WO2008157726A1 - Boron-containing small molecules - Google Patents

Boron-containing small molecules Download PDF

Info

Publication number
WO2008157726A1
WO2008157726A1 PCT/US2008/067550 US2008067550W WO2008157726A1 WO 2008157726 A1 WO2008157726 A1 WO 2008157726A1 US 2008067550 W US2008067550 W US 2008067550W WO 2008157726 A1 WO2008157726 A1 WO 2008157726A1
Authority
WO
WIPO (PCT)
Prior art keywords
compound
substituted
member selected
exemplary embodiment
unsubstituted
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2008/067550
Other languages
English (en)
French (fr)
Inventor
Stephen J. Baker
Vincent S. Hernandez
Rashmi Sharma
James A. Nieman
Tsutoma Akama
Yong-Kang Zhang
Jacob J. Plattner
Michael Richard Kevin Alley
Rajeshwar Singh
Yi Xia
Huchen Zhou
Rahim Mohammad
El Mehdi KERAMANE
Xiaosong Lu
Minh HA
James G. Phillips
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Anacor Pharmaceuticals LLC
Original Assignee
Anacor Pharmaceuticals LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=40156702&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2008157726(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to EA200901617A priority Critical patent/EA020530B1/ru
Priority to EP08825921.3A priority patent/EP2164331B1/en
Priority to DK08825921.3T priority patent/DK2164331T3/da
Priority to KR1020167009966A priority patent/KR101685656B1/ko
Priority to JP2010513416A priority patent/JP5530923B2/ja
Priority to CA2692135A priority patent/CA2692135C/en
Priority to CN200880101464.4A priority patent/CN101772302B/zh
Priority to BRPI0813450A priority patent/BRPI0813450B8/pt
Priority to MX2015007480A priority patent/MX347688B/es
Priority to KR1020157021997A priority patent/KR20150100945A/ko
Priority to ES08825921.3T priority patent/ES2655299T3/es
Priority to AU2008265630A priority patent/AU2008265630B2/en
Application filed by Anacor Pharmaceuticals LLC filed Critical Anacor Pharmaceuticals LLC
Priority to NZ582706A priority patent/NZ582706A/en
Priority to NO08825921A priority patent/NO2164331T3/no
Publication of WO2008157726A1 publication Critical patent/WO2008157726A1/en
Priority to IL202379A priority patent/IL202379A/en
Priority to ZA2009/09003A priority patent/ZA200909003B/en
Anticipated expiration legal-status Critical
Priority to MA32517A priority patent/MA31675B1/fr
Priority to US12/848,051 priority patent/US8895534B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07FACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
    • C07F5/00Compounds containing elements of Groups 3 or 13 of the Periodic Table
    • C07F5/02Boron compounds
    • C07F5/025Boronic and borinic acid compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/69Boron compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/02Drugs for disorders of the urinary system of urine or of the urinary tract, e.g. urine acidifiers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/02Local antiseptics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10Antimycotics
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • oxaboroles useful as antimicrobials have been described previously, such as in U.S. Pat. Pubs. US20060234981 and US20070155699.
  • an oxaborole has the following structure and substituent numbering system:
  • This invention provides, among other things, novel compounds useful for treating bacterial infections, pharmaceutical compositions containing such compounds, as well as combinations of these compounds with at least one additional therapeutically effective agent.
  • FIG. 1 displays MIC data for representative compounds of the invention.
  • FIG. 2 displays IC50 data for representative compounds of the invention.
  • Compound of the invention refers to the compounds discussed herein, salts (e.g. pharmaceutically acceptable salts), prodrugs, solvates and hydrates of these compounds.
  • MIC or minimum inhibitory concentration
  • MIC is the point where the compound stops more than 50% of cell growth, preferably 60% of cell growth, preferably 70% of cell growth, preferably 80% of cell growth, preferably 90% of cell growth, relative to an untreated control.
  • substituent groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents, which would result from writing the structure from right to left, e.g., -CH 2 O- is intended to also recite -OCH 2 -.
  • poly as used herein means at least 2.
  • a polyvalent metal ion is a metal ion having a valency of at least 2.
  • Moiety refers to a radical of a molecule that is attached to the remainder of the molecule.
  • V ⁇ /V P indicates the point at which the displayed moiety is attached to the remainder of the molecule.
  • alkyl by itself or as part of another substituent, means, unless otherwise stated, a straight or branched chain, or cyclic hydrocarbon radical, or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals, having the number of carbon atoms designated (i.e. Ci-Cio means one to ten carbons).
  • the term “alkyl” means a straight or branched chain, or combinations thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals.
  • saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, cyclohexyl,
  • cyclohexyl (cyclohexyl)methyl, cyclopropylmethyl, homologs and isomers of, for example, n- pentyl, n-hexyl, n-heptyl, n-octyl, and the like.
  • An unsaturated alkyl group is one having one or more double bonds or triple bonds.
  • unsaturated alkyl groups include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2- (butadienyl), 2,4-pentadienyl, 3-(l,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3- butynyl, and the higher homologs and isomers.
  • alkylene by itself or as part of another substituent means a divalent radical derived from an alkane, as exemplified, but not limited, by - CH 2 CH 2 CH 2 CH 2 -, and further includes those groups described below as “heteroalkylene.”
  • an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being preferred in the present invention.
  • a “lower alkyl” or “lower alkylene” is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms.
  • alkoxy alkylamino and “alkylthio” (or thioalkoxy) are used in their conventional sense, and refer to those alkyl groups attached to the remainder of the molecule via an oxygen atom, an amino group, or a sulfur atom, respectively.
  • heteroalkyl by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or cyclic hydrocarbon radical, or combinations thereof, consisting of the stated number of carbon atoms and at least one heteroatom.
  • the term “heteroalkyl,” by itself or in combination with another term means a stable straight or branched chain, or combinations thereof, consisting of the stated number of carbon atoms and at least one heteroatom.
  • the heteroatoms can be selected from the group consisting of B, O, N and S, and wherein the nitrogen and sulfur atoms may optionally be oxidized and the nitrogen heteroatom may optionally be quaternized.
  • the heteroatom(s) B, O, N and S may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule.
  • heteroalkylene by itself or as part of another substituent means a divalent radical derived from heteroalkyl, as exemplified, but not limited by, -CH 2 -CH 2 -S-CH 2 -CH 2 - and -CH 2 -S-CH 2 -CH 2 -NH-CH 2 -.
  • heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like).
  • cycloalkyl and “heterocycloalkyl”, by themselves or in combination with other terms, represent, unless otherwise stated, cyclic versions of “alkyl” and “heteroalkyl”, respectively. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. Examples of cycloalkyl include, but are not limited to, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3-cyclohexenyl, cycloheptyl, and the like.
  • heterocycloalkyl examples include, but are not limited to, 1 -(1,2,5,6- tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4-morpholinyl, 3- morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl, tetrahydrothien-3-yl, 1 -piperazinyl, 2-piperazinyl, and the like.
  • halo or halogen
  • haloalkyl by themselves or as part of another substituent, mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom.
  • terms such as “haloalkyl,” are meant to include monohaloalkyl and polyhaloalkyl.
  • halo(Ci-C 4 )alkyl is mean to include, but not be limited to, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.
  • aryl means, unless otherwise stated, a polyunsaturated, aromatic, substituent that can be a single ring or multiple rings (preferably from 1 to 3 rings), which are fused together or linked covalently.
  • heteroaryl refers to aryl groups (or rings) that contain from one to four heteroatoms.
  • the heteroatom is selected from B, N, O, and S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized.
  • a heteroaryl group can be attached to the remainder of the molecule through a heteroatom.
  • Non- limiting examples of aryl and heteroaryl groups include phenyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3- pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4- oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2- pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-
  • aryl when used in combination with other terms (e.g. , aryloxy, arylthioxy, arylalkyl) includes those radicals in which an aryl group is attached through the next moiety to the rest of the molecule.
  • arylalkyl is meant to include those radicals in which an aryl group is attached to an alkyl group (e.g., benzyl, l-(3-nitrophenyl)ethyl and the like).
  • a substituent such as benzyl or l-(3-nitrophenyl)ethyl can also be represented by 'substituted alkyl' wherein the ethyl radical is substituted with a 3-nitrophenyl moiety.
  • aryloxy is meant to include those radicals in which an aryl group is attached to an oxygen atom.
  • aryloxyalkyl is meant to include those radicals in which an aryl group is attached to an oxygen atom which is then attached to an alkyl group (e.g., phenoxymethyl, 3-(l-naphthyloxy)propyl, and the like).
  • heteroaryl when used in combination with other terms (e.g., hetero aryloxy, heteroarylthioxy, heteroarylalkyl) includes those radicals in which a heteroaryl group is attached through the next moiety to the rest of the molecule.
  • heteroarylalkyl is meant to include those radicals in which a heteroaryl group is attached to an alkyl group (e.g., pyridylmethyl and the like).
  • heteroaryloxy is meant to include those radicals in which a heteroaryl group is attached to an oxygen atom.
  • heteroaryloxyalkyl is meant to include those radicals in which an aryl group is attached to an oxygen atom which is then attached to an alkyl group, (e.g., 2-pyridyloxymethyl and the like).
  • R', R", R'", R"" and R'" each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, e.g. , aryl substituted with 1-3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups.
  • each of the R groups is independently selected as are each R', R", R'", R"" and R'"" groups when more than one of these groups is present.
  • R' and R" When R' and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring.
  • -NR'R is meant to include, but not be limited to, 1-pyrrolidinyl and 4-morpholinyl.
  • alkyl is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (e.g., -CF 3 and -CH 2 CF 3 ) and acyl (e.g., - C(O)CH 3 , -C(O)CF 3 , -C(O)CH 2 OCH 3 , and the like).
  • haloalkyl e.g., -CF 3 and -CH 2 CF 3
  • acyl e.g., - C(O)CH 3 , -C(O)CF 3 , -C(O)CH 2 OCH 3 , and the like.
  • substituents for the aryl and heteroaryl groups are generically referred to as "aryl group substituents.”
  • Two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula -T-C(O)-(CRR') q -U-, wherein T and U are independently -NR-, -O-, -CRR'- or a single bond, and q is an integer of from 0 to 3.
  • two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula - A-(CH 2 ) r -B-, wherein A and B are independently -CRR'-, -O-, -NR-, -S-, -S(O)-, -S(O) 2 -, -S(O) 2 NR'- or a single bond, and r is an integer of from 1 to 4.
  • One of the single bonds of the new ring so formed may optionally be replaced with a double bond.
  • two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula - (CRR')s-X-(CR"R'")d-, where s and d are independently integers of from 0 to 3, and X is -O-, -NR'-, -S-, -S(O)-, -S(O) 2 -, or -S(O) 2 NR'-.
  • the substituents R, R', R" and R'" are preferably independently selected from hydrogen or substituted or unsubstituted (Ci-C 6 )alkyl.
  • Ring means a substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
  • a ring includes fused ring moieties. The number of atoms in a ring is typically defined by the number of members in the ring. For example, a "5- to 7-membered ring" means there are 5 to 7 atoms in the encircling arrangement. Unless otherwise specified, the ring optionally includes a heteroatom.
  • the term “5- to 7-membered ring” includes, for example phenyl, pyridinyl and piperidinyl.
  • the term “ring” further includes a ring system comprising more than one "ring”, wherein each "ring” is independently defined as above.
  • heteroatom includes atoms other than carbon (C) and hydrogen (H). Examples include oxygen (O), nitrogen (N) sulfur (S), silicon (Si), germanium (Ge), aluminum (Al) and boron (B).
  • leaving group means a functional group or atom which can be displaced by another functional group or atom in a substitution reaction, such as a nucleophilic substitution reaction.
  • representative leaving groups include triflate, chloro, bromo and iodo groups; sulfonic ester groups, such as mesylate, tosylate, brosylate, nosylate and the like; and acyloxy groups, such as acetoxy, trifluoroacetoxy and the like.
  • amino-protecting group means a protecting group suitable for preventing undesired reactions at an amino nitrogen.
  • Representative amino-protecting groups include, but are not limited to, formyl; acyl groups, for example alkanoyl groups, such as acetyl, trichloroacetyl or trifluoroacetyl; alkoxycarbonyl groups, such as tert-butoxycarbonyl (Boc); arylmethoxycarbonyl groups, such as benzyloxycarbonyl (Cbz) and 9-fluorenylmethoxycarbonyl (Fmoc); arylmethyl groups, such as benzyl (Bn), trityl (Tr), and l,l-di-(4'-methoxyphenyl)methyl; silyl groups, such as trimethylsilyl (TMS) and tert-butyldimethylsilyl (TBS); and the like.
  • hydroxy-protecting group means a protecting group suitable for preventing undesired reactions at a hydroxy group.
  • Representative hydroxy- protecting groups include, but are not limited to, alkyl groups, such as methyl, ethyl, and tert-butyl; acyl groups, for example alkanoyl groups, such as acetyl; arylmethyl groups, such as benzyl (Bn), p-methoxybenzyl (PMB), 9-fluorenylmethyl (Fm), and diphenylmethyl (benzhydryl, DPM); silyl groups, such as trimethylsilyl (TMS) and tert-butyldimethylsilyl (TBS); and the like.
  • alkyl groups such as methyl, ethyl, and tert-butyl
  • acyl groups for example alkanoyl groups, such as acetyl
  • arylmethyl groups such as benzyl (Bn), p-methoxy
  • R is a general abbreviation that represents a substituent group that is selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted cycloalkyl and substituted or unsubstituted heterocycloalkyl groups.
  • the term "derived from” includes its plain language meaning and also refers to a molecule that is 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 75%, 70%, 65%, or 60% homologous to a referenced molecule.
  • the molecules referred to in this definition include chains of RNA or DNA, oligonucleotides, polypeptides, or proteins of any length and composition.
  • noncognate is meant to encompass both the singular and plural forms of the word, i.e. the phrase “noncognate amino acid” comprises one or more amino acids.
  • an effective amount of a drug, formulation, or permeant is meant a sufficient amount of a active agent to provide the desired local or systemic effect.
  • a “Topically effective,” “Cosmetically effective,” “pharmaceutically effective,” or “therapeutically effective” amount refers to the amount of drug needed to effect the desired therapeutic result.
  • Topicically effective refers to a material that, when applied to the skin, nail, hair, claw or hoof produces a desired pharmacological result either locally at the place of application or systemically as a result of transdermal passage of an active ingredient in the material.
  • Cosmetically effective refers to a material that, when applied to the skin, nail, hair, claw or hoof, produces a desired cosmetic result locally at the place of application of an active ingredient in the material.
  • salts are meant to include salts of the compounds of the invention which are prepared with relatively nontoxic acids or bases, depending on the particular substituents found on the compounds described herein.
  • base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent.
  • pharmaceutically acceptable base addition salts include sodium, potassium, calcium, ammonium, organic amino, or magnesium salt, or a similar salt.
  • acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent.
  • Examples of pharmaceutically acceptable acid addition salts include those derived from inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric, dihydrogenphosphoric, sulfuric, monohydrogensulfuric, hydriodic, or phosphorous acids and the like, as well as the salts derived from relatively nontoxic organic acids like acetic, propionic, isobutyric, maleic, malonic, benzoic, succinic, suberic, fumaric, lactic, mandelic, phthalic, benzenesulfonic, p-tolylsulfonic, citric, tartaric, methanesulfonic, and the like.
  • inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric, dihydrogenphosphoric, sulfuric, monohydrogensulfuric, hydriodic, or phosphorous acids and
  • salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge et al., "Pharmaceutical Salts", Journal of Pharmaceutical Science 66: 1-19 (1977)).
  • Certain specific compounds of the present invention contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.
  • the neutral forms of the compounds are preferably regenerated by contacting the salt with a base or acid and isolating the parent compounds in the conventional manner.
  • the parent form of the compound differs from the various salt forms in certain physical properties, such as solubility in polar solvents.
  • the present invention provides compounds which are in a prodrug form.
  • Prodrugs of the compounds or complexes described herein readily undergo chemical changes under physiological conditions to provide the compounds of the present invention. Additionally, prodrugs can be converted to the compounds of the present invention by chemical or biochemical methods in an ex vivo environment.
  • Certain compounds of the present invention can exist in unsolvated forms as well as solvated forms, including hydrated forms. In general, the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present invention. Certain compounds of the present invention may exist in multiple crystalline or amorphous forms. In general, all physical forms are equivalent for the uses contemplated by the present invention and are intended to be within the scope of the present invention.
  • Certain compounds of the present invention possess asymmetric carbon atoms (optical centers) or double bonds; the racemates, diastereomers, geometric isomers and individual isomers are encompassed within the scope of the present invention.
  • the graphic representations of racemic, ambiscalemic and scalemic or enantiomerically pure compounds used herein are taken from Maehr, J. Chem. Ed. 1985, 62: 114-120. Solid and broken wedges are used to denote the absolute configuration of a stereocenter unless otherwise noted.
  • the compounds described herein contain olefmic double bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers. Likewise, all tautomeric forms are included.
  • Compounds of the invention can exist in particular geometric or stereoisomeric forms.
  • the invention contemplates all such compounds, including cis- and trans -isomers, (-)- and (+)-enantiomers, (R)- and (S)-enantiomers, diastereomers, (D)-isomers, (L)-isomers, the racemic mixtures thereof, and other mixtures thereof, such as enantiomerically or diastereomerically enriched mixtures, as falling within the scope of the invention.
  • Additional asymmetric carbon atoms can be present in a substituent such as an alkyl group. All such isomers, as well as mixtures thereof, are intended to be included in this invention.
  • Optically active (R)- and (5)-isomers and d and / isomers can be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques. If, for instance, a particular enantiomer of a compound of the present invention is desired, it can be prepared by asymmetric synthesis, or by derivatization with a chiral auxiliary, where the resulting diastereomeric mixture is separated and the auxiliary group cleaved to provide the pure desired enantiomers.
  • diastereomeric salts can be formed with an appropriate optically active acid or base, followed by resolution of the diastereomers thus formed by fractional crystallization or chromatographic means known in the art, and subsequent recovery of the pure enantiomers.
  • separation of enantiomers and diastereomers is frequently accomplished using chromatography employing chiral, stationary phases, optionally in combination with chemical derivatization (e.g., formation of carbamates from amines).
  • the compounds of the present invention may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds.
  • the compounds may be radiolabeled with radioactive isotopes, such as for example tritium ( 3 H), iodine- 125 ( 125 I) or carbon- 14 ( 14 C). All isotopic variations of the compounds of the present invention, whether radioactive or not, are intended to be encompassed within the scope of the present invention.
  • pharmaceutically acceptable carrier or “pharmaceutically acceptable vehicle” refers to any formulation or carrier medium that provides the appropriate delivery of an effective amount of an active agent as defined herein, does not interfere with the effectiveness of the biological activity of the active agent, and that is sufficiently non-toxic to the host or patient.
  • Representative carriers include water, oils, both vegetable and mineral, cream bases, lotion bases, ointment bases and the like. These bases include suspending agents, thickeners, penetration enhancers, and the like. Their formulation is well known to those in the art of cosmetics and topical pharmaceuticals. Additional information concerning carriers can be found in Remington: The Science and Practice of Pharmacy, 21st Ed., Lippincott, Williams & Wilkins (2005) which is incorporated herein by reference.
