13 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| US12485172B2 (en) | 2014-12-22 | 2025-12-02 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| US12544438B2 (en) | 2014-12-22 | 2026-02-10 | Novartis Ag | Pharmaceutical products and stable liquid compositions of IL-17 antibodies |
| KR20170142185A (ko) * | 2015-04-28 | 2017-12-27 | 스위디쉬 오르펀 바이오비트럼 에이비 (피유비엘) | 아나킨라를 포함하는 조성물 |
| US11324807B2 (en) | 2015-04-28 | 2022-05-10 | Swedish Orphan Biovitrum Ab (Publ) | Compositions comprising anakinra |
| KR102582560B1 (ko) * | 2015-04-28 | 2023-09-26 | 스위디쉬 오르펀 바이오비트럼 에이비 (피유비엘) | 아나킨라를 포함하는 조성물 |
| CN107645956B (zh) * | 2015-04-28 | 2021-07-20 | 瑞典孤儿比奥维特鲁姆有限公司 | 包含阿那白滞素的组合物 |
| WO2016174082A1 (en) | 2015-04-28 | 2016-11-03 | Swedish Orphan Biovitrum Ab (Publ) | Compositions comprising anakinra |
| AU2016256217B2 (en) * | 2015-04-28 | 2020-04-16 | Swedish Orphan Biovitrum Ab (Publ) | Compositions comprising anakinra |
| CN107645956A (zh) * | 2015-04-28 | 2018-01-30 | 瑞典孤儿比奥维特鲁姆有限公司 | 包含阿那白滞素的组合物 |
| US10345620B2 (en) | 2016-02-18 | 2019-07-09 | Johnson & Johnson Vision Care, Inc. | Methods and apparatus to form biocompatible energization elements incorporating fuel cells for biomedical devices |
| CN105833234A (zh) * | 2016-05-20 | 2016-08-10 | 刘传彬 | 一种纯天然加热外敷治疗筋骨伤痛的中药组合物 |
| US12303527B2 (en) | 2018-04-18 | 2025-05-20 | i.com medical GmbH | High molecular weight hyaluronic acid for treatment and prevention of severe ocular surface disease |
| US12268706B2 (en) | 2019-01-31 | 2025-04-08 | i.com medical GmbH | Hyaluronic acid for relief of idiopathic ocular pain |
| CN110437043A (zh) * | 2019-08-24 | 2019-11-12 | 黄泳华 | 由白藜芦醇与前列腺素类似物剂构成的共晶及其在制备抗肿瘤药物中的用途 |
| US11596641B2 (en) | 2020-03-24 | 2023-03-07 | Hovione Scientia Limited | Methods and compositions for treating meibomian gland dysfunction |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2187900A2 (en) | 2010-05-26 |
| US10105441B2 (en) | 2018-10-23 |
| WO2009025763A3 (en) | 2009-04-23 |
| EP2187900A4 (en) | 2011-08-17 |
| JP2011516400A (ja) | 2011-05-26 |
| US20100203103A1 (en) | 2010-08-12 |
| AU2008289552B2 (en) | 2014-10-09 |
| JP2016065089A (ja) | 2016-04-28 |
| AU2008289552A1 (en) | 2009-02-26 |
| EP2187900B1 (en) | 2016-11-09 |
| JP5894364B2 (ja) | 2016-03-30 |
| US20130273065A1 (en) | 2013-10-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10105441B2 (en) | Method for inhibiting or reducing dry eye disease by IL-1Ra | |
| JP2011516400A5 (https=) | ||
| EP2242504B1 (en) | Therapeutic compositions for treatment of ocular inflammatory disorders | |
| AU2010203425B2 (en) | Therapeutic compositions for treatment of corneal disorders | |
| Costa et al. | Wound healing modulation in glaucoma filtration surgery | |
| Colligris et al. | Recent developments on dry eye disease treatment compounds | |
| WO2011106697A1 (en) | Therapeutic compositions for the treatment of dry eye disease | |
| US20120014970A1 (en) | Therapeutic Compositions for Treatment of Corneal Disorders | |
| AU2014227534B2 (en) | Therapeutic compositions for treatment of inflammation of ocular and adnexal tissues | |
| CA2640986C (en) | Therapeutic compositions for treatment of inflammation of ocular and adnexal tissues | |
| CN114206849B (zh) | 用于治疗非感染性眼部免疫炎性病症的治疗方法 | |
| US11306140B2 (en) | Therapeutics for ocular immunoinflammatory diseases | |
| EP3634416B1 (en) | Methods and compositions for reducing corneal endothelial cell loss |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 2640986 Country of ref document: CA |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 08795360 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2010521046 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008289552 Country of ref document: AU |
|
| REEP | Request for entry into the european phase |
Ref document number: 2008795360 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008795360 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2008289552 Country of ref document: AU Date of ref document: 20080815 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12298380 Country of ref document: US |