  • “Pharmaceutically acceptable topical carrier” and equivalent terms refer to pharmaceutically acceptable carriers, as described herein above, suitable for topical application.
  • An inactive liquid or cream vehicle capable of suspending or dissolving the active agent(s), and having the properties of being nontoxic and non-inflammatory when applied to the skin, nail, hair, claw or hoof is an example of a pharmaceutically- acceptable topical carrier. This term is specifically intended to encompass carrier materials approved for use in topical cosmetics as well.
  • compositions refers to preservatives, antioxidants, fragrances, emulsif ⁇ ers, dyes and excipients known or used in the field of drug formulation and that do not unduly interfere with the effectiveness of the biological activity of the active agent, and that is sufficiently non-toxic to the host or patient.
  • Additives for topical formulations are well-known in the art, and may be added to the topical composition, as long as they are pharmaceutically acceptable and not deleterious to the epithelial cells or their function. Further, they should not cause deterioration in the stability of the composition.
  • inert fillers for example, inert fillers, anti- irritants, tackifiers, excipients, fragrances, opacifiers, antioxidants, gelling agents, stabilizers, surfactant, emollients, coloring agents, preservatives, buffering agents, other permeation enhancers, and other conventional components of topical or transdermal delivery formulations as are known in the art.
  • the terms "enhancement,” “penetration enhancement” or “permeation enhancement” relate to an increase in the permeability of the skin, nail, hair, claw or hoof to a drug, so as to increase the rate at which the drug permeates through the skin, nail, hair, claw or hoof.
  • the enhanced permeation effected through the use of such enhancers can be observed, for example, by measuring the rate of diffusion of the drug through animal skin, nail, hair, claw or hoof using a diffusion cell apparatus.
  • a diffusion cell is described by Merritt et al. Diffusion Apparatus for Skin Penetration, J of Controlled Release, 1 (1984) pp. 161-162.
  • permeation enhancer or “penetration enhancer” intends an agent or a mixture of agents, which, alone or in combination, act to increase the permeability of the skin, nail, hair or hoof to a drug.
  • excipients is conventionally known to mean carriers, diluents and/or vehicles used in formulating drug compositions effective for the desired use.
  • Topical administration refers to the application of a pharmaceutical agent to the external surface of the skin, nail, hair, claw or hoof, such that the agent crosses the external surface of the skin, nail, hair, claw or hoof and enters the underlying tissues.
  • Topical administration includes application of the composition to intact skin, nail, hair, claw or hoof, or to a broken, raw or open wound of skin, nail, hair, claw or hoof.
  • Topical administration of a pharmaceutical agent can result in a limited distribution of the agent to the skin and surrounding tissues or, when the agent is removed from the treatment area by the bloodstream, can result in systemic distribution of the agent.
  • Transdermal delivery refers to the diffusion of an agent across the barrier of the skin, nail, hair, claw or hoof resulting from topical administration or other application of a composition.
  • stratum corneum acts as a barrier and few pharmaceutical agents are able to penetrate intact skin.
  • the epidermis and dermis are permeable to many solutes and absorption of drugs therefore occurs more readily through skin, nail, hair, claw or hoof that is abraded or otherwise stripped of the stratum corneum to expose the epidermis.
  • Transdermal delivery includes injection or other delivery through any portion of the skin, nail, hair, claw or hoof or mucous membrane and absorption or permeation through the remaining portion.
  • Absorption through intact skin, nail, hair, claw or hoof can be enhanced by placing the active agent in an appropriate pharmaceutically acceptable vehicle before application to the skin, nail, hair, claw or hoof.
  • Passive topical administration may consist of applying the active agent directly to the treatment site in combination with emollients or penetration enhancers.
  • transdermal delivery is intended to include delivery by permeation through or past the integument, i.e. skin, nail, hair, claw or hoof.
  • microbial infection or "infection by a microorganism” refers to any infection of a host tissue by an infectious agent including, but not limited to, viruses, bacteria, mycobacteria, fungus and parasites (see, e.g., Harrison's Principles of Internal Medicine, pp. 93-98 (Wilson et al, eds., 12th ed. 1991); Williams et al, J. of Medicinal Chem. 42:1481-1485 (1999), herein each incorporated by reference in their entirety).
  • Bio medium refers to both in vitro and in vivo biological milieus.
  • exemplary in vitro “biological media” include, but are not limited to, cell culture, tissue culture, homogenates, plasma and blood. In vivo applications are generally performed in mammals, preferably humans.
  • the enzyme is an editing domain of a tRNA synthetase.
  • a "human nail unit”, as defined herein, can be the nail plate, the nail bed, proximal nail fold, lateral nail fold and combinations thereof.
  • Dative bonds are usually weaker than covalent bonds.
  • a boron is covalently bonded to at least one oxygen or nitrogen, and is at the same time datively bonded to an oxygen or nitrogen, respectively, the dative bond and covalent bond between the boron and the two identical heteroatoms can interconvert or be in the form of a resonance hybrid.
  • the structures supplied are not intended to include any and all possible bonding scenarios between boron and the atom to which it is bound. Non limiting examples of these bonds are as follows:
  • the compounds comprising a boron bonded to a carbon and three heteroatoms can optionally contain a fully negatively charged boron or partially negatively charged boron, due to the nature of the dative bond between the boron and one of the oxygens. Due to the negative charge, a positively charged counterion may associate with this compound, thus forming a salt.
  • positively charged counterions include H + , H 3 O + , calcium, sodium, ammonium, potassium. The salts of these compounds are implicitly contained in descriptions of these compounds.
  • the present invention also encompasses compounds that are poly- or multi-valent species, including, for example, species such as dimers, trimers, tetramers and higher homo logs of the compounds of use in the invention or reactive analogues thereof.
  • dimers of (Al) can form under the following conditions:
  • dimers of (A46) can form under the following conditions:
  • the present invention also encompasses compounds that are anhydrides of the cyclic boronic esters are synthesized by subjecting these compounds to dehydrating conditions. Examples of these anhydrides are provided below:
  • trimers of the compounds of the invention are also produced.
  • trimers of acyclic boronic esters can be formed as follows:
  • trimers of acyclic boronic esters can be formed as follows:
  • Also of use in the present invention are compounds that are poly- or multivalent species, including, for example, species such as dimers, trimers, tetramers and higher homo logs of the compounds of use in the invention or reactive analogues thereof.
  • the poly- and multi-valent species can be assembled from a single species or more than one species of the invention.
  • a dimeric construct can be "homo-dimeric" or "heterodimeric.”
  • poly- and multi-valent constructs in which a compound of the invention or a reactive analogue thereof, is attached to an oligomeric or polymeric framework e.g., polylysine, dextran, hydroxyethyl starch and the like
  • the framework is preferably polyfunctional (i.e. having an array of reactive sites for attaching compounds of use in the invention).
  • the framework can be derivatized with a single species of the invention or more than one species of the invention.
  • the present invention includes the use of compounds within the motif set forth in the formulae contained herein, which are functionalized to afford compounds having water-solubility that is enhanced relative to analogous compounds that are not similarly functionalized.
  • any of the substituents set forth herein can be replaced with analogous radicals that have enhanced water solubility.
  • additional water solubility is imparted by substitution at a site not essential for the activity towards the editing domain of the compounds set forth herein with a moiety that enhances the water solubility of the parent compounds.
  • Methods of enhancing the water-solubility of organic compounds are known in the art. Such methods include, but are not limited to, functionalizing an organic nucleus with a permanently charged moiety, e.g., quaternary ammonium, or a group that is charged at a physiologically relevant pH, e.g. carboxylic acid, amine.
  • Other methods include, appending to the organic nucleus hydroxyl- or amine- containing groups, e.g. alcohols, polyols, polyethers, and the like.
  • Representative examples include, but are not limited to, polylysine, polyethyleneimine, poly(ethyleneglycol) and poly(propyleneglycol).
  • Suitable functionalization chemistries and strategies for these compounds are known in the art. See, for example, Dunn, R. L., et al, Eds. POLYMERIC DRUGS AND DRUG DELIVERY SYSTEMS, ACS Symposium Series Vol. 469, American Chemical Society, Washington, D.C. 1991.
  • the compound of the invention has a structure which is a member selected from:
  • R z , R y , R x and R w are members independently selected from a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • R* is a member selected from H and a negative charge.
  • R* is as described herein, R z is H and R y is a member selected from substituted or unsubstituted aminoalkyl, substituted or unsubstituted hydroxyalkyl, substituted or unsubstituted carboxyalkyl.
  • the compound has a structure which is
  • the compound has a structure which is a member selected from:
  • R* is as described herein.
  • the compound has a structure:
  • R* is H.
  • the invention provides a compound having a structure according to the formula:
  • R* is a member selected from H and a negative charge.
  • R 3 is a member selected from H, cyano, substituted or unsubstituted nitroalkyl and substituted or unsubstituted aminoalkyl.
  • R a is a member selected from H and -YR 5 wherein Y is a member selected from O and S.
  • R 5 is a member independently selected from H, substituted or unsubstituted alkyl and substituted or unsubstituted heteroalkyl; with the proviso that R a and R 3 cannot both be H; with the proviso that R a and R*, together with the atoms to which they are attached, are optionally combined to form a 6- to 10- membered substituted or unsubstituted heterocycloalkyl ring, or a salt, prodrug, hydrate or solvate thereof, or a combination thereof.
  • the invention provides a compound of the invention, or a salt, prodrug, hydrate or solvate thereof.
  • R 3 there is a proviso that when R 3 is H, R a does not have a structure which is a member selected from: unsubstituted benzyloxy, - OCH 2 COOH, methoxy, ethoxy.
  • R a there is a proviso that when R 3 is H, R a is not substituted benzyloxy.
  • R a there is a proviso that when R is H, R a is not unsubstituted alkyloxy.
  • R a there is a proviso that when R 3 is H, R a is not substituted unsubstituted alkylthio.
  • the compound has a structure according to the following formula:
  • R a , R* and R are as described herein, and C* is a carbon atom, and with the proviso that when R 3 is not H, C* is a stereocenter which has a configuration which is a member selected from (R) and (S).
  • Y is O. In an exemplary embodiment, Y is
  • the invention provides a compound having a structure according to the formula which is a member selected from:
  • R* is a member selected from H and a negative charge.
  • R q is a member selected from H and -S ⁇ 2-R b .
  • R b is a member selected from unsubstituted phenyl and unsubstituted pyridinyl.
  • R 3 is a member selected from H, cyano, substituted or unsubstituted nitroalkyl and substituted or unsubstituted aminoalkyl.
  • the compound has a structure according to the following formula:
  • R a , R* and R 3 are as described herein, and C* is a carbon atom, and with the proviso that when R 3 is not H, C* is a stereocenter which has a configuration which is a member selected from (R) and (S).
  • R 3 is a member selected from H, -CH 2 NH 2 and -CH 2 NO 2 .
  • the invention has the following structure:
  • R 3 is-(CR 20 R 21 ⁇ NR 22 R 23 in which the index n is an integer selected from 1 to 10; each R 20 and each R 21 is a member independently selected from H, R 26 ,OR 26 , NR 26 R 27 , SR 26 , -S(O)R 26 , -S(O) 2 R 26 , - S(O) 2 NR 26 R 27 , -C(O)R 27 , -C(O)OR 27 , -C(O)NR 26 R 27 ; R 22 and R 23 are members independently selected from H, -S(O)R 28 , -S(O) 2 R 28 , -S(O) 2 NR 28 R 29 , -C(O)R 28 , - C(O)OR 28 , -C(O)NR 28 R 29 , nitro, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl
  • n is an integer selected from 1 to 5. In an exemplary embodiment, n is 1.
  • R 20 is substituted or unsubstituted alkyl. In an exemplary embodiment, R 20 is unsubstituted alkyl. In an exemplary embodiment, R 20 is C 1 -C 4 unsubstituted alkyl. In an exemplary embodiment, R 20 is methyl.
  • R 21 is H. In an exemplary embodiment, R 23 is H.
  • R 3 is a member selected from cyano and -CH 2 NO 2 . In an exemplary embodiment, R is a member selected from -C(O)R and -C(O)OR .
  • R 28 is a member selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl and substituted or unsubstituted aryl.
  • R 28 is a member selected from -(CR 30 R 31 ⁇ R 32 , wherein R 32 is a member selected from substituted or unsubstituted aryl, -NR 33 R 34 and OR 33 , wherein the index m is an integer selected from O to 10; each R 33 and each R 34 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • R 28 is a member selected from substituted or unsubstituted alky
  • R is
  • index a is a member selected from 1 to 10.
  • Each R 10 and each R 11 is a member selected from H, substituted or unsubstituted alkyl, OH and NH 2 .
  • R 12 is a member selected from H, R 7 , halogen, cyano, amidino, OR 7 , NR 7 R 8 , SR 7 , - N(R 7 )S(O) 2 R 8 , -C(O)R 7 , -C(O)OR 7 , -C(O)NR 7 R 8 .
  • Each R 7 and each R 8 is a member independently selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • the index a is an integer selected from 1 to 8.
  • the index a is an integer selected from 2 to 4.
  • each R 10 and each R 11 is a member selected from H, substituted or unsubstituted alkyl, OH and NH 2 .
  • each R 10 and each R 11 is a member selected from H, hydroxyalkyl and NH 2 . In an exemplary embodiment, at least one R 10 or R 11 is a member selected from hydroxyalkyl and NH 2 . In an exemplary embodiment, each R 10 and each R 11 is H.
  • R 12 is a member selected from H, cyano, amidino, - N(R 7 )S(O) 2 R 8 , OR 7 , NR 7 R 8 , -C(O)OR 7 , -C(O)NR 7 R 8 , each R 7 and each R 8 is a member independently selected from H substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • each R 7 and each R 8 is a member independently selected from H, -C(O)R 9 , -C(O)NHR 9 , substituted or unsubstituted C1-C4 alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl, wherein R 9 is substituted or unsubstituted Ci-C 4 alkyl.
  • At least one member selected from R 7 and R 8 is a member independently selected from -C(O)R 9 and -C(O)NHR 9 , wherein R 9 is substituted or unsubstituted Ci-C 4 alkyl.
  • R 12 is a member selected from OH, NH 2 , methyl, ethyl, - NHS(O) 2 CH 3 , cyano, -NHC(O)CH 3 , -NHC(O)NHCH 2 CH 3 , -C(O)NH 2 , -C(O)OH, 4- (methoxy)phenyl, benzyl, -NHC(O)OCH 2 Ph, -C(O)NHCH 2 CH 2 OH and - C(NH 2 )(NH).
  • R 12 comprises OR 7
  • the R 7 comprises a hydroxy-protecting group
  • R 12 comprises NR 7 R 8
  • at least one of the R 7 or R 8 comprises an amino -protecting group.
  • the compound has a structure which is a member selected from:
  • index a is an integer selected from 1 to 20 and R is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • the index a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R* is H
  • R f is H and a is an integer selected from 2, 3 and 4.
  • the compound has a structure which is a member selected from:
  • a is an integer selected from 1 to 20 and R f is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R* is H
  • R f is H and a is an integer selected from 2, 3 and 4.
  • the compound has a structure according to
  • R* is as described herein and R x is a member selected from substituted or unsubstituted aminoalkyl, substituted or unsubstituted hydroxyalkyl, substituted or unsubstituted carboxyalkyl.
  • R x is a member selected from substituted or unsubstituted alkyl and substituted or unsubstituted heteroalkyl.
  • R x is substituted or unsubstituted hydroxyalkyl.
  • the compound is:
  • the compound has a structure which is a member selected from:
  • a is an integer selected from 1 to 20 and R f is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R* is H, R is H and a is an integer selected from 2, 3 and 4.
  • the compound has a structure which is a member selected from:
  • a is an integer selected from 1 to 20 and R f is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R* is H, R is H and a is an integer selected from 2, 3 and 4.
  • the compound has a structure according to
  • R* is as described herein and R w is a member selected from substituted or unsubstituted aminoalkyl, substituted or unsubstituted hydroxyalkyl, substituted or unsubstituted carboxyalkyl.
  • R w is a member selected from substituted or unsubstituted alkyl and substituted or unsubstituted heteroalkyl.
  • R w is substituted or unsubstituted hydroxyalkyl.
  • the compound has a structure which is a member selected from:
  • a is an integer selected from 1 to 20 and R f is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R* is H
  • R f is H and a is an integer selected from 2, 3 and 4.
  • the compound has a structure which is a member selected from:
  • a is an integer selected from 1 to 20 and R f is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R* is H
  • R f is H and a is an integer selected from 2, 3 and 4.
  • the compound has a structure which is a member selected from:
  • R z , R y , R x and R w are members independently selected from substituted or unsubstituted alkyl and substituted or unsubstituted heteroalkyl.
  • R* and R 3 are as described herein.
  • the compound has a structure which is a member selected from:
  • R* is as defined herein, and R x and R w are members independently selected from a member selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • R x and R w are members independently selected from substituted or unsubstituted alkyl and substituted or unsubstituted heteroalkyl.
  • R x and R w are members independently selected from substituted or unsubstituted hydroxyalkyl.
  • the compound is:
  • R* is as defined herein.
  • the compound of the invention has a structure which is a member selected from:
  • R* is as defined herein, R is substituted or unsubstituted aminoalkyl;
  • R z , R y , R x and R w are members independently selected from a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • the compound of the invention has a structure which is a member selected from
  • R* is as defined herein
  • b is an integer selected from 1 to 20 and R z , R y , R x , R w , R J and R k is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • b is a member selected from 1 to 10.
  • b is a member selected from 1 to 5.
  • b is 1, R J and R k is H.
  • at least one member selected from R J and R k is an amino protecting group.
  • the compound has the following structure:
  • R*, b, R J and R k are as described herein, R z and R y are each members independently selected from substituted or unsubstituted aminoalkyl, substituted or unsubstituted hydroxyalkyl, substituted or unsubstituted carboxyalkyl.
  • b is 1
  • R J and R k is H.
  • at least one member selected from R J and R k is an amino protecting group.
  • the compound has a structure which is a member selected from RJ ⁇ R k k and RJ ⁇ R k k wherein R* is as described herein, R y is H and R z is a member selected from substituted or unsubstituted aminoalkyl, substituted or unsubstituted hydroxyalkyl, substituted or unsubstituted carboxyalkyl.
  • R y is H
  • R z is a member selected from substituted or unsubstituted aminoalkyl, substituted or unsubstituted hydroxyalkyl, substituted or unsubstituted carboxyalkyl.
  • b is 1, R J and R k is H.
  • the compound has the following structure:
  • the compound has a structure which is a member selected from:
  • the compound has a structure which is a member selected from:
  • the compound has a structure which is a member selected from: wherein R* is as defined herein, a is an integer selected from 1 to 20 and R is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • the index a is a member selected from 1 to 10.
  • the index a is a member selected from 1 to 5.
  • the compound is a member selected from a member selected from
  • R* is as defined herein.
  • the compound is a member selected from
  • R* is as defined herein.
  • the compound has a structure which is a member selected from:
  • the compound has a structure which is a member selected from:
  • R* is as described herein, a is an integer selected from 1 to 20 and R f is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R* is H
  • R f is H and a is an integer selected from 2, 3 and 4.
  • the compound has a structure which is a member selected from:
  • the compound has a structure which is a member selected from:
  • the compound has a structure which is a member selected from:
  • the compound has a structure which is a member selected from
  • RJ R k wherein R*, b, R x , R J and R k are as defined herein.
  • at least one member selected from R J and R k is an amino protecting group.
  • the compound has a structure which is a member selected from wherein R*, b, R x , R J and R k are as defined herein and R x is a member selected from substituted or unsubstituted aminoalkyl, substituted or unsubstituted hydroxyalkyl, substituted or unsubstituted carboxyalkyl.
  • the compound has a structure which is a member selected from:
  • R*, R and a are as defined herein.
  • the compound has a structure which is a member selected from:
  • R* is as described herein, a is an integer selected from 1 to 20 and R is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R* is H
  • R f is H and a is an integer selected from 2, 3 and 4.
  • the compound has a structure which is a member selected from:
  • the compound has a structure which is a member selected from:
  • R* is as described herein, and a is an integer selected from 1 to 20 and R f is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R 1 is H
  • R f is H and a is an integer selected from 2, 3 and 4.
  • the compound has the following structure:
  • R 7 is a member selected from H and a hydroxyl protecting group and R J and R k are members independently selected from H and an amino protecting group.
  • at least one member selected from R J and R k is an amino protecting group.
  • a is a member selected from 2, 3, and 4.
  • the compound has the following structure:
  • R 7 is a member selected from H and a hydroxyl protecting group and R J and R k are members independently selected from H and an amino protecting group.
  • R J and R k are members independently selected from H and an amino protecting group.
  • at least one member selected from R J and R k is an amino protecting group.
  • the index a is a member selected from 2, 3, and 4.
  • the compound is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N
  • R* is as described herein.
  • R* is H.
  • the compound is H 2 s wherein R* is as described herein.
  • R* is H.
  • the compound has the following structure:
  • R*, b, R w , R J and R k are as defined herein.
  • at least one member selected from R J and R k is an amino protecting group.
  • the compound has a structure which is a member selected from:
  • R*, b, R J and R k are as described herein and R w is a member selected from substituted or unsubstituted aminoalkyl, substituted or unsubstituted hydroxyalkyl, substituted or unsubstituted carboxyalkyl.
  • the compound has a structure which is a member selected from:
  • the compound has a structure which is a member selected from:
  • R* is as described herein, a is an integer selected from 1 to 20 and R is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R* is H
  • R f is H and a is an integer selected from 2, 3 and 4.
  • the compound has a structure which is a member selected from:
  • the compound has a structure which is a member selected from:
  • R* is as described herein, a is an integer selected from 1 to 20 and R f is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • a is a member selected from 1 to 10.
  • a is a member selected from 1 to 5.
  • R* is H
  • R f is H and a is an integer selected from 2, 3 and 4.
  • the compound has the following structure:
  • R J and R k are members independently selected from H and an amino protecting group.
  • at least one member selected from R J and R k is an amino protecting group.
  • the compound has the following structure: , wherein R* is as defined herein, and R J and R are members independently selected from H and an amino protecting group. In an exemplary embodiment, at least one member selected from R J and R k is an amino protecting group.
  • the compound has the following structure:
  • R* is as described herein.
  • R* is H.
  • the compound has the following structure:
  • R* is as described herein. In another exemplary embodiment, R* is H.
  • the compound has a structure which is a member selected from:
  • R* is as described herein, R 3 is substituted or unsubstituted aminoalkyl;
  • R z , R y , R x and R w are members independently selected from a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • the compound has a structure which is a member selected from:
  • R x and R w are members independently selected from a member selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • R x and R w are members independently selected from substituted or unsubstituted alkyl and substituted or unsubstituted heteroalkyl.
  • R x and R w are members independently selected from substituted or unsubstituted hydroxyalkyl.
  • the compound has a structure which is a member selected from:
  • R 3 is a member selected from H, -CH 2 NH 2 and -CH 2 NO 2 ; and R 12 is a member selected from OH, NH 2 , methyl, ethyl, - NHS(O) 2 CH 3 , cyano, -NHC(O)CH 3 , -NHC(O)NHCH 2 CH 3 , -C(O)NH 2 , -C(O)OH, 4- (trifluoromethyl)phenyl, 4-(methoxy)phenyl, benzyl, -NHC(O)OCH 2 Ph, - C(O)NHCH 2 CH 2 OH and -C(NH 2 )(NH).
  • R 3 is a member selected from H, -CH 2 NH 2 and -CH 2 NO 2 ; and R a is a member selected from H, -O(CH 2 ) 3 NH 2 , -O(CH 2 ) 3 OH, -OCH 2 CH 3 , -O(CH 2 ) 3 NHS(O) 2 CH 3 , -O(CH 2 ) 3 CN, - O(CH 2 ) 3 NHC(O)CH 3 , -O(CH 2 ) 3 NHCH 3 , -O(CH 2 ) 3 OCH 3 , -O(CH 2 ) 4 OH, -OCH 3 , - O(CH 2 ) 3 NHC(O)NHCH 2 CH 3 , -O(CH 2 ) 3 C(O)NH 2 , -O(CH 2 ) 3 C(O)OH, - C(O)NHCH 2 Ph(4-CF 3 ), -O(CH 2 ) 4
  • R a is a member selected from -O(CH 2 ) 3 NH 2 , -O(CH 2 ) 3 NHS(O) 2 CH 3 , -O(CH 2 ) 3 CN, -O(CH 2 ) 3 NHC(O)CH 3 , - O(CH 2 ) 3 NHCH 3 , -O(CH 2 ) 4 OH, -O(CH 2 ) 3 NHC(O)NHCH 2 CH 3 , -O(CH 2 ) 3 C(O)NH 2 , - O(CH 2 ) 3 C(O)OH, -O(CH 2 ) 4 NH 2 , -O(CH 2 ) 2 NH 2 , -OCH 2 CH 2 CH(NH 2 )CH 2 OH, - OCH 2 Ph(4-methoxy), -O(CH 2 ) 4 OCH 2 Ph, -OCH 2 C(O)NH(CH 2 )
  • R a is a member selected from H, -O(CH 2 ) 3 OH, -OCH 2 CH 3 , -O(CH 2 ) 3 OCH 3 , -OCH 3 , - O(CH 2 ) 4 NH 2 , -O(CH 2 ) 3 NHS(O) 2 CH 3 , -O(CH 2 ) 3 NHC(O)OCH 2 Ph, - O(CH 2 ) 3 NHC(O)CH 3 , -O(CH 2 ) 3 NH 2 .
  • R a is a member selected from -O(CH 2 ) 3 CN and -OCH 2 CH 3 .
  • R a is a member selected from -O(CH 2 ) 3 NH 2 , - O(CH 2 ) 3 NHS(O) 2 CH 3 , -O(CH 2 ) 3 CN, -O(CH 2 ) 3 NHC(O)CH 3 , -O(CH 2 ) 3 NHCH 3 , - O(CH 2 ) 4 OH, -O(CH 2 ) 3 NHC(O)NHCH 2 CH 3 , -O(CH 2 ) 3 C(O)NH 2 , -O(CH 2 ) 3 C(O)OH, - O(CH 2 ) 4 NH 2 , -O(CH 2 ) 2 NH 2 , -OCH 2 CH 2 CH(NH 2 )CH 2
  • R a when R is -CH 2 NH 2 , R a is a member selected from H, -O(CH 2 ) 3 OH, - OCH 2 CH 3 , -O(CH 2 ) 3 OCH 3 , -OCH 3 .
  • R a when R 3 is H, R a is a member selected from -O(CH 2 ) 3 NH 2 , -O(CH 2 ) 3 CN, -O(CH 2 ) 3 NHC(O)CH 3 , - O(CH 2 ) 3 NHCH 3 .
  • R a when R 3 is -CH 2 NH 2 , R a is a member selected from H, -O(CH 2 ) 3 OH and -OCH 2 CH 3 .
  • the compound is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N
  • R* is as described herein.
  • the compound is a member selected from
  • R* is as described herein.
  • the compound is a member selected from
  • R* is as described herein.
  • the compound is a member selected from
  • R* is as described herein.
  • the compound is a member selected from
  • R* is as described herein.
  • the compound is a member selected from wherein R* is as described herein.
  • the compound is a member selected from
  • R* is as described herein.
  • R* is H.
  • the C* stereocenter is in a configuration which is a member selected from (R) and (S).
  • the C* stereocenter is in a (S) configuration.
  • the C* stereocenter is in a (S) configuration and R 3 is - CH 2 NH 2 .
  • the C* stereocenter is in a (S) configuration, R 3 is -CH 2 NH 2 and R a is a member selected from H and -O(CH 2 ) 3 OH.
  • the invention provides a compound described herein, or a salt, hydrate or solvate thereof, or a combination thereof.
  • the invention provides a compound described herein, or a salt, hydrate or solvate thereof.
  • the invention provides a compound described herein, or a salt thereof.
  • the salt is a pharmaceutically acceptable salt.
  • the invention provides a compound described herein, or a hydrate thereof.
  • the invention provides a compound described herein, or a solvate thereof.
  • the invention provides a compound described herein, or a prodrug thereof.
  • the invention provides a salt of a compound described herein. In an exemplary embodiment, the invention provides a pharmaceutically acceptable salt of a compound described herein. In an exemplary embodiment, the invention provides a hydrate of a compound described herein. In an exemplary embodiment, the invention provides a solvate of a compound described herein. In an exemplary embodiment, the invention provides a prodrug of a compound described herein. In an exemplary embodiment, the invention provides a compound as described in Figure 1 or Figure 2.
  • alkyl is a member selected from linear alkyl and branched alkyl.
  • heteroalkyl is a member selected from linear heteroalkyl and branched heteroalkyl.
  • the term “chiral”, “enantiomerically enriched” or “diastereomerically enriched” refers to a composition having an enantiomeric excess (ee) or a diastereomeric excess (de) of greater than about 50%, preferably greater than about 70% and more preferably greater than about 90%. In general, higher than about 90% enantiomeric or diastereomeric excess is particularly preferred, e.g., those compositions with greater than about 95%, greater than about 97% and greater than about 99% ee or de. [0113]
  • the terms “enantiomeric excess” and “diastereomeric excess” are used interchangeably herein. Compounds with a single stereocenter are referred to as being present in “enantiomeric excess”, those with at least two stereocenters are referred to as being present in "diastereomeric excess”.
  • ee a x WO [0115]
  • the term "enantiomeric excess” is related to the older term “optical purity” in that both are measures of the same phenomenon.
  • the value of ee will be a number from 0 to 100, zero being racemic and 100 being enantiomerically pure.
  • a composition which in the past might have been called 98% optically pure is now more precisely characterized by 96% ee.
  • a 90% ee reflects the presence of 95% of one enantiomer and 5% of the other(s) in the material in question.
  • the invention provides a composition including a first stereoisomer and at least one additional stereoisomer of a compound of the invention.
  • the first stereoisomer can be present in a diastereomeric or enantiomeric excess of at least about 80%, or at least about 90%, or at least about
  • the first stereoisomer is present in a diastereomeric or enantiomeric excess of at least about 96%, at least about 97%, at least about 98%, at least about 99% or at least about 99.5%.
  • the compound of the invention is enantiomerically or diastereomerically pure (diastereomeric or enantiomeric excess is about 100%). Enantiomeric or diastereomeric excess can be determined relative to exactly one other stereoisomer, or can be determined relative to the sum of at least two other stereoisomers. In an exemplary embodiment, enantiomeric or diastereomeric excess is determined relative to all other detectable stereoisomers, which are present in the mixture. Stereoisomers are detectable if a concentration of such stereoisomer in the analyzed mixture can be determined using common analytical methods, such as chiral HPLC.
  • composition that is "substantially free" of a compound means that the composition contains less than about 20% by weight, or less than about 15% by weight, or less than about 10% by weight, or less than about 5% by weight, or less than about 3% by weight, or less than about 2% by weight, or less than about 1% by weight of the compound.
  • the term "substantially free of the (or its) enantiomer” means that a composition containg a compound of the invention is made up of a significantly greater proportion of one enantiomer than of its optical antipode.
  • the term “substantially free of the enantiomer” means that the compound is made up of at least about 90% by weight of the (S) enantiomer and about 10% by weight or less of the (R) stereoisomer.
  • the term "substantially free of the enantiomer” means that the compound is made up of at least about 95% by weight of the (S) enantiomer and about 5% by weight or less of the (R) stereoisomer. In an even more preferred embodiment, the term “substantially free of the enantiomer” means that the compound is made up of at least about 98% by weight of the (S) enantiomer and about 2% or less of the (R) stereoisomer. In an even more preferred embodiment, the term “substantially free of the enantiomer” means that the compound is made up of at least about 99% by weight of the (S) enantiomer and about 1% or less of the (R) stereoisomer.
  • the invention provides a composition comprising a) a first stereoisomer of a compound described herein, wherein R 3 is not H; b) at least one additional stereoisomer of the first stereoisomer, wherein the first stereoisomer is present in an enantiomeric excess of at least 80% relative to said at least one additional stereoisomer. In an exemplary embodiment, the enantiomeric excess is at least 92%.
  • the C* stereocenter of the first stereoisomer is in a (S) configuration. In an exemplary embodiment, the C* stereocenter of the first stereoisomer is in a (S) configuration, and R is -CH 2 NH 2 .
  • the invention provides a composition comprising a compound of the invention, wherein R 3 is not H and the C* stereocenter is in a (S) configuration, and said composition is substantially free of the enantiomer of the compound.
  • the composition comprises A2, A49 or combinations thereof, wherein the composition is substantially free of the enantiomer of A2 or A49.
  • the invention provides a composition comprising a compound described herein, wherein R 3 is not H and the C* stereocenter is in a (R) configuration.
  • the compounds of the invention may also be used in combination with additional therapeutic agents.
  • the invention thus provides, in a further aspect, a combination comprising a compound described herein or a pharmaceutically acceptable salt thereof together with at least one additional therapeutic agent.
  • the additional therapeutic agent is a compound of the invention.
  • the additional therapeutic agent includes a boron atom.
  • the additional therapeutic agent does not contain a boron atom.
  • the additional therapeutic agent is a compound described in section III.c).
  • the dose of each compound may differ from that when the compound is used alone. Appropriate doses will be readily appreciated by those skilled in the art. It will be appreciated that the amount of a compound of the invention required for use in treatment will vary with the nature of the condition being treated and the age and the condition of the patient and will be ultimately at the discretion of the attendant physician or veterinarian.
  • the additional therapeutic agent is an antibiotic.
  • antibiotics examples include an aminoglycoside, an ansamycin, a carbacephem, a carbapenem, a first-generation cephalosporin, a second- generation cephalosporin, a third-generation cephalosporin, a fourth-generation cephalosporin, a fifth-generation cephalosporin, a glycopeptide, a macrolide, a quinolone, a sulfonamide, and a tetracycline.
  • the additional therapeutic agent is a member selected from amikacin, gentamicin, kanamycin, neomycin, netilmicin, streptomycin, tobramycin, paromomycin.
  • the additional therapeutic agent is a member selected from geldanamycin and herbimycin. In an exemplary embodiment, the additional therapeutic agent is loracarbef. In an exemplary embodiment, the additional therapeutic agent is a member selected from ertapenem, doripenem, imipenem, cilastatin and meropenem. In an exemplary embodiment, the additional therapeutic agent is a member selected from cefadroxil, cefazolin, cefalotin and cefalexin. In an exemplary embodiment, the additional therapeutic agent is a member selected from cefaclor, cefamandole, cefoxitin, cefprozil and cefuroxime.
  • the additional therapeutic agent is a member selected from cefixime, cefdinir, cefditoren, cefoperazone, cefotaxime, cefpodoxime, ceftazidime, ceftibuten, ceftizoxime and ceftriaxone.
  • the additional therapeutic agent is cefepime.
  • the additional therapeutic agent is ceftobiprole.
  • the additional therapeutic agent is a member selected from teicoplanin and vancomycin.
  • the additional therapeutic agent is a member selected from azithromycin, clarithromycin, dirithromycin, erythromycin, roxithromycin, troleandomycin, telithromycin and spectinomycin.
  • the additional therapeutic agent is aztreonam.
  • the additional therapeutic agent is a member selected from amoxicillin, ampicillin, azlocillin, carbenicillin, cloxacillin, dicloxacillin, flucloxacillin, mezlocillin, meticillin, nafcillin, oxacillin, penicillin, piperacillin and ticarcillin.
  • the additional therapeutic agent is a member selected from bacitracin, colistin and polymyxin B.
  • the additional therapeutic agent is a member selected from ciprofloxacin, enoxacin, gatifloxacin, levofloxacin, lomefloxacin, moxifloxacin, norfloxacin, ofloxacin and trovafloxacin.
  • the additional therapeutic agent is a member selected from mafenide, prontosil, sulfacetamide, sulfamethizole, sulfanilimide, sulfasalazine, sulfisoxazole, trimethoprim and sulfamethoxazole.
  • the additional therapeutic agent is a member selected from demeclocycline, doxycycline, minocycline, oxytetracycline and tetracycline.
  • the additional therapeutic agent is a member selected from arsphenamine, chloramphenicol, lincomycin, ethambutol, fosfomycin, fusidic acid, furazolidone, isoniazid, linezolid, metronidazole, mupirocin, nitrofurantoin, platensimycin, pyrazinamide, quinupristin, rifampin and tinidazole.
  • the compounds of the invention, or pharmaceutical formulations thereof may also be used in combination with other therapeutic agents, for example immune therapies [e.g. interferon, such as interferon alfa-2a (ROFERONd)-A; Hoffmann-La Roche), interferon alpha-2b (INTRONd)-A; Schering-Plough), interferon alfacon-1 (INFERGEN®; Intermune), peginterferon alpha-2b (PEGINTRONTM; Schering- Plough) or peginterferon alpha-2a (PEGASYSd); Hoffmann-La Roche)], therapeutic vaccines, antifibrotic agents, anti-inflammatory agents [such as corticosteroids or NSAIDs], bronchodilators [such as beta-2 adrenergic agonists and xanthines (e.g.
  • interferon such as interferon alfa-2a (ROFERONd)-A; Hoffmann-La Roche), interferon alpha-2b (INTRONd)-A; Schering-Plough
  • compositions according to the invention may also be used in combination with gene replacement therapy.
  • the individual components of such combinations may be administered either simultaneously or sequentially in a unit dosage form.
  • the unit dosage form may be a single or multiple unit dosage forms.
  • the invention provides a combination in a single unit dosage form.
  • An example of a single unit dosage form is a capsule wherein both the compound of the invention and the additional therapeutic agent are contained within the same capsule.
  • the invention provides a combination in a two unit dosage form.
  • An example of a two unit dosage form is a first capsule which contains the compound of the invention and a second capsule which contains the additional therapeutic agent.
  • the term 'single unit' or 'two unit' or 'multiple unit' refers to the object which the patient ingests, not to the interior components of the object. Appropriate doses of known therapeutic agents will be readily appreciated by those skilled in the art.
  • an exemplary embodiment of the invention is a pharmaceutical formulation comprising a) a compound of the invention; b) an additional therapeutic agent and c) a pharmaceutically acceptable excipient.
  • the pharmaceutical formulation is a unit dosage form.
  • the pharmaceutical formulation is a single unit dosage form.
  • the pharmaceutical formulation is a two unit dosage form.
  • the pharmaceutical formulation is a two unit dosage form comprising a first unit dosage form and a second unit dosage form, wherein the first unit dosage form includes a) a compound of the invention and b) a first pharmaceutically acceptable excipient; and the second unit dosage form includes c) an additional therapeutic agent and d) a second pharmaceutically acceptable excipient.
  • Additional compounds of the invention include those formed between the 2 ',3' diol of the ribose ring of a nucleic acid, nucleoside or nucleotide, and a compound described herein or according to a formula described herein.
  • the compound is a cyclic or acyclic boronic ester such as those described herein.
  • These compounds can be used in an animal to kill or inhibit the growth of a microorganism described herein, as well as to treat the diseases described herein.
  • These compounds can be formed in vitro as well as in vivo. Methods of making these compounds are provided in the Examples section.
  • the invention provides a compound having a structure according to the following formula:
  • L is a member selected from OR 7 , substituted or unsubstituted purine, substituted or unsubstituted pyrimidine, substituted or unsubstituted pyridine and substituted or unsubstituted imidazole.
  • R 7 is a member selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted aryl and substituted or unsubstituted heteroaryl.
  • A is a member selected from OH, substituted or unsubstituted monophosphate, substituted or unsubstituted
  • A* O P O. diphosphate, substituted or unsubstituted triphosphate, ° I " V ;
  • A* is a nucleic acid sequence which comprises between 1 and 100 nucleotides.
  • the compound has a structure according to the formula:
  • R a , L and A are as described herein.
  • the compound has a structure which is a member selected from:
  • the compound has a structure which is a member selected from
  • a compound of the invention When a compound of the invention is applied to a nail component of a human, the compound absorbs or penetrates into the nail.
  • the human nail is primarily composed of keratin (i.e. hair keratin or ⁇ -keratin) as well as trace amounts of lipid components. Therefore, in the process of treating a disease of the nail or killing or inhibiting the growth of a microorganism, a formulation comprising a human nail unit and a compound of the invention is formed.
  • the invention provides a formulation comprising: (a) a compound of the invention; and (b) a keratin containing component of an animal.
  • the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
  • the compound of the invention a compound described in a formula provided herein.
  • the compound of the invention is a compound described herein.
  • the keratin containing component of an animal is a member selected from an animal nail unit, skin and hair.
  • the compound of part (a) contacts the component of part (b).
  • the animal is a human.
  • the keratin containing component is a nail plate of the human nail unit. In an exemplary embodiment, the keratin containing component is a nail bed of the human nail unit. In an exemplary embodiment, the keratin containing component is a proximal nail fold of the human nail unit. In an exemplary embodiment, the keratin containing component is a lateral nail fold of the human nail unit.
  • the human nail unit comprises a member selected from keratin and lipid. In another exemplary embodiment, keratin is a member selected from skin keratin and nail/hair keratin. In another exemplary embodiment, lipid is a member selected from cholesterol sulfate, cerebroside, ceramide, free sterol, free fatty acids, triglycerides, sterol esters, wax esters, and squalene.
  • the compound is present in the formulation at a concentration which is a member selected from about 0.001%, about 0.01%, about 0.05%, about 0.1%, about 0.5%, about 1%, about 1.5%, about 2%, about 2.5%, about 3%.
  • the keratin is present in said formulation at a concentration which is a member selected from about 99.99%, about 99.95%, about 99.90%, about 99.5%, about 99.0%, about 98.5%, about 98.0%, about 97.5% and about 97%.
  • the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
  • the compound is described herein.
  • the invention provides a method of forming this formulation, wherein said method comprises applying said compound to a formulation comprising keratin, thereby forming said formulation.
  • the formulation comprising keratin is a human nail unit.
  • the formulation comprising keratin is a member selected from a nail plate, nail bed, proximal nail fold, and lateral nail fold. Methods of making these formulations are described in the Examples section.
  • compound 1 * Through subjecting it to sulfonylation conditions, compound 1 * can be converted to compound 2*.
  • unsubstituted phenyl or unsubstituted pyridinyl sulfonyl chloride (1-1.2 equiv) and a base (such as NMM, K2CO3, or pyridine 3-4 equiv) were added sequentially to a solution of the amine in MeCN (20 mL/g) at rt. After completion (typical duration O/N) the volatiles were removed in vacuo. H 2 O was added to the residue and the mixture adjusted to ⁇ pH 6 with dilute HCl.
  • the aqueous layer was then extracted with an organic solvent (such as EtOAc), and the combined organic fractions dried with a desiccant, such as Na 2 SO 4 or MgSO 4 , filtered, and concentrated in vacuo.
  • an organic solvent such as EtOAc
  • a desiccant such as Na 2 SO 4 or MgSO 4
  • the product was typically purified by either recrystallization from H 2 O, trituration with CH 2 Cl 2 or EtOAc, or flash chromatography.
  • Trifluoromethanesulfonic anhydride (1.2 equiv) was added dropwise to a solution of pyridine (1.2 equiv) and the phenol in CH 2 Cl 2 (40 mL/8.6 g) at 0 0 C (bath temp). The reaction mixture was then allowed to warm to rt and was stirred until complete consumption of starting material (as determined by TLC). Et 2 O and 2 N HCl were then added. The organic layer was separated and washed with sat. NaHCO 3 then brine. The organic layer was dried (Na 2 SO 4 ) and filtered through a short silica gel plug, washing with Et 2 O. The filtrate was concentrated in vacuo to give the desired triflate that was used directly in general procedure 5.
  • CTAB or CTACl (5 mol%) was added to a mixture OfMeNO 2 and aldehyde, in aq. NaOH, and THF (1 mL/300 mg aldehyde) at rt.
  • the reaction was monitored by TLC. Upon completion (typically 1-1.5 h), the mixture was adjusted to pH 2-3 using 2 N HCl or 1 M NaHSO 4 and the mixture was then stirred for 30 min. The solid was filtered and dried to afford the desired nitro compound which was used directly in next step. If there was no precipitation, the organic material was extracted from the reaction mixture with EtOAc. The organic fraction was then dried (MgSO 4 ) and concentrated in vacuo. The residue was purified by flash chromatography.
  • General procedure 10 Reduction ofAlkyl Nitro and/or Alkyl Nitrile compounds to N- Boc Protected Amines.
  • compound 12* Through subjecting it to reducing conditions, compound 12* can be converted to compound 13*.
  • compound 12* Through subjecting it to reducing conditions, compound 12* can be converted to compound 15*.
  • reaction mixture is then allowed to warm to room temperature where it is stirred for 3 hours before being quenched with 6 M HCl (30 mL).
  • 6 M HCl (30 mL).
  • the reaction mixture is concentrated under reduced pressure and the resulting residue is subjected to flash column chromatography to give the substituted 3- (azidomethyl)benzo[c] [ 1 ,2] oxaborol- 1 (3H)-ol.
  • the mutants were furthermore shown to be sensitive to various antibacterial agents with known modes of action, suggesting that the cellular target of (Al) is distinct from the target of the other antibacterial agents.
  • the leuS gene from the mutants was cloned onto a plasmid and their resistance was confirmed by MIC.
  • the editing domain from these mutants were sequenced and the mutations were all located in the editing domain of this enzyme.
  • Assays to determine whether, and how effectively, a particular compound binds to and/or inhibits the editing domain of a selected tRNA synthetase are also set forth herein, and additional assays are readily available to those of skill in the art. Briefly, in an exemplary assay, an improperly charged tRNA and a tRNA synthetase that is capable of editing the improperly charged tRNA are combined. The resulting mixture is contacted with the putative inhibitor and the degree of editing inhibition is observed.
  • Another assay uses genetics to show that a drug works via the editing domain.
  • the compound is first tested against a strain of cells over- expressing copies of the tRNA synthetase gene. The compound's effect on the over- expressing strain is compared with a control strain to determine whether the compound is active against the synthetase. If the minimum inhibitory concentration (MIC) is 2-fold higher in the strain with extra copies of the synthetase gene than the MIC of the inhibitor against a wild type cell, a further genetic screen is conducted to determine whether the increased resistance is due to mutations in the editing domain. In this second screen, the control strain is challenged against a high concentration of the inhibitor. The colonies surviving the challenge are isolated and DNA from these cells is isolated.
  • MIC minimum inhibitory concentration
  • the editing domain is amplified using a proof-reading PCR enzyme and the appropriate primers.
  • the PCR product can be purified using standard procedures.
  • the sequence amplified mutant DNA is compared to wild-type. If the mutant DNA bears mutations in the editing domain, such results would suggest that the compound binds to the editing domain and affects the editing function of the molecule through this domain.
  • the assays set forth above are useful in essentially any microbial system, e.g., bacterial, fungal, parasitic, viral and the like.
  • the compounds to be tested are present in the assays in ranges from about 1 pM to about 100 mM, preferably from about 1 pM to about 1 ⁇ M.
  • Other compounds range from about 1 nM to about 100 nM, preferably from about 1 nM to about 1 ⁇ M.
  • the effects of the test compounds upon the function of the enzymes can also be measured by any suitable physiological change.
  • the functional consequences are determined using intact cells or animals, one can also measure a variety of effects such as transmitter release, hormone release, transcriptional changes to both known and uncharacterized genetic markers, changes in cell metabolism such as cell growth or pH changes, and changes in intracellular second messengers such as Ca 2+ , or cyclic nucleotides.
  • High throughput screening is also of use in identifying promising candidates of the invention.
  • the invention provides a method for identifying a compound which binds to an editing domain of a tRNA synthetase comprising: a) contacting said editing domain with a test compound under conditions suitable for binding; and b) detecting binding of said test compound to said editing domain.
  • detecting binding of said compound comprises use of at least one detectable element, isotope, or chemical label attached to said compound.
  • the element, isotope or chemical label is detected by a fluorescent, luminescent, radioactive, or absorbance readout.
  • the contacting of said test compound with said editing domain also includes further contacting said test compound and said editing domain with a member selected from AMP and a molecule with a terminal adenosine.
  • said tRNA synthetase is derived from a member selected from alanyl tRNA synthetase, isoleucyl tRNA synthetase, leucyl tRNA synthetase, methionyl tRNA synthetase, lysyl tRNA synthetase, phenylalanyl tRNA synthetase, prolyl tRNA synthetase, threonyl tRNA synthetase and valyl tRNA synthetase.
  • the tRNA synthetase is derived from leucyl tRNA synthetase. In an exemplary embodiment, the tRNA synthetase is derived from a mutated tRNA synthetase, wherein said mutated tRNA synthetase comprises amino acid mutations in an editing domain. In another exemplary embodiment, wherein said editing domain of a tRNA synthetase comprises the amino acid sequence of a peptide sequence described herein.
  • the invention provides a method for identifying a compound which binds to an editing domain of a tRNA synthetase, said assay comprising: a) contacting said editing domain of a tRNA synthetase with said compound under conditions suitable for binding of said compound with said editing domain of a tRNA synthetase; b) comparing a biological activity of said editing domain of a tRNA synthetase contacting said compound to said biological activity when not contacting said compound; and c) identifying said compound as binding to said editing domain of a tRNA synthetase if said biological activity of said editing domain of a tRNA synthetase is reduced when contacting said compound.
  • the biological activity is hydrolysis of noncognate amino acid.
  • the hydrolysis of said noncognate amino acid is detected through the use of one or more labels.
  • the labels include a radiolabel, a fluorescent marker, an antibody, or a combination thereof.
  • said labels can be detected using spectroscopy.
  • the editing domain of a tRNA synthetase is derived from a member selected from alanyl tRNA synthetase, isoleucyl tRNA synthetase, leucyl tRNA synthetase, methionyl tRNA synthetase, lysyl tRNA synthetase, phenylalanyl tRNA synthetase, prolyl tRNA synthetase, threonyl tRNA synthetase and valyl tRNA synthetase.
  • said editing domain of a tRNA synthetase is derived from leucyl tRNA synthetase.
  • the invention provides a method of generating tRNA molecules with noncognate amino acid comprising: a) creating or isolating a mutated tRNA synthetase with altered amino acid editing domains; and b) contacting a tRNA molecule with said mutated tRNA synthetase and a noncognate amino acid.
  • the mutated tRNA synthetase contains one or more amino acid mutations in an editing domain.
  • the mutated tRNA synthetase is unable to bind with a compound of the invention.
  • the mutated tRNA synthetase is unable to bind with a compound described herein, or a pharmaceutically acceptable salt thereof. In another exemplary embodiment, the mutated tRNA synthetase is unable to bind with a compound according to a formula described herein, or a pharmaceutically acceptable salt thereof. In another exemplary embodiment, the compound of the invention is a member selected from
  • R is H.
  • the invention provides a composition that comprises one or more tRNA molecules attached to noncognate amino acids, wherein said tRNA molecules are synthesized using one or more mutated tRNA synthetases isolated from a microorganism or a cell line derived from a microorganism.
  • the microorganism is a bacteria.
  • said mutated tRNA synthetases contain amino acid mutations in their editing domains.
  • Transfer RNAs translate mRNA into a protein on a ribosome.
  • Each transfer RNA contains an anti-codon region that hybridizes with mRNA, and an amino acid which may be attached to the growing peptide.
  • the structural gene of tRNA is about 72 to 90 nucleotides long and folds into a cloverleaf structure (Sharp S. J., Schaack J., Coolen L., Burke D. J. and Soil D., "Structure and transcription of eukaryotic tRNA genes", Crit. Rev. Biochem, 19:107 144 (1985); Geiduschek E. O., and Tocchini-Valentini, "Transcription by RNA polymerase III", Annu. Rev. Biochem. 57:873 914 (1988)).
  • a compound described herein contacts AMP and a tRNA synthetase, and the tRNA synthetase in turn contacts a tRNA molecule.
  • a compound described herein contacts AMP from the tRNA molecules and a tRNA synthetase.
  • the nucleotide sequence of the tRNA molecule can be determined by the identity of the tRNA synthetase involved.
  • the cognate tRNA molecule bound will be tRNA-leucine (SEQ ID NO: 1), but a noncognate tRNA, such as isoleucine, (SEQ ID NO: 2) may be bound under certain conditions.
  • the tRNA molecule is a leucyl t-RNA.
  • the tRNA molecule is represented by a SEQ ID described herein.
  • the tRNA molecule is represented by SEQ ID NO: 14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23 and SEQ ID NO:24.
  • the term "noncognate” is meant to encompass both the singular and plural forms of the word, i.e. the phrase "noncognate amino acid" comprises one or more amino acids.
  • SEQ ID NO: 1 corresponds to the nucleotide sequence of the tRNA-Leu gene from Saccharomyces cerevisiae: gggagtttgg ccgagtggtt taaggcgtca gatttaggct ctgatatctt cggatgcaagggttcgaatc ccttagctct caeca
  • SEQ ID NO: 2 corresponds to the nucleotide sequence of the tRNA-Ile gene from Saccharomyces cerevisiae: gaaactataa ttcaattggt tagaatagta ttttgataag gtacaaatat aggttcaatc cctgttagtt tcatcca
  • SEQ ID NO: 14 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ . gcgaaggtggcggaattggtagacgcgctagcttcaggtgttagtgtccttacggacgtgggggttcaagtcccccctc gcacca
  • SEQ ID NO: 15 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ . gcgggagtggcgaaattggtagacgcaccagatttaggttctggcgccgcaaggtgtgcgagttcaagtctcgcctccg caeca
  • SEQ ID NO: 16 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ . gccgaagtggcgaaatcggtagacgcagttgattcaaaatcaaccgtagaaatacgtgccggttcgagtccggcttcgg caeca
  • SEQ ID NO: 17 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ . gccgaggtggtggaattggtagacacgctaccttgaggtggtagtgcccaatagggcttacgggttcaagtcccgtcctcg gtacca
  • SEQ ID NO: 18 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ . gcccggatggtggaatcggtagacacacaagggatttaaaatccctcggcgttcgcgctgtgcgggttcaagtcccgctccg ggtacca
  • SEQ ID NO: 19 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ .
  • SEQ ID NO: 20 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ .
  • SEQ ID NO: 21 corresponds to the nucleotide sequence of a tRNA-Leu gene from E. col ⁇ . GCCGAGGUGGUGGAADDGmGDAGACACGCUACCUUGAGunkGYGGUAGU GCCCAAUAGGGCUUACGGGTYCAAGUCCCGUCCUCGGUACCA
  • SEQ ID NO: 22 corresponds to the nucleotide sequence of a tRNA-Leu gene from Pseudomonas aeruginosa gcggacgtggtggaattggtagacacactggatttaggttccagcgccgcaaggcgtgagagttcgagtctctccgtccgc acca
  • SEQ ID NO: 23 corresponds to the nucleotide sequence of a tRNA-Leu gene from Staphylococcus aureus gccggggtggcggaactggcagacgcacaggacttaaaatcctgcggtgagagatcaccgtaccggttcgattccggtc ctcggcacca
  • SEQ ID NO: 24 corresponds to the nucleotide sequence of a tRNA-Leu gene from Staphylococcus aureus gccggggtggcggaactggcagacgcacaggacttaaaatcctgcggtgagtgatcaccgtaccggttcgattccggtcc tcggcacca
  • polypeptide fragments corresponding to the editing domain of a tRNA synthetase molecule are used in assay and binding experiments.
  • Such fragments are represented by SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6 and SEQ ID NO:7.
  • the fragments are represented by SEQ ID NO:5, SEQ ID NO: 6 and SEQ ID NO:7.
  • SEQ ID NO 5 TCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQVIDGCC WRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRNWIGRS EGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPEL AAFIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLME YGTGAVMAVPGHDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVL FNSGEFNGLDHEAAFNAIADKLTAMGVGERKVNYRLRDWGVSRQRYWG
  • SEQ ID NO 8 corresponds to a peptide sequence for a leu-tRNA synthetase editing domain for Escherichia coli GRSEGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENN PELAAFIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFV LMEYGTGAVMAVPGHDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTE KGVLFNSGEFNGLDHEAAFNAIADKLTAMGVGERKVNYR
  • SEQ ID NO 9 corresponds to a peptide sequence for a leu-tRNA synthetase editing domain for Pseudomonas
  • SEQ ID NO 10 corresponds to a peptide sequence for a leu-tRNA synthetase editing domain for Staphylococcus aureus
  • polypeptides corresponding to a tRNA synthetase molecule are used in assay and binding experiments.
  • Such polypeptides are represented by SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13.
  • SEQ ID NO 11 corresponds to a peptide sequence for a leu-tRNA synthetase for Escherichia coli
  • SEQ ID NO 12 corresponds to a peptide sequence for a leu-tRNA synthetase for Pseudomonas
  • SEQ ID NO 13 corresponds to a peptide sequence for a leu-tRNA synthetase for Staphylococcus aureus
  • the compounds of the invention can be utilized to inhibit an enzyme.
  • the compounds of the invention exhibit the ability of inhibiting the editing domain of tRNA synthetases, such as leucyl tRNA synthetase, of microorganisms, such as bacteria, and therefore have the potential to be used as editing domain inhibitors of microorganism tRNA synthetases.
  • a method for binding to and/or inhibiting the editing domain of a tRNA synthetase comprises contacting a tRNA synthetase with a compound of the invention that inhibits the editing domain under conditions in which the tRNA synthetase interacts with its substrate to form an aminoacyl adenylate intermediate and, preferably, to form a charged tRNA.
  • a compound of the invention that inhibits the editing domain under conditions in which the tRNA synthetase interacts with its substrate to form an aminoacyl adenylate intermediate and, preferably, to form a charged tRNA.
  • the compound is described herein, or a salt, hydrate or solvate thereof, or a combination thereof.
  • the invention provides a compound described herein, or a salt, hydrate or solvate thereof.
  • the invention provides a compound described herein, or a salt thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt thereof.
  • the tRNA synthetase is contacted with an amount of compound of the invention sufficient to result in a detectable amount of tRNA synthetase inhibition.
  • This method can be performed on a tRNA synthetase that is contained within an organism or which is outside an organism. In an exemplary embodiment, the method is performed on a tRNA synthetase that is contained within a microorganism or a microbial cell that is in, or on the surface of, an animal. In an exemplary embodiment, the animal is a human.
  • the method results in a decrease in the amount of charged tRNA produced by the tRNA synthetase that has an inhibited editing domain.
  • the inhibition takes place in a cell, such as a microbial cell.
  • the microbial cell is a bacteria, fungus, yeast or parasite.
  • the tRNA synthetase is a mitochondrial tRNA synthetase or a cytoplasmic tRNA synthetase.
  • the tRNA synthetase is a member selected from alanyl tRNA synthetase, isoleucyl tRNA synthetase, leucyl tRNA synthetase, methionyl tRNA synthetase, lysyl tRNA synthetase, phenylalanyl tRNA synthetase, prolyl tRNA synthetase, threonyl tRNA synthetase and valyl tRNA synthetase.
  • the tRNA synthetase is leucyl tRNA synthetase.
  • the invention provides a method of inhibiting conversion of a tRNA molecule into a charged tRNA molecule.
  • the method involves contacting a tRNA synthetase with a compound of the invention effective to inhibit activity of an editing domain of said tRNA synthetase, under conditions sufficient to inhibit said activity, thereby inhibiting said conversion.
  • the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
  • the inhibition occurs within a cell, and the cell is a microbial cell.
  • the microbial cell is a member selected from a bacteria, fungus, yeast, and parasite.
  • the tRNA synthetase is a member selected from a mitochondrial tRNA synthetase and a cytoplasmic tRNA synthetase.
  • the tRNA synthetase is a member selected from alanyl tRNA synthetase, isoleucyl tRNA synthetase, leucyl tRNA synthetase, methionyl tRNA synthetase, lysyl tRNA synthetase, phenylalanyl tRNA synthetase, prolyl tRNA synthetase, threonyl tRNA synthetase and valyl tRNA synthetase.
  • the tRNA synthetase is leucyl tRNA synthetase.
  • the compound has a K Di synthes i s of greater than 100 ⁇ M against a synthetic domain of said tRNA synthetase.
  • the mechanism of action of a compound of the invention is to inhibit the conversion of a tRNA molecule into a charged tRNA molecule by binding to and/or inhibiting at least the editing domain of the synthetase.
  • the compounds of use in this method may also inhibit or otherwise interact with the synthetic domain (e.g., the active site of the synthetic domain).
  • the editing domain is inhibited selectively in the presence of the synthetic domain.
  • the synthetic domain is essentially uninhibited, while the editing domain is inhibited at least 50%, preferably at least 60%, more preferably at least 70%, still more preferably, at least 80% and even still more preferably at least 90% of the activity of the tRNA synthetase.
  • the synthetic domain is inhibited by at most 50%, preferably at most 30%, preferably at most 20%, 10%, preferably at most 8%, more preferably at most 5%, still more preferably, at most 3% and even still more preferably at most 1%. Inhibition of the editing domain produces a decrease in the amount of the properly charged tRNA which results in retardation or cessation of cell growth and division.
  • the ratio of a minimum concentration of said compound inhibiting said editing domain to a minimum concentration of said compound inhibiting said synthetic domain of said tRNA synthetase, represented as KD, edit/Ko, synthesis is less than one.
  • the K D , edit /KD, synthesis of the compound is a member selected from less than 0.5, less than 0.1 and less than 0.05.
  • the compounds of the present invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to kill and/or inhibit the growth of microorganisms.
  • the invention provides a method of killing and/or inhibiting the growth of a microorganism, said method comprising: contacting said microorganism with an effective amount of a compound of the invention, thereby killing and/or inhibiting the growth of the microorganism.
  • the microorganism is a member selected from a bacteria, fungus, virus, yeast or parasite.
  • the compound is described herein, or a salt, prodrug, hydrate or solvate thereof, or a combination thereof.
  • the invention provides a compound described herein, or a salt, hydrate or solvate thereof.
  • the invention provides a compound described herein, or a prodrug thereof. In an exemplary embodiment, the invention provides a compound described herein, or a salt thereof. In another exemplary embodiment, the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof. In another exemplary embodiment, the compound is described by a formula listed herein, or a pharmaceutically acceptable salt thereof. In an exemplary embodiment, the compound is part of a pharmaceutical formulation described herein. In another exemplary embodiment, the contacting occurs under conditions which permit entry of the compound into the organism. In an exemplary embodiment, the compound inhibits the tRNA synthetase through the editing domain of the synthetase.
  • This method involves contacting a microbial cell with a therapeutically-effective amount of an editing domain inhibitor to inhibit tRNA synthetase in vivo or in vitro.
  • the compound is a member selected from
  • R is H.
  • the microorganism is inside, or on the surface of an animal.
  • the animal is a member selected from human, cattle, deer, reindeer, goat, honey bee, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, camel, yak, elephant, ostrich, otter, chicken, duck, goose, guinea fowl, pigeon, swan, and turkey.
  • the animal is a human.
  • the microorganism is killed or its growth is inhibited through oral administration of the compound of the invention. In an exemplary embodiment, the microorganism is killed or its growth is inhibited through intravenous administration of the compound of the invention.
  • the microorganism is a bacterium.
  • the bacterium is a gram-positive bacteria.
  • the gram-positive bacterium is a member selected from Staphylococcus species, Streptococcus species, Bacillus species, Mycobacterium species, Cory neb acterium species (Propionibacterium species), Clostridium species, Actinomyces species, Enterococcus species and Streptomyces species.
  • the gram-positive bacterium is a member selected from Propionibacterium acnes; Staphylococcus aureus; Staphylococcus epidermidis, Staphylococcus saprophyticus; Staphylococcus haemolyticus; Streptococcus pyogenes; Streptococcus agalactiae; Streptococcus pneumoniae; Enterococcus faecalis; Enterococcus faecium; Bacillus anthracis; Mycobacterium avium- intracellulare; Mycobacterium tuberculosis, Acinetobacter baumanii; Corynebacterium diphtheria; Clostridium perfringens; Clostridium botulinum; Clostridium tetani; Clostridium difficile.
  • the gram-positive bacterium is a member selected from Staphylococcus aureus, Staphylococcus epidermidis, Streptococcus pneumoniae, Streptococcus pyogenes, Enterococcus faecalis, Enterococcus faecium, Clostridium difficile and Propionibacter acnes.
  • the bacterium is a gram- negative bacterium.
  • the gram-negative bacterium is a member selected from Acinetobacter species, Neisseria species, Pseudomonas species, Brucella species, Agrobacterium species, Bordetella species, Escherichia species, Shigella species, Yersinia species, Salmonella species, Klebsiella species, Enterobacter species, Haemophilus species, Pasteurella species, Streptobacillus species, spirochetal species, Campylobacter species, Vibrio species, Helicobacter species, Bacteroides species, Citrobacter species, Proteus species, Providencia species, Serratia species, Stenotrophomonas species and Burkholderia species.
  • the gram-negative bacterium is a member selected from Acinetobacter species, Pseudomonas species, Escherichia species, Klebsiella species, Enterobacter species, Bacteroides species, Citrobacter species, Proteus species, Providencia species, Serratia species, Stenotrophomonas species and Burkholderia species.
  • the gram-negative bacterium is a member selected from Neisseria gonorrhoeae; Neisseria meningitidis; Pseudomonas aeruginosa; Legionella pneumophila; Escherichia coli; Yersinia pestis; Haemophilus influenzae; Helicobacter pylori; Campylobacter fetus; Campylobacter jejuni; Vibrio cholerae; Vibrio parahemolyticus; Trepomena pallidum; Actinomyces israelii; Rickettsia prowazekii; Rickettsia rickettsii; Chlamydia trachomatis; Chlamydia psittaci; Brucella abortus; Agrobacterium tumefaciens; Francisella tularensis, Klebsiella pneumoniae, Enterobacter cloacae
  • the gram-negative bacterium is a member selected from Pseudomonas aeruginosa; Escherichia coli; Haemophilus influenzae, Klebsiella pneumoniae, Enterobacter cloacae, Acinetobacter baumannii, Bacteroides fragilis, Citrobacter freundii, Proteus mirabilis, Providencia stuartii, Serratia marcescens, Stenotrophomonas maltophilia and Burkholderia cepacia.
  • the bacterium is a Pseudomonas species. In another exemplary embodiment, the bacterium is Pseudomonas aeruginosa. In another exemplary embodiment, the bacterium is a member selected from Pseudomonas aeruginosa; Acinetobacter baumannii, Stenotrophomonas maltophilia and Burkholderia cepacia. In another exemplary embodiment, the bacterium is Acinetobacter species. In another exemplary embodiment, the bacterium is Acinetobacter anitratus.
  • the bacterium is a member selected from Enterobacter aerogenes, Enterobacter cloacae, Enterobacter sakazakii, E. coli, K. pneumoniae, P. mirabilis, Serratia marcescens, Citrobacter freundii and Providencia spp.
  • the bacterium is a member selected from Enterobacter aerogenes, Enterobacter cloacae, Enterobacter sakazakii, E. coli, K. pneumoniae, P. mirabilis, Serratia marcescens, Citrobacter freundii, Providencia spp., S. aureus, S. pneumonia, S. pyogenes, E.
  • the bacterium is a member selected from Viridans group Strep.. In another exemplary embodiment, the bacterium is a member selected from Strep, mitis, Strep, mutans, Strep, oralis, Strep, sanguis, Strep, sobrinus and Strep, millari. In another exemplary embodiment, the bacterium is a member selected from S. pneumonia, H. influenzae, S. aureus, M. catarrhalis, M. pneumoniae, L. pneumoniae and C pneumoniae. In another exemplary embodiment, the bacterium is S. aureus. In another exemplary embodiment, the bacterium is an anaerobe.
  • the bacterium is an Alcaligenes species. In another exemplary embodiment, the bacterium is a B. cepacia. In another exemplary embodiment, the bacterium is a member selected from Enterobacter cloacae, Escherichia coli; Klebsiella pneumoniae, Proteus mirabilis, Providencia stuartii, Serratia marcescens, and Citrobacter freundii. In another exemplary embodiment, the bacterium is resistant to methicillin. In another exemplary embodiment, the bacterium is methicillin-resistant staphylococcus aureus.
  • the bacterium is a member selected from Streptococcus pneumoniae; Haemophilus influenzae; Staphylococcus aureus; Mycobacterium catarrhalis; Mycobacterium pneumoniae; Legionella pneumophila and Chlamydia pneumoniae.
  • the bacterium is a member selected from Enterobacter cloacae, Escherichia coli; Klebsiella pneumoniae, Proteus mirabilis, Serratia marcescens, Citrobacter freundii, Providencia stuartii, Pseudomonas aeruginosa; Acinetobacter baumannii, Stenotrophomonas maltophilia, Burkholderia cepacia, Staphylococcus aureus; Streptococcus pneumoniae; Streptococcus pyogenes; Enterococcus faecalis; and Enter ococcus faecium.
  • the microorganism is a bacterium, which is a member selected from acid-fast bacteria, including Mycobacterium species; bacilli, including Bacillus species, Corynebacterium species (also Propionibacterium) and Clostridium species; filamentous bacteria, including Actinomyces species and Streptomyces species; bacilli, such as Pseudomonas species, Brucella species, Agrobacterium species, Bordetella species, Escherichia species, Shigella species, Yersinia species, Salmonella species, Klebsiella species, Enterobacter species, Haemophilus species, Pasteurella species, and Streptobacillus species; spirochetal species, Campylobacter species, Vibrio species; and intracellular bacteria including Rickettsiae species and Chlamydia species.
  • the microorganism is described in a Figure provided herein.
  • the microorganism is a member selected from a fungus and a yeast.
  • the fungus or yeast is a member selected from Candida species, Trichophyton species, Microsporium species, Aspergillus species, Cryptococcus species, Blastomyces species, Cocciodiodes species, Histoplasma species, Paracoccidiodes species, Phycomycetes species, Malassezia species, Fusarium species, Epidermophyton species, Scytalidium species, Scopulariopsis species, Alternaria species, Penicillium species, Phialophora species, Rhizopus species, Scedosporium species and Zygomycetes class.
  • the fungus or yeast is a member selected from Aspergilus fumigatus (A.fumigatus), Blastomyces dermatitidis, Candida Albicans (C albicans, both fluconazole sensitive and resistant strains), Candida glabrata (C glabrata), Candida krusei (C krusei), Cryptococcus neoformans (C neoformans), Candida parapsilosis (C parapsilosis), Candida tropicalis (C tropicalis), Cocciodiodes immitis, Epidermophyton floccosum (E.floccosum), Fusarium solani (F.
  • Aspergilus fumigatus A.fumigatus
  • Blastomyces dermatitidis Candida Albicans (C albicans, both fluconazole sensitive and resistant strains
  • Candida glabrata C glabrata
  • Candida krusei C krusei
  • the fungus or yeast is a member selected from Trichophyton concentricum, T violaceum, T schoenleinii, T. verrucosum, T soudanense, Microsporum gypseum, M. equinum, Candida guilliermondii, Malassezia globosa, M. obtuse, M. restricta, M. slooffiae, and Aspergillus flavus .
  • the fungus or yeast is a member selected from dermatophytes, Trichophyton, Microsporum, Epidermophyton and yeast- like fungi.
  • the fungus or yeast is Candida Albicans.
  • the microorganism is a virus.
  • the virus is a member selected from hepatitis A-B, human rhinoviruses, Yellow fever virus, human respiratory coronaviruses, Severe acute respiratory syndrome (SARS), respiratory syncytial virus, influenza viruses, parainfluenza viruses 1-4, human immunodeficiency virus 1 (HIV-I), human immunodeficiency virus 2 (HIV-2), Herpes simplex virus 1 (HSV-I), Herpes simplex virus 2 (HSV-2), human cytomegalovirus (HCMV), Varicella zoster virus, Epstein- Barr (EBV), polioviruses, coxsackieviruses, echoviruses, rubella virus, neuroderma- tropic virus, variola virus, papoviruses, rabies virus, dengue virus, West Nile virus and SARS virus.
  • the virus is a member selected from picornaviridae, flaviviridae, coronaviridae, paramyxoviridae, orthomyxoviridae, retroviridae, herpesviridae and hepadnaviridae.
  • the virus is a member selected from a virus included in the following table: Table A. Viruses
  • SAR Severe acute respiratory syndrome
  • Bunyavirus - Bunyamwera BUN
  • HTN Hantavirus - Hantaan
  • HIV-I Human immunodeficiency virus 1
  • HIV-2 Human immunodeficiency virus 2
  • Papovaviridae Pediatric viruses that reside in kidney Adenoviridae Human respiratory distress and some deep- seated eye infections
  • Herpes simplex virus 1 Herpes simplex virus 1 (HSV-I)
  • Herpes simplex virus 2 Herpes simplex virus 2 (HSV-2)
  • the microorganism is a parasite.
  • the parasite is a member selected from Plasmodium falciparum, P. vivax, P. ovale P. malariae, P. berghei, Leishmania donovani, L. infantum, L. chagasi, L. mexicana, L. amazonensis, L. venezuelensis, L. tropics, L. major, L. minor, L. aethiopica, L. Biana braziliensis, L. (V.) guyanensis, L.
  • V. panamensis
  • L. peruviana
  • Trypanosoma brucei rhodesiense Trypanosoma brucei rhodesiense
  • T. brucei gambiense T. cruzi
  • Giardia intestinalis G. lambda
  • Toxoplasma gondii Entamoeba histolytica
  • Trichomonas vaginalis Pneumocystis carinii
  • Cryptosporidium parvum Cryptosporidium parvum.
  • the compounds of the present invention exhibit potency against microorganisms, such as bacteria, and therefore have the potential to achieve therapeutic efficacy in the animals described herein.
  • the invention provides a method of treating and/or preventing a disease.
  • the method includes administering to the animal a therapeutically effective amount of the compound of the invention, sufficient to treat and/or prevent the disease.
  • the compound of the invention can be used in human or veterinary medical therapy, particularly in the treatment or prophylaxis of bacterial-associated disease.
  • the compound is described herein, or a salt, prodrug, hydrate or solvate thereof, or a combination thereof.
  • the invention provides a compound described herein, or a prodrug thereof.
  • the invention provides a compound described herein, or a salt, hydrate or solvate thereof.
  • the invention provides a compound described herein, or a salt thereof.
  • the compound of the invention is a compound described herein, or a pharmaceutically acceptable salt thereof.
  • the compound is a compound described herein, or a pharmaceutically acceptable salt thereof.
  • the compound is according to a formula described herein, or a pharmaceutically acceptable salt thereof.
  • the compound is part of a pharmaceutical formulation described herein.
  • the animal is a member selected from human, cattle, deer, reindeer, goat, honey bee, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, camel, yak, elephant, ostrich, otter, chicken, duck, goose, guinea fowl, pigeon, swan, and turkey.
  • the animal is a human.
  • the animal is a member selected from a human, cattle, goat, pig, sheep, horse, cow, bull, dog, guinea pig, gerbil, rabbit, cat, chicken and turkey.
  • the disease is a member selected from a systemic disease, a cutaneous disease, and an ungual, periungual or subungual disease.
  • the disease is a systemic disease.
  • the compound is a member selected from
  • R is H.
  • the treatment of a disorder or condition occurs through inhibition of an editing domain of an aminoacyl tRNA synthetase.
  • the disease is treated through oral administration of the compound of the invention.
  • the disease is treated through intravenous administration of the compound of the invention.
  • the invention provides a method of treating a systemic disease.
  • the method involves contacting an animal with a compound of the invention.
  • the disease is a member selected from candidiasis, aspergillosis, coccidioidomycosis, cryptococcosis, histoplasmosis, blastomycosis, paracoccidioidomycosis, zygomycosis, phaeohyphomycosis and rhinosporidiosis.
  • the disease is associated with an infection by a microorganism described herein. In an exemplary embodiment, the disease is associated with an infection by a bacterium described herein.
  • the disease is associated with infection by a Gram-positive bacteria.
  • the disease is associated with a Staphylococcus species.
  • the disease is a member selected from pneumonia, gastroenteritis, toxic shock syndrome, CAP, meningitis, septic arthritis, urinary tract infections, bacteremia, endocarditis, osteomylitis, skin and skin- structure infections.
  • the disease is associated with a Streptococcus species.
  • the disease is a member selected from strep throat, skin infections, necrotizing fasciitis, toxic shock syndrome, pneumonia, otitis media and sinusitis.
  • the disease is associated with an Actinomyces species. In another exemplary embodiment, the disease is actinomycosis. In an exemplary embodiment, the disease is associated with a Norcardia species. In another exemplary embodiment, the disease is pneumonia. In an exemplary embodiment, the disease is associated with a Cory neb acterium species. In another exemplary embodiment, the disease is diptheria. In an exemplary embodiment, the disease is associated with a Listeria species. In another exemplary embodiment, the disease is meningitis. In an exemplary embodiment, the disease is associated with a Bacillus species. In another exemplary embodiment, the disease is a member selected from anthrax and food poisoning. In an exemplary embodiment, the disease is associated with a Clostridium species.
  • the disease is a member selected from botulism, tetanus, gas gangrene and diarrhea. In an exemplary embodiment, the disease is associated with a Mycobacterium species. In another exemplary embodiment, the disease is a member selected from tuberculosis and leprosy.
  • the disease is associated with infection by a Gram-negative bacteria.
  • the disease is associated with a Neisseria species.
  • the disease is a member selected from meningitis, gonorrhea, otitis externa and folliculitis.
  • the disease is associated with an Escherichia species.
  • the disease is a member selected from diarrhea, urinary tract infections, meningitis, sepsis and HAP.
  • the disease is associated with a Shigella species.
  • the disease is a member selected from diarrhea, bacteremia, endocarditis, meningitis and gastroenteritis.
  • the disease is associated with a Salmonella species.
  • the disease is a member selected from Typhoid fever, supsis, gastroenteritis, endocarditis, sinusitis and meningitis.
  • the disease is associated with a Yersinia species.
  • the disease is a member selected from Typhoid fever, bubonic plague, enteric fever and gastroenteritis.
  • the disease is associated with a Klebsiella species.
  • the disease is a member selected from sepsis and urinary tract infection.
  • the disease is associated with a Proteus species.
  • the disease is an urinary tract infection. In an exemplary embodiment, the disease is associated with an Enterobacter species. In another exemplary embodiment, the disease is a hospital-acquired infection. In an exemplary embodiment, the disease is associated with a Serratia species. In another exemplary embodiment, the disease is a member selected from a urinary tract infection, skin and skin-structure infection and pneumonia. In an exemplary embodiment, the disease is associated with a Vibrio species. In another exemplary embodiment, the disease is a member selected from cholera and gastroenteritis. In an exemplary embodiment, the disease is associated with a Campylobacter species. In another exemplary embodiment, the disease is gastroenteritis. In an exemplary embodiment, the disease is associated with a Helicobacter species.
  • the disease is chronic gastritis.
  • the disease is associated with a Pseudomonas species.
  • the disease is a member selected from pneumonia, osteomylitis, burn-wound infections, sepsis, UTIs, endocarditis, otitis, corneal infections.
  • the disease is associated with a Bacteroides species.
  • the disease is a member selected from periodontal disease and aspriation pneumonia.
  • the disease is associated with a Haemophilus species.
  • the disease is a member selected from meningitis, epiglottitis, septic arthritis, sepsis, chancroid and vaginitis.
  • the disease is associated with a Bordetella species.
  • the disease is Whooping cough.
  • the disease is associated with a Legionella species.
  • the disease is a member selected from pneumonia and pontiac fever.
  • the disease is associated with a Francis ella species.
  • the disease is tularemia.
  • the disease is associated with a Brucella species.
  • the disease is brucellosis.
  • the disease is associated with a Pasteur ella species. In another exemplary embodiment, the disease is a skin infection. In an exemplary embodiment, the disease is associated with a Gardner ella species. In another exemplary embodiment, the disease is vaginitis. In an exemplary embodiment, the disease is associated with a Spirochetes species. In another exemplary embodiment, the disease is syphilis and Lyme disease. In an exemplary embodiment, the disease is associated with a Chlamydia species. In another exemplary embodiment, the disease is chlamydia. In an exemplary embodiment, the disease is associated with a Rickettsiae species. In another exemplary embodiment, the disease is a member selected from Rocky Mountain spotted fever and typhus.
  • the disease is associated with Mycoplasma pneumoniae.
  • the disease is a member selected from tracheobronchitis and walking pneumonia.
  • the disease is associated with Ureaplasma urealyticum.
  • the disease is urethritis.
  • the disease is pyelonenephritis.
  • the disease is an intraabdominal infection.
  • the disease is febrile neutropenia.
  • the disease is a pelvic infection.
  • the disease is bacteraemia.
  • the disease is septicaemia.
  • the compound administered has a structure which is a member selected from
  • R is H.
  • the invention provides a method of treating or preventing an ungual and/or periungual disease.
  • the method includes administering to the animal a therapeutically effective amount of a compound or pharmaceutical formulation of the invention, sufficient to treat or prevent said disease.
  • the method includes administering the compound or pharmaceutical formulation of the invention at a site which is a member selected from the skin, nail, hair, hoof, claw and the skin surrounding the nail, hair, hoof and claw.
  • the compound is a member selected from
  • Onychomycosis is a disease of the nail caused by yeast, dermatophytes, or other molds, and represents approximately 50% of all nail disorders. Toenail infection accounts for approximately 80% of onychomycosis incidence, while fingernails are affected in about 20% of the cases. Dermatophytes are the most frequent cause of nail plate invasion, particularly in toenail onychomycosis. Onychomycosis caused by a dermatophyte is termed Tinea unguium. Trichophyton rubrum is by far the most frequently isolated dermatophyte, followed by T. mentagrophytes.
  • Distal subungual onychomycosis is the most common presentation of tinea unguium, with the main site of entry through the hyponychium (the thickened epidermis underneath the free distal end of a nail) progressing in time to involve the nail bed and the nail plate.
  • Discoloration, onycholysis, and accumulation of subungual debris and nail plate dystrophy characterize the disease.
  • the disease adversely affects the quality of life of its victims, with subject complaints ranging from unsightly nails and discomfort with footwear, to more serious complications including secondary bacterial infections.
  • antibiotics e.g., nystatin and amphotericin B
  • imidazole anti-fungal agents such as miconazole, clotrimazole, fluconazole, econazole and sulconazole
  • non-imidazole fungal agents such as the allylamine derivatives terbinafme and naftifine, and the benzylamine butenafme.
  • onychomycosis has proven to be resistant to most treatments.
  • Nail fungal infections reside in an area difficult to access by conventional topical treatment and anti-fungal drugs cannot readily penetrate the nail plate to reach the infection sites under the nail. Therefore, onychomycosis has traditionally been treated by oral administration of anti-fungal drugs; however, clearly this is undesirable due to the potential for side effects of such drugs, in particular those caused by the more potent anti-fungal drugs such as itraconazole and ketoconazole.
  • An alternative method of treatment of onychomycosis is by removal of the nail before treating with a topically active anti-fungal agent; such a method of treatment is equally undesirable.
  • Systemic antimycotic agents require prolonged use and have the potential for significant side effects.
  • the invention provides a method of treating or preventing onychomycosis.
  • the method includes administering to an animal a therapeutically effective amount of a compound of the invention, sufficient to treat or prevent onychomycosis.
  • the method includes administering the compound of the invention at a site which is a member selected from the skin, nail, hair, hoof, claw and the skin surrounding the nail, hair, hoof and claw.
  • the animal is a human.
  • the compound of the invention is a compound described herein.
  • the compound is a member selected from
  • the invention provides a method of treating or preventing an ungual or periungual disease in an animal. This method comprising administering to the animal a therapeutically effective amount of a compound of the invention, thereby treating or preventing the ungual or periungual disease.
  • the ungual or periungual disease is a member selected from: chloronychia, paronychias, erysipeloid, onychorrhexis, gonorrhea, swimming-pool granuloma, larva migrans, leprosy, Orf nodule, milkers' nodules, herpetic whitlow, acute bacterial perionyxis, chronic perionyxis, sporotrichosis, syphilis, tuberculosis verrucosa cutis, tularemia, tungiasis, peri- and subungual warts, zona, nail dystrophy (trachy onychia), and dermatological diseases with an effect on the nails, such as psoriasis, pustular psoriasis, alopecia aerata, parakeratosis pustulosa, contact dermatosis, Reiter's syndrome, psoriasiform
  • the compounds and pharmaceutical formulations of the invention useful for ungual and periungual applications also find application in the cosmetics field, in particular for the treatment of irregularities of the nails, koilonychias, Beau's lines, longitudinal ridging, ingrown nails.
  • the disease is of the skin, nail, hair, claw or hoof, hair, ear and eye and is a member selected from Sporotrichosis, Mycotic keratitis, Extension oculomycosis, Endogenous oculomycosis, Lobomycosis, Mycetoma, Piedra, Pityriasis versicolor, Tinea corporis, Tinea cruris, Tinea pedis, Tinea barbae, Tinea capitis, Tinea nigra, Otomycosis, Tinea favosa, Chromomycosis, and Tinea Imbricata.
  • the compound useful for treating these diseases is a compound of the invention.
  • the compound of the invention has a structure which is a member selected from
  • R is H.
  • the compounds of the invention are useful for the treatment of diseases of animals (such as humans), involving viruses.
  • the disease is a member selected from hepatitis A - B - C, yellow fever, respiratory syncytial, influenza, AIDS, herpes simplex, chicken pox, varicella zoster, and Epstein-Barr disease.
  • the compound is a member selected from
  • R is H.
  • the compounds of the invention are useful for the treatment of diseases of animals (such as humans), involving parasites.
  • the disease is a member selected from malaria, Chagas' disease, Leishmaniasis, African sleeping sickness (African human trypanosomiasis), giardiasis, toxoplasmosis, amebiasis and cryptosporidiosis.
  • the aminoacyl tRNA synthetase is an aminoacyl tRNA synthetase comprising an editing domain.
  • the editing domain is encoded by a portion of the aminoacyl tRNA synthetase involved in proofreading.
  • the editing domain is preferably encoded by a DNA portion having at least conserved residues compared after alignment with the editing site of the leucyl-tRNA synthetase, valyl-tRNA synthetase and isoleucyl-tRNA synthetase.
  • the synthetase is selected from the group consisting of the valyl-tRNA synthetase, isoleucyl-tRNA synthetase, leucyl-tRNA synthetase, alanyl-tRNA synthetase, prolyl-tRNA synthetase, threonyl- tRNA synthetase, phenyl-tRNA synthetase and lysyl-tRNA synthetase which are known to have an editing site or domain (see for He RS Baldwin, A. N. and Berg, P. (1966) J. Biol. Chem. 241, 839-845 and Eldred, E. W.
  • the compound of the invention is a member selected from
  • compound is a member selected from H 2 and H 2 .
  • R is H.
  • the invention provides a method of killing or inhibiting growth of a microorganism present in a human nail unit, wherein said human nail unit comprises a nail plate.
  • the method comprising contacting a dorsal layer of the nail plate with a compound of the invention capable of penetrating the nail plate, traveling through the nail plate to a nail bed underlying said nail plate, and contacting said microorganism, under conditions sufficient for said compound to penetrate said nail plate.
  • the compound has a molecular weight of between about 100 Da and about 200 Da, a log P value of between about 1.0 and about 2.6, a water solubility greater than about 0.1 mg/mL octanol/saturated water, and an MIC of less than 16 ⁇ g/mL against said microorganism, thereby killing or inhibiting the growth of said microorganism.
  • the compound of the invention has a structure which is a member selected from
  • R is H.
  • the invention provides a method of treating a disease caused by a microorganism present in a human nail unit, wherein said human nail unit comprises a nail plate, said method comprising: contacting a dorsal layer of the nail plate with a compound of the invention capable of penetrating the nail plate, traveling through the nail plate to a nail bed underlying said nail plate, and contacting said microorganism, under conditions sufficient for said compound to penetrate said nail plate and to treat said disease.
  • the compound has a molecular weight of between about 100 Da and about 200 Da; a log P value of between about 1.0 and about 2.6; a water solubility greater than about 0.1 mg/mL octano I/saturated water, and an MIC of less than 16 ⁇ g/mL against said microorganism, thereby treating said disease.
  • the compound is described herein.
  • the invention provides a method of delivering a compound from the dorsal layer of the nail plate to the nail bed.
  • This method comprises contacting the cell with a compound of the invention capable of penetrating the nail plate, under conditions sufficient to penetrate the nail.
  • the compound has a molecular weight of between about 100 and about 200 Da.
  • the compound also has a log P value of between about 1.0 and about 2.6.
  • the compound additionally has a water solubility between about 0.1 mg/mL and 1 g/mL octano I/saturated water, thereby delivering said compound.
  • the physicochemical properties of the compound of the invention described by quantities predictive for migration of the compound through the nail plate, including, but not limited to, molecular weight, log P and solubility in water, and the like, are effective to provide substantial penetration of the nail plate.
  • the compound has a molecular weight of between 130 and 200. In another embodiment of this invention, the compound has a molecular weight of from about 140 to about 200 Da. In another embodiment of this invention, the compound has a molecular weight of from about 170 to about 200 Da. In another embodiment of this invention, the compound has a molecular weight of from about 155 to about 190 Da. In another embodiment of this invention, the compound has a molecular weight of from about 165 to about 185 Da. In another embodiment of this invention, the compound has a molecular weight of from about 145 to about 170 Da. In yet another embodiment the molecular weight is either 151.93 or 168.39 Da.
  • the compound has a log P value of between about -3.5 to about 2.5. In another exemplary embodiment, the compound has a log P value of from about -1.0 to about 2.5. In another exemplary embodiment, the compound has a log P value of from about -1.0 to about 2.0. In another exemplary embodiment, the compound has a log P value of from about -0.5 to about 2.5. In another exemplary embodiment, the compound has a log P value of from about -0.5 to about 1.5. In another exemplary embodiment, the compound has a log P value of from about 0.5 to about 2.5. In another exemplary embodiment, the compound has a log P value of from about 1.0 to about 2.5. In yet another exemplary embodiment, the compound has a log P value of 1.9 or 2.3.
  • Also contemplated by the present invention is a compound with a log P value less then 2.5, with a molecular weight less than 200 Da, that are still able to penetrate the nail plate.
  • the compound has a water solubility between about 0.1 mg/mL to 1 g/mL in octanol saturated water. In one embodiment of the present invention the compound has a water solubility of between 0.1 mg/mL and 100 mg/mL. In another embodiment of this invention, the compound has a water solubility of from about 0.1 mg/mL and 10 mg/mL. In another embodiment of this invention, the compound has a water solubility of from about 0.1 mg/mL and 1 mg/mL. In another embodiment of this invention, the compound has a water solubility of from about 5 mg/mL and 1 g/mL. In another embodiment of this invention, the compound has a water solubility of from about 10 mg/mL and 500 g/mL. In another embodiment of this invention, the compound has a water solubility of from about 80 mg/mL and 250 mg/mL.
  • the present invention provides a compound with a log P value selected from a range above, with a molecular weight selected from a range above, that are still able to penetrate the nail plate.
  • the present invention provides a compound with a molecular weight selected from a range above, with a water solubility selected from a range above, that are still able to penetrate the nail plate.
  • the present invention provides a compound with a log P selected from a range above, with a water solubility selected from a range above, that are still able to penetrate the nail plate.
  • the present invention provides a compound with a molecular weight selected from a range above, with a log P selected from a range above, and with a water solubility selected from a range above, that are still able to penetrate the nail plate.
  • Penetration of the nail by the active ingredient may be effected by the polarity of the formulation.
  • the polarity of the formulation is not expected have as much influence on nail penetration as some of the other factors, such as the molecular weight or the log P of the active ingredient.
  • the presence of penetration enhancing agents in the formulation is likely to increase penetration of the active agent when compared to similar formulations containing no penetration enhancing agent.
  • Compound 3 below is an example of a compound similar in molecular weight to ciclopirox, and like ciclopirox, penetrates the nail plate poorly.
  • the topical formulations including a compound of the invention has a total molecular weight of less than 200 Da, has a Log P of less than 2.5, and a minimum inhibitory concentration against Trichophyton rubrum that is substantially unchanged in the presence of 5% keratin.
  • the efficacy coefficient (defined as flux over MIC) of a compound also informs one of skill regarding whether the compound may be effective in killing a microorganism, inhibiting the growth of a microorganism, or treating a disease which is caused by a microorganism present in a human nail unit, wherein said human nail unit comprises a nail plate.
  • the method comprises: contacting a dorsal layer of the nail plate with a compound of the invention capable of penetrating the nail plate, traveling through the nail plate to a nail bed underlying said nail plate, and contacting said microorganism, under conditions sufficient for the compound to penetrate said nail plate and to treat said disease, wherein the compound has an efficacy coefficient above 10.
  • the compound has an efficacy coefficient between about 10 and about 1000. In an exemplary embodiment, the compound has an efficacy coefficient between about 30 and about 100. In an exemplary embodiment, the compound has an efficacy coefficient between about 100 and about 500. In an exemplary embodiment, the compound has an efficacy coefficient between about 25 and about 200. [0270]
  • the methods provided in this aspect of the invention are useful in the penetration of nails and hoofs, as well as the treatment of ungual and periungual conditions.
  • the invention is a pharmaceutical formulation which includes: (a) a pharmaceutically acceptable excipient; and (b) a compound of the invention.
  • the pharmaceutical formulation includes: (a) a pharmaceutically acceptable excipient; and (b) a compound according to a formula described herein.
  • the pharmaceutical formulation includes: (a) a pharmaceutically acceptable excipient; and (b) a compound described herein, or a salt, prodrug, hydrate or solvate thereof, or a combination thereof.
  • the pharmaceutical formulation includes: (a) a pharmaceutically acceptable excipient; and (b) a compound described herein, or a salt, hydrate or solvate thereof, or a combination thereof.
  • the pharmaceutical formulation includes: (a) a pharmaceutically acceptable excipient; and (b) a compound described herein, or a salt, hydrate or solvate thereof.
  • the pharmaceutical formulation includes: (a) a pharmaceutically acceptable excipient; and (b) a salt of a compound described herein.
  • the salt is a pharmaceutically acceptable salt.
  • the pharmaceutical formulation includes: (a) a pharmaceutically acceptable excipient; and (b) a prodrug of a compound described herein.
  • the pharmaceutical formulation includes: (a) a pharmaceutically acceptable excipient; and (b) a compound described herein.
  • the pharmaceutical formulation is a unit dosage form. In an exemplary embodiment, the pharmaceutical formulation is a single unit dosage form.
  • the invention is a pharmaceutical formulation comprising: (a) a pharmaceutically acceptable excipient; and (b) a compound having a structure which is a member selected from:
  • the invention is a pharmaceutical formulation comprising: (a) a pharmaceutically acceptable excipient; and (b) a compound having a structure which is a member selected from
  • R is H.
  • the pharmaceutical formulations of the invention can take a variety of forms adapted to the chosen route of administration. Those skilled in the art will recognize various synthetic methodologies that may be employed to prepare non-toxic pharmaceutical formulations incorporating the compounds described herein. Those skilled in the art will recognize a wide variety of non-toxic pharmaceutically acceptable solvents that may be used to prepare solvates of the compounds of the invention, such as water, ethanol, propylene glycol, mineral oil, vegetable oil and dimethylsulfoxide (DMSO).
  • DMSO dimethylsulfoxide
  • the pharmaceutical formulation of the invention may be administered orally, topically, parenterally, by inhalation or spray or rectally in unit dosage forms containing conventional non-toxic pharmaceutically acceptable carriers, adjuvants and vehicles. It is further understood that the best method of administration may be a combination of methods. Oral administration in the form of a pill, capsule, elixir, syrup, lozenge, troche, or the like is particularly preferred.
  • parenteral as used herein includes subcutaneous injections, intradermal, intravascular (e.g., intravenous), intramuscular, spinal, intrathecal injection or like injection or infusion techniques.
  • the pharmaceutical formulation of the invention is administered orally.
  • the pharmaceutical formulation of the invention is administered intravenously.
  • the pharmaceutical formulations containing compounds of the invention are preferably in a form suitable for oral use, for example, as tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsion, hard or soft capsules, or syrups or elixirs.
  • compositions intended for oral use may be prepared according to any method known in the art for the manufacture of pharmaceutical formulations, and such compositions may contain one or more agents selected from the group consisting of sweetening agents, flavoring agents, coloring agents and preserving agents in order to provide pharmaceutically elegant and palatable preparations.
  • Tablets may contain the active ingredient in admixture with non-toxic pharmaceutically acceptable excipients that are suitable for the manufacture of tablets.
  • excipients may be for example, inert diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example, corn starch, or alginic acid; binding agents, for example starch, gelatin or acacia; and lubricating agents, for example magnesium stearate, stearic acid or talc.
  • the tablets may be uncoated or they may be coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period.
  • a time delay material such as glyceryl monostearate or glyceryl distearate may be employed.
  • Formulations for oral use may also be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate or kaolin, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example peanut oil, liquid paraffin or olive oil.
  • an inert solid diluent for example, calcium carbonate, calcium phosphate or kaolin
  • water or an oil medium for example peanut oil, liquid paraffin or olive oil.
  • Aqueous suspensions contain the active materials in admixture with excipients suitable for the manufacture of aqueous suspensions.
  • excipients are suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethylcellulose, sodium alginate, polyvinylpyrrolidone, gum tragacanth and gum acacia; and dispersing or wetting agents, which may be a naturally-occurring phosphatide, for example, lecithin, or condensation products of an alkylene oxide with fatty acids, for example polyoxyethylene stearate, or condensation products of ethylene oxide with long chain aliphatic alcohols, for example heptadecaethyleneoxycetanol, or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol such as polyoxyethylene sorbitol monooleate, or condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides, for example polyethylene sorbito
  • the aqueous suspensions may also contain one or more preservatives, for example ethyl, or n-propyl p-hydroxybenzoate, one or more coloring agents, one or more flavoring agents, and one or more sweetening agents, such as sucrose or saccharin.
  • preservatives for example ethyl, or n-propyl p-hydroxybenzoate
  • coloring agents for example ethyl, or n-propyl p-hydroxybenzoate
  • flavoring agents for example ethyl, or n-propyl p-hydroxybenzoate
  • sweetening agents such as sucrose or saccharin.
  • Oily suspensions may be formulated by suspending the active ingredients in a vegetable oil, for example arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid paraffin.
  • the oily suspensions may contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol.
  • Sweetening agents such as those set forth above, and flavoring agents may be added to provide palatable oral preparations. These compositions may be preserved by the addition of an anti-oxidant such as ascorbic acid.
  • Dispersible powders and granules suitable for preparation of an aqueous suspension by the addition of water provide the active ingredient in admixture with a dispersing or wetting agent, suspending agent and one or more preservatives.
  • a dispersing or wetting agent e.g., sodium EDTA
  • suspending agent e.g., sodium EDTA
  • preservatives e.g., sodium EDTA, sodium bicarbonate, sodium bicarbonate
  • compositions of the invention may also be in the form of oil-in-water emulsions and water-in-oil emulsions.
  • the oily phase may be a vegetable oil, for example olive oil or arachis oil, or a mineral oil, for example liquid paraffin or mixtures of these.
  • Suitable emulsifying agents may be naturally-occurring gums, for example gum acacia or gum tragacanth; naturally-occurring phosphatides, for example soy bean, lecithin, and esters or partial esters derived from fatty acids and hexitol; anhydrides, for example sorbitan monooleate; and condensation products of the said partial esters with ethylene oxide, for example polyoxyethylene sorbitan monooleate.
  • the emulsions may also contain sweetening and flavoring agents.
  • Syrups and elixirs may be formulated with sweetening agents, for example glycerol, propylene glycol, sorbitol or sucrose. Such formulations may also contain a demulcent, a preservative, and flavoring and coloring agents.
  • the pharmaceutical formulations may be in the form of a sterile injectable aqueous or oleaginous suspension. This suspension may be formulated according to the known art using those suitable dispersing or wetting agents and suspending agents, which have been mentioned above.
  • the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol.
  • Suitable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution.
  • sterile, fixed oils are conventionally employed as a solvent or suspending medium.
  • any bland fixed oil may be employed including synthetic mono- or diglycerides.
  • fatty acids such as oleic acid find use in the preparation of injectables.
  • composition of the invention may also be administered in the form of suppositories, e.g., for rectal administration of the drug.
  • suppositories e.g., for rectal administration of the drug.
  • These compositions can be prepared by mixing the drug with a suitable non-irritating excipient that is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug.
  • suitable non-irritating excipient that is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug.
  • Such materials are cocoa butter and polyethylene glycols.
  • compositions can be administered parenterally in a sterile medium.
  • the drug depending on the vehicle and concentration used, can either be suspended or dissolved in the vehicle.
  • adjuvants such as local anesthetics, preservatives and buffering agents can be dissolved in the vehicle.
  • the composition containing the therapeutic compound may be added to the animal's feed or drinking water. Also, it will be convenient to formulate animal feed and drinking water products so that the animal takes in an appropriate quantity of the compound in its diet. It will further be convenient to present the compound in a composition as a premix for addition to the feed or drinking water. The composition can also added as a food or drink supplement for humans.
  • the amount of active ingredient that may be combined with the carrier materials to produce a unit dosage form will vary depending upon the condition being treated and the particular mode of administration. Unit dosage forms will generally contain between from about 1 mg to about 500 mg of an active ingredient.
  • Frequency of dosage may also vary depending on the compound used and the particular disease treated. However, for treatment of most disorders, a dosage regimen of 4 times daily or less is preferred. It will be understood, however, that the specific dose level for any particular patient will depend upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, route of administration and rate of excretion, drug combination and the severity of the particular disease undergoing therapy.
  • Preferred compounds of the invention will have desirable pharmacological properties that include, but are not limited to, oral bioavailability, low toxicity, low serum protein binding and desirable in vitro and in vivo half- lives. Penetration of the blood brain barrier for compounds used to treat CNS disorders is necessary, while low brain levels of compounds used to treat peripheral disorders are often preferred.
  • Assays may be used to predict these desirable pharmacological properties. Assays used to predict bioavailability include transport across human intestinal cell monolayers, including Caco-2 cell monolayers. Toxicity to cultured hepatocyctes may be used to predict compound toxicity. Penetration of the blood brain barrier of a compound in humans may be predicted from the brain levels of laboratory animals that receive the compound intravenously.
  • Serum protein binding may be predicted from albumin binding assays. Such assays are described in a review by Oravcova, et al. (Journal of Chromatography B (1996) volume 677, pages 1-27).
  • Compound half- life is inversely proportional to the frequency of dosage of a compound.
  • In vitro half- lives of compounds may be predicted from assays of microsomal half-life as described by Kuhnz and Gieschen (Drug Metabolism and Disposition, (1998) volume 26, pages 1120-1127).
  • compositions required for use in treatment will vary not only with the particular compound selected but also with the route of administration, the nature of the condition being treated and the age and condition of the patient and will ultimately be at the discretion of the attendant physician or clinician.
  • the pharmaceutical formulation excipient comprises ethanol and the pharmaceutical formulation compound is a member selected from
  • the compound is a member selected from - I n another exemplary embodiment, R is H.
  • the pharmaceutical formulation excipient comprises propylene glycol and the pharmaceutical formulation compound is a member selected from
  • the pharmaceutical formulation comprises: about propylene glycol: ethanol 1 :4, with 1 :10 wt/ volume of a compound which is a member selected from
  • the pharmaceutical formulation comprises: about 70% ethanol; about 20% poly( vinyl methyl ether-alt-maleic acid monobutyl ester); about 10% of a compound which is a member selected from
  • the pharmaceutical formulation comprises: about 56% ethanol; about 14% water; about 15% poly(2-hydroxyethyl methacrylate); about 5% dibutyl sebacate; about 10% of a compound which is a member selected from
  • the pharmaceutical formulation comprises: about 55% ethanol; about 15% ethyl acetate; about 15% polyvinyl acetate); about 5% dibutyl sebacate; about 10% of a compound which is a member selected from
  • R is H.
  • the pharmaceutical formulation in a concentration which is a member selected from 1%, 2.5%, 5%, 7.5%, 10% and 15% w/v.
  • the pharmaceutical formulation is a lacquer.
  • the pharmaceutical formulation excipient comprises ethanol and the pharmaceutical formulation compound is a compound described herein.
  • the pharmaceutical formulation excipient comprises propylene glycol and the pharmaceutical formulation compound is a compound described herein.
  • the pharmaceutical formulation comprises: about 20% propylene glycol; about 70% ethanol; about 10% of a compound described herein.
  • the pharmaceutical formulation comprises: about 70% ethanol; about 20% poly( vinyl methyl ether-alt- maleic acid monobutyl ester); about 10% of a compound described herein.
  • the pharmaceutical formulation comprises: about 56% ethanol; about 14% water; about 15% poly(2-hydroxyethyl methacrylate); about 5% dibutyl sebacate; about 10% of a compound described herein.
  • the pharmaceutical formulation comprises: about 55% ethanol; about 15% ethyl acetate; about 15% poly( vinyl acetate); about 5% dibutyl sebacate; about 10% of a compound described herein.
  • a compound described herein is present in a pharmaceutical formulation in a concentration which is a member selected from 1%, 2.5%, 5%, 7.5%, 10% and 15% w/v.
  • the pharmaceutical formulation is a lacquer.
  • the methods of the invention can be employed through the topical application of the compounds described herein.
  • the compound is a member selected from
  • R is H.
  • compositions of the present invention comprises fluid or semi-solid vehicles that may include but are not limited to polymers, thickeners, buffers, neutralizers, chelating agents, preservatives, surfactants or emulsifiers, antioxidants, waxes or oils, emollients, sunscreens, and a solvent or mixed solvent system.
  • the solvent or mixed solvent system is important to the formation because it is primarily responsible for dissolving the drug.
  • the best solvent or mixed solvent systems are also capable of maintaining clinically relevant levels of the drug in solution despite the addition of a poor solvent to the formulation.
  • the topical compositions useful in the subject invention can be made into a wide variety of product types.
  • compositions include, but are not limited to, lotions, creams, gels, sticks, sprays, ointments, pastes, foams, mousses, and cleansers.
  • product types can comprise several types of carrier systems including, but not limited to particles, nanoparticles, and liposomes.
  • disintegrating agents can be added, such as the cross-linked polyvinyl pyrrolidone, agar or alginic acid or a salt thereof such as sodium alginate. Techniques for formulation and administration can be found in Remington: The Science and Practice of Pharmacy, supra. The formulation can be selected to maximize delivery to a desired target site in the body.
  • Lotions which are preparations that are to be applied to the skin, nail, hair, claw or hoof surface without friction, are typically liquid or semi-liquid preparations in which finely divided solid, waxy, or liquid are dispersed. Lotions will typically contain suspending agents to produce better dispersions as well as compounds useful for localizing and holding the active agent in contact with the skin, nail, hair, claw or hoof, e.g., methylcellulose, sodium carboxymethyl-cellulose, or the like.
  • Creams containing the active agent for delivery according to the present invention are viscous liquid or semisolid emulsions, either oil-in-water or water-in-oil.
  • Cream bases are water- washable, and contain an oil phase, an emulsifier and an aqueous phase.
  • the oil phase is generally comprised of petrolatum or a fatty alcohol, such as cetyl- or stearyl alcohol; the aqueous phase usually, although not necessarily, exceeds the oil phase in volume, and generally contains a humectant.
  • the emulsif ⁇ er in a cream formulation as explained in Remington: The Science and Practice of Pharmacy, supra, is generally a nonionic, anionic, cationic or amphoteric surfactant.
  • Gel formulations can also be used in connection with the present invention. As will be appreciated by those working in the field of topical drug formulation, gels are semisolid. Single-phase gels contain organic macromolecules distributed substantially uniformly throughout the carrier liquid, which is typically aqueous, but also may be a solvent or solvent blend.
  • Ointments which are semisolid preparations, are typically based on petrolatum or other petroleum derivatives.
  • the specific ointment base to be used is one that provides for optimum delivery for the active agent chosen for a given formulation, and, preferably, provides for other desired characteristics as well, e.g., emolliency or the like.
  • an ointment base should be inert, stable, nonirritating and non- sensitizing. As explained in Remington: The Science and Practice of Pharmacy, 19th Ed.
  • ointment bases may be grouped in four classes: oleaginous bases; emulsif ⁇ able bases; emulsion bases; and water-soluble bases.
  • Oleaginous ointment bases include, for example, vegetable oils, fats obtained from animals, and semisolid hydrocarbons obtained from petroleum.
  • Emulsifiable ointment bases also known as absorbent ointment bases, contain little or no water and include, for example, hydroxystearin sulfate, anhydrous lanolin and hydrophilic petrolatum.
  • Emulsion ointment bases are either water-in-oil (W/O) emulsions or oil-in-water (O/W) emulsions, and include, for example, cetyl alcohol, glyceryl monostearate, lanolin and stearic acid.
  • W/O water-in-oil
  • O/W oil-in-water
  • Preferred water-soluble ointment bases are prepared from polyethylene glycols of varying molecular weight; again, reference may be had to Remington: The Science and Practice of Pharmacy, supra, for further information.
  • Sprays generally provide the active agent in an aqueous and/or alcoholic solution which can be misted onto the skin, nail, hair, claw or hoof for delivery.
  • Such sprays include those formulated to provide for concentration of the active agent solution at the site of administration following delivery, e.g., the spray solution can be primarily composed of alcohol or other like volatile liquid in which the drug or active agent can be dissolved.
  • the carrier evaporates, leaving concentrated active agent at the site of administration.
  • the topical pharmaceutical compositions may also comprise suitable solid or gel phase carriers.
  • suitable solid or gel phase carriers include but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols.
  • the topical pharmaceutical compositions may also comprise a suitable emulsifier which refers to an agent that enhances or facilitates mixing and suspending oil-in- water or water-in-oil.
  • a suitable emulsifier which refers to an agent that enhances or facilitates mixing and suspending oil-in- water or water-in-oil.
  • the emulsifying agent used herein may consist of a single emulsifying agent or may be a nonionic, anionic, cationic or amphoteric surfactant or blend of two or more such surfactants; preferred for use herein are nonionic or anionic emulsifiers.
  • Such surface-active agents are described in "McCutcheon's Detergent and Emulsifiers," North American Edition, 1980 Annual published by the McCutcheon Division, MC Publishing Company, 175 Rock Road, Glen Rock, N.J. 07452, USA.
  • Preferred for use herein are high molecular weight alcohols such as cetearyl alcohol, cetyl alcohol, stearyl alcohol, emulsifying wax, glyceryl monostearate.
  • Other examples are ethylene glycol distearate, sorbitan tristearate, propylene glycol monostearate, sorbitan monooleate, sorbitan monostearate (SPAN 60), diethylene glycol monolaurate, sorbitan monopalmitate, sucrose dioleate, sucrose stearate (CRODESTA F- 160), polyoxyethylene lauryl ether (BRIJ 30), polyoxyethylene (2) stearyl ether (BRIJ 72), polyoxyethylene (21) stearyl ether (BRIJ 721), polyoxyethylene monostearate (Myrj 45), polyoxyethylene sorbitan monostearate (TWEEN 60), polyoxyethylene sorbitan monooleate (TWEEN 80), polyoxyethylene sorbitan monolaurate (TW
  • nonionic emulsifying agents are those with hydrophile- lipophile balances (HLB) of about 3 to 6 for w/o system and 8 to 18 for o/w system as determined by the method described by Paul L. Lindner in "Emulsions and Emulsion", edited by Kenneth Lissant, published by Dekker, New York, N. Y., 1974, pages 188-190. More preferred for use herein are one or more nonionic surfactants that produce a system having HLB of about 8 to about 18.
  • HLB hydrophile- lipophile balances
  • nonionic emulsif ⁇ ers include but are not limited to "BRIJ 72", the trade name for a polyoxyethylene (2) stearyl ether having an HLB of 4.9; "BRIJ 721 ", the trade name for a polyoxyethylene (21) stearyl ether having an HLB of 15.5, “Brij 30", the trade name for polyoxyethylene lauryl ether having an HLB of 9.7; "Polawax”, the trade name for emulsifying wax having an HLB of 8.0; "Span 60”, the trade name for sorbitan monostearate having an HLB of 4.7; “Crodesta F-160”, the trade name for sucrose stearate” having an HLB of 14.5.
  • each emulsifying agent is present in amount from about 0.5 to about 2.5 wt%, preferably 0.5 to 2.0%, more preferably 1.0% or 1.8%.
  • the emulsifying agent comprises a mixture of steareth 21 (at about 1.8 %) and steareth 2 (at about 1.0%).
  • the topical pharmaceutical compositions may also comprise suitable emollients.
  • Emollients are materials used for the prevention or relief of dryness, as well as for the protection of the skin, nail, hair, claw or hoof.
  • Useful emollients include, but are not limited to, cetyl alcohol, isopropyl myristate, stearyl alcohol, and the like.
  • suitable emollients are known and can be used herein. See e.g., Sagarin, Cosmetics, Science and Technology, 2nd Edition, Vol. 1, pp. 32-43 (1972), and U.S. Pat. No. 4,919,934, to Deckner et al, issued Apr. 24, 1990, both of which are incorporated herein by reference in their entirety.
  • These materials are available from Ruger Chemical Co, (Irvington, NJ).
  • each emollient is present in an amount from about 0.1 to 15%, preferably 0.1 to about 3.0, more preferably 0.5, 1.0, or 2.5 wt%.
  • the emollient is a mixture of cetyl alcohol, isopropyl myristate and stearyl alcohol in a 1/5/2 ratio.
  • the emollient may also be a mixture of cetyl alcohol and stearyl alcohol in a 1 /2 ratio.
  • the topical pharmaceutical compositions may also comprise suitable antioxidants, substances known to inhibit oxidation.
  • Antioxidants suitable for use in accordance with the present invention include, but are not limited to, butylated hydroxytoluene, ascorbic acid, sodium ascorbate, calcium ascorbate, ascorbic palmitate, butylated hydroxyanisole, 2,4,5-trihydroxybutyrophenone, A- hydroxymethyl-2,6-di-tert-butylphenol, erythorbic acid, gum guaiac, propyl gallate, thiodipropionic acid, dilauryl thiodipropionate, tert-butylhydroquinone and tocopherols such as vitamin E, and the like, including pharmaceutically acceptable salts and esters of these compounds.
  • the antioxidant is butylated hydroxytoluene, butylated hydroxyanisole, propyl gallate, ascorbic acid, pharmaceutically acceptable salts or esters thereof, or mixtures thereof.
  • the antioxidant is butylated hydroxytoluene. These materials are available from Ruger Chemical Co, (Irvington, NJ).
  • the topical formulations of the present invention contain at least one antioxidant
  • the total amount of antioxidant present is from about 0.001 to 0.5 wt%, preferably 0.05 to about 0.5 wt%, more preferably 0.1%.
  • the topical pharmaceutical compositions may also comprise suitable preservatives.
  • Preservatives are compounds added to a pharmaceutical formulation to act as an anti-microbial agent.
  • preservatives known in the art as being effective and acceptable in parenteral formulations are benzalkonium chloride, benzethonium, chlorohexidine, phenol, m-cresol, benzyl alcohol, methylparaben, propylparaben, chlorobutanol, o-cresol, p-cresol, chlorocresol, phenylmercuric nitrate, thimerosal, benzoic acid, and various mixtures thereof. See, e.g., Wall Later, K.-H., Develop. Biol.
  • the preservative is selected from methylparaben, propylparaben and mixtures thereof. These materials are available from Inolex Chemical Co (Philadelphia, PA) or Spectrum Chemicals.
  • the topical formulations of the present invention contain at least one preservative
  • the total amount of preservative present is from about 0.01 to about 0.5 wt%, preferably from about 0.1 to 0.5%, more preferably from about 0.03 to about 0.15.
  • the preservative is a mixture of methylparaben and proplybarben in a 5/1 ratio.
  • the amount is usually 15 to 20%.
  • the topical pharmaceutical compositions may also comprise suitable chelating agents to form complexes with metal cations that do not cross a lipid bilayer.
  • suitable chelating agents include ethylene diamine tetraacetic acid (EDTA), ethylene glycol-bis(beta-aminoethyl ether)-N,N,N',N'-tetraacetic acid (EGTA) and 8- Amino-2- [(2-amino-5 -methylphenoxy)methyl] -6-methoxyquinoline- N,N,N',N'-tetraacetic acid, tetrapotassium salt (QUIN-2).
  • the chelating agents are EDTA and citric acid. These materials are available from Spectrum Chemicals.
  • the topical formulations of the present invention contain at least one chelating agent
  • the total amount of chelating agent present is from about 0.005% to 2.0% by weight, preferably from about 0.05% to about 0.5 wt%, more preferably about 0.1% by weight.
  • the topical pharmaceutical compositions may also comprise suitable neutralizing agents used to adjust the pH of the formulation to within a pharmaceutically acceptable range.
  • neutralizing agents include but are not limited to trolamine, tromethamine, sodium hydroxide, hydrochloric acid, citric acid, and acetic acid. Such materials are available from are available from Spectrum Chemicals (Gardena, CA).
  • the total amount of neutralizing agent present is from about 0.1 wt to about 10 wt %, preferably 0.1 wt % to about 5.0 wt%, and more preferably about 1.0 wt %.
  • the neutralizing agent is generally added in whatever amount is required to bring the formulation to the desired pH.
  • the topical pharmaceutical compositions may also comprise suitable viscosity increasing agents. These components are diffusible compounds capable of increasing the viscosity of a polymer-containing solution through the interaction of the agent with the polymer.
  • CARBOPOL ULTREZ 10 may be used as a viscosity- increasing agent. These materials are available from Noveon Chemicals, Cleveland, OH.
  • the topical formulations of the present invention contain at least one viscosity increasing agent
  • the total amount of viscosity increasing agent present is from about 0.25% to about 5.0% by weight, preferably from about 0.25% to about 1.0 wt%, and more preferably from about 0.4% to about 0.6% by weight.
  • the topical pharmaceutical compositions may also comprise suitable nail penetration enhancers.
  • nail penetration enhancers include mercaptan compounds, sulfites and bisulfites, keratolytic agents and surfactants.
  • Nail penetration enhancers suitable for use in the invention are described in greater detail in Malhotra et al., J. Pharm. ScL, 91:2, 312-323 (2002), which is incorporated herein by reference in its entirety.
  • the topical pharmaceutical compositions may also comprise one or more suitable solvents.
  • suitable solvents The ability of any solid substance (solute) to dissolve in any liquid substance (solvent) is dependent upon the physical properties of the solute and the solvent. When solutes and solvents have similar physical properties the solubility of the solute in the solvent will be the greatest. This gives rise to the traditional understanding that "like dissolves like.”
  • Solvents can be characterized in one extreme as non-polar, lipophilic oils, while in the other extreme as polar hydrophilic solvents. Oily solvents dissolve other non-polar substances by Van der WaIs interactions while water and other hydrophilic solvents dissolve polar substances by ionic, dipole, or hydrogen bonding interactions.
  • solvents can be listed along a continuum from the least polar, i.e. hydrocarbons such as decane, to the most polar solvent being water.
  • a solute will have its greatest solubility in solvents having equivalent polarity.
  • less polar solvents will provide improved solubility with the solvent having polarity nearly equivalent to the solute providing maximum solubility.
  • Most drugs have intermediate polarity, and thus experience maximum solubility in solvents such as propylene glycol or ethanol, which are significantly less polar than water.
  • the concentration of active ingredient in the formulation may be limited by the solubility of the active ingredient in the chosen solvent and/or carrier.
  • Non-lipophilic drugs typically display very low solubility in pharmaceutically acceptable solvents and/or carriers.
  • the solubility of some compounds in the invention in water is less than 0.00025% wt/wt.
  • the solubility of the same compounds in the invention can be less than about 2% wt/wt in either propylene glycol or isopropyl myristate.
  • diethylene glycol monoethyl ether (DGME) is the solvent used to dissolve the compounds of the invention.
  • the compounds in the invention useful in the present formulation are believed to have a solubility of from about 10% wt/wt to about 25% wt/wt in DGME.
  • a DGME water cosolvent system is used to dissolve the compounds of the invention.
  • the solvent capacity of DGME drops when water is added; however, the DGME/water cosolvent system can be designed to maintain the desired concentration of from about 0.1 % to about 5% wt/wt active ingredient.
  • the active ingredient is present from about 0.5 % to about 3% wt/wt, and more preferably at about 1% wt/wt, in the as-applied topical formulations.
  • DGME is less volatile than water, as the topical formulation evaporates upon application, the active agent becomes more soluble in the cream formulation. This increased solubility reduces the likelihood of reduced bioavailability caused by the drug precipitating on the surface of the skin, nail, hair, claw or hoof.
  • Liquid forms such as lotions suitable for topical administration or suitable for cosmetic application, may include a suitable aqueous or nonaqueous vehicle with buffers, suspending and dispensing agents, thickeners, penetration enhancers, and the like.
  • Solid forms such as creams or pastes or the like may include, for example, any of the following ingredients, water, oil, alcohol or grease as a substrate with surfactant, polymers such as polyethylene glycol, thickeners, solids and the like.
  • Liquid or solid formulations may include enhanced delivery technologies such as liposomes, microsomes, microsponges and the like.
  • the compounds can be delivered using a sustained-release system, such as semipermeable matrices of solid hydrophobic polymers containing the therapeutic agent.
  • sustained-release materials have been established and are well known by those skilled in the art.
  • Topical treatment regimens comprise applying the composition directly to the skin, nail, hair, claw or hoof at the application site, from one to several times daily.
  • Formulations of the present invention can be used to treat, ameliorate or prevent conditions or symptoms associated with bacterial infections, acne, inflammation and the like.
  • the pharmaceutical formulation includes a simple solution.
  • the simple solution includes an alcohol.
  • the simple solution includes alcohol and water.
  • the alcohol is ethanol, ethylene glycol, propanol, polypropylene glycol, isopropanol or butanol.
  • the simple solution is a member selected from about 10% polypropylene glycol and about 90% ethanol; about 20% polypropylene glycol and about 80% ethanol; about 30% polypropylene glycol and about 70% ethanol; about 40% polypropylene glycol and about 60% ethanol; about 50% polypropylene glycol and about 50% ethanol; about 60% polypropylene glycol and about 40% ethanol; about 70% polypropylene glycol and about 30% ethanol; about 80% polypropylene glycol and about 20% ethanol; about 90% polypropylene glycol and about 10% ethanol.
  • the pharmaceutical formulation is a lacquer. Please see Remington's, supra, for more information on the production of lacquers.
  • the compound is present in said pharmaceutical formulation in a concentration of from about 0.5% to about 15%. In an exemplary embodiment, the compound is present in said pharmaceutical formulation in a concentration of from about 0.1% to about 12.5%. In an exemplary embodiment, the compound is present in said pharmaceutical formulation in a concentration of from about 1% to about 10%. In an exemplary embodiment, the compound is present in said pharmaceutical formulation in a concentration of from about 1% to about 5%. In an exemplary embodiment, the compound is present in said pharmaceutical formulation in a concentration of from about 0.5% to about 5%. In an exemplary embodiment, the compound is present in said pharmaceutical formulation in a concentration of from about 0.5% to about 7.5%.
  • the compound is present in said pharmaceutical formulation in a concentration of from about 5% to about 7.5%. In an exemplary embodiment, the compound is present in said pharmaceutical formulation in a concentration of from about 2% to about 8%. In an exemplary embodiment, the compound is present in said pharmaceutical formulation in a concentration of from about 4% to about 9%.
  • Anti-inflammatory agents include, but are not limited to, bisabolol, mentholatum, dapsone, aloe, hydrocortisone, and the like.
  • Vitamins include, but are not limited to, Vitamin B, Vitamin E, Vitamin A, Vitamin D, and the like and vitamin derivatives such as tazarotene, calcipotriene, tretinoin, adapalene and the like.
  • Anti-aging agents include, but are not limited to, niacinamide, retinol and retinoid derivatives, AHA, Ascorbic acid, lipoic acid, coenzyme Q lO, beta hydroxy acids, salicylic acid, copper binding peptides, dimethylaminoethyl (DAEA), and the like.
  • Sunscreens and or sunburn relief agents include, but are not limited to, PABA, jojoba, aloe, padimate-O, methoxycinnamates, proxamine HCl, lidocaine and the like.
  • Sunless tanning agents include, but are not limited to, dihydroxyacetone (DHA).
  • Psoriasis-treating agents and/or acne-treating agents include, but are not limited to, salicylic acid, benzoyl peroxide, coal tar, selenium sulfide, zinc oxide, pyrithione (zinc and/or sodium), tazarotene, calcipotriene, tretinoin, adapalene and the like.
  • Agents that are effective to control or modify keratinization including without limitation: tretinoin, tazarotene, and adapalene.
  • compositions comprising an compound/active agent of the invention, and optionally at least one of these additional agents, are to be administered topically.
  • this leads to the compounds of the invention and any other active agent working upon and treating the skin, nail, hair, claw or hoof.
  • any one of the topically applied active agents may also be delivered systemically by transdermal routes.
  • an additional cosmetically or pharmaceutically effective agent such as an anti-inflammatory agent, vitamin, anti-aging agent, sunscreen, and/or acne-treating agent, for example, is usually a minor component (from about 0.001 % to about 20% by weight or preferably from about 0.01 % to about 10% by weight) with the remainder being various vehicles or carriers and processing aids helpful for forming the desired dosing form.
  • Preferred compounds for use in the pharmeceutical formulations described herein will have certain pharmacological properties. Such properties include, but are not limited to, low toxicity, low serum protein binding and desirable in vitro and in vivo half-lives. Assays may be used to predict these desirable pharmacological properties. Assays used to predict bioavailability include transport across human intestinal cell monolayers, including Caco-2 cell monolayers. Serum protein binding may be predicted from albumin binding assays. Such assays are described in a review by Oravcova et al. (1996, J. Chromat. B677: 1-27). Compound half-life is inversely proportional to the frequency of dosage of a compound. In vitro half- lives of compounds may be predicted from assays of microsomal half- life as described by Kuhnz and Gleschen (Drug Metabolism and Disposition, (1998) volume 26, pages 1120-1127).
  • Toxicity and therapeutic efficacy of such compounds can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio between LD50 and ED50.
  • Compounds that exhibit high therapeutic indices are preferred.
  • the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in humans.
  • the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
  • the dosage can vary within this range depending upon the unit dosage form employed and the route of administration utilized. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. (See, e.g. Fingl et al., 1975, in "The Pharmacological Basis of Therapeutics", Ch
  • the therapeutically effective dose can be estimated initially from cell culture assays, as disclosed herein.
  • a dose can be formulated in animal models to achieve a circulating concentration range that includes the EC50 (effective dose for 50% increase) as determined in cell culture, i.e., the concentration of the test compound which achieves a half-maximal inhibition of bacterial cell growth.
  • EC50 effective dose for 50% increase
  • the compounds prepared by the methods, and from the intermediates, described herein will be administered in a therapeutically or cosmetically effective amount by any of the accepted modes of administration for agents that serve similar utilities. It will be understood, however, that the specific dose level for any particular patient will depend upon a variety of factors including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, route of administration, and rate of excretion, drug combination, the severity of the particular disease undergoing therapy and the judgment of the prescribing physician.
  • the drug can be administered from once or twice a day, or up to 3 or 4 times a day.
  • Dosage amount and interval can be adjusted individually to provide plasma levels of the active moiety that are sufficient to maintain bacterial cell growth inhibitory effects.
  • Usual patient dosages for systemic administration range from 0.1 to 1000 mg/day, preferably, 1-500 mg/day, more preferably 10 - 200 mg/day, even more preferably 100 - 200 mg/day. Stated in terms of patient body surface areas, usual dosages range from 50-91 mg/m 2 /day.
  • the amount of the compound in a formulation can vary within the full range employed by those skilled in the art.
  • the formulation will contain, on a weight percent (wt%) basis, from about 0.01-10 wt% of the drug based on the total formulation, with the balance being one or more suitable pharmaceutical excipients.
  • the compound is present at a level of about 0.1-3.0 wt%, more preferably, about 1.0 wt%.
  • the invention provides a compound having a structure according to the formula:
  • R* is a member selected from H and a negative charge
  • R 3 is a member selected from H, cyano, substituted or unsubstituted nitroalkyl and substituted or unsubstituted aminoalkyl
  • R a is a member selected from H and -YR 5 ; wherein Y is a member selected from O and S
  • R 5 is a member selected from H, substituted or unsubstituted alkyl and substituted or unsubstituted heteroalkyl; with the proviso that R a and R cannot both be H; with the proviso that R a and R*, together with the atoms to which they are attached, are optionally combined to form a 6- to 10-membered substituted or unsubstituted heterocycloalkyl ring; and with the proviso that when R 3 is H, R a does not have a structure which is a member selected from: unsubstituted benzyloxy, -OCH 2 COOH, me
  • C* is a carbon atom with the proviso that when R 3 is not H, C* is a stereocenter which has a configuration which is a member selected from (R) and (S).
  • R 3 is-(CR 20 R 21 ⁇ NR 22 R 23 in which n is an integer selected from 1 to 10; each R 20 and each R 21 is a member independently selected from H, R 26 ,OR 26 , NR 26 R 27 , SR 26 , - S(O)R 26 , -S(O) 2 R 26 , -S(O) 2 NR 26 R 27 , -C(O)R 27 , -C(O)OR 27 , -C(O)NR 26 R 27 ; R 22 and R 23 are members independently selected from H, -S(O)R 28 , -S(O) 2 R 28 , -S(O) 2 NR 28 R 29 , -C(O)R 28 , -C(O)OR 28 , -C(O)NR 28 R 29 , nitro, halogen, substituted or unsubstituted alkyl, substituted or unsubsti
  • n is an integer selected from 1 to 5.
  • n 1
  • R 20 is substituted or unsubstituted alkyl.
  • R 20 is unsubstituted alkyl.
  • R 20 is C 1 -C 4 unsubstituted alkyl.
  • R 20 is methyl
  • R 21 is H.
  • R 23 is H.
  • R 3 is a member selected from cyano and -CH 2 NO 2 .
  • R 22 is a member selected from -C(O)R 28 and -C(O)OR 28 .
  • R 28 is a member selected from substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl and substituted or unsubstituted aryl.
  • R 28 is a member selected from -(CR 30 R 31 ⁇ R 32 , wherein R 32 is a member selected from substituted or unsubstituted aryl, -NR 33 R 34 and OR 33 wherein m is an integer selected from 0 to 10; each R 33 and each R 34 is a member independently selected from H, nitro, halogen, cyano, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • R 28 is a member selected from
  • R 5 is:
  • a is a member selected from 1 to 10; each R 10 and each R 11 is a member selected from H, substituted or unsubstituted alkyl, OH and NH 2 ; R 12 is a member selected from H, R 7 , halogen, cyano, amidino, OR 7 , NR 7 R 8 , SR 7 , - N(R 7 )S(O) 2 R 8 , -C(O)R 7 , -C(O)OR 7 , -C(O)NR 7 R 8 ; wherein each R 7 and each R 8 is a member independently selected from H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • a is an integer selected from 1 to 5. [0363] In an exemplary embodiment, according to any of the above paragraphs, a is an integer selected from 2 to 4.
  • each R 10 and each R 11 is a member selected from H, substituted or unsubstituted alkyl, OH and NH 2 .
  • each R 10 and each R 11 is a member selected from H, hydroxyalkyl and NH 2 .
  • At least one R 10 or R 11 is a member selected from hydroxyalkyl and NH 2 .
  • each R 10 and each R 11 is H.
  • R 12 is a member selected from H, cyano, amidino, -N(R 7 )S(O) 2 R 8 , OR 7 , NR 7 R 8 , - C(O)OR 7 , -C(O)NR 7 R 8 ; each R 7 and each R 8 is a member independently selected from H substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
  • each R 7 and each R 8 is a member independently selected from H, -C(O)R 9 , - C(O)NHR 9 , substituted or unsubstituted C1-C4 alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl; wherein R 9 is substituted or unsubstituted Ci-C 4 alkyl.
  • At least one member selected from R 7 and R 8 is a member independently selected from - C(O)R 9 and -C(O)NHR 9 ; wherein R 9 is substituted or unsubstituted C 1 -C 4 alkyl.
  • R 12 is a member selected from OH, NH 2 , methyl, ethyl, -NHS(O) 2 CHs, cyano, - NHC(O)CH 3 , -NHC(O)NHCH 2 CH 3 , -C(O)NH 2 , -C(O)OH, 4-(methoxy)phenyl, benzyl, -NHC(O)OCH 2 Ph, -C(O)NHCH 2 CH 2 OH and -C(NH 2 )(NH).
  • R 12 when R 12 comprises OR 7 , said R 7 comprises a hydroxy-protecting group; and when R 12 comprises NR 7 R 8 , at least one of said R 7 or R 8 comprises an amino-protecting group.
  • R 3 is a member selected from H, -CH 2 NH 2 and -CH 2 NO 2 ; and R 12 is a member selected from OH, NH 2 , methyl, ethyl, -NHS(O) 2 CH 3 , cyano, -NHC(O)CH 3 , - NHC(O)NHCH 2 CH 3 , -C(O)NH 2 , -C(O)OH, 4-(methoxy)phenyl, benzyl, - NHC(O)OCH 2 Ph, -C(O)NHCH 2 CH 2 OH and -C(NH 2 )(NH).
  • R 3 is a member selected from H, -CH 2 NH 2 and -CH 2 NO 2 ; and R a is a member selected from H, -O(CH 2 ) 3 NH 2 , -O(CH 2 ) 3 OH, -OCH 2 CH 3 , -O(CH 2 ) 3 NHS(O) 2 CH 3 , - O(CH 2 ) 3 CN, -O(CH 2 ) 3 NHC(O)CH 3 , -O(CH 2 ) 3 NHCH 3 , -O(CH 2 ) 3 OCH 3 , -O(CH 2 ) 4 OH, -OCH 3 , -O(CH 2 ) 3 NHC(O)NHCH 2 CH 3 , -O(CH 2 ) 3 C(O)NH 2 , -O(CH 2 ) 3 C(O)OH, - O(CH 2 ) 4 NH 2 ,
  • R a is a member selected from -O(CH 2 ) 3 NH 2 , -O(CH 2 ) 3 NHS(O) 2 CH 3 , - O(CH 2 ) 3 CN, -O(CH 2 ) 3 NHC(O)CH 3 , -O(CH 2 ) 3 NHCH 3 , -O(CH 2 ) 4 OH, - O(CH 2 ) 3 NHC(O)NHCH 2 CH 3 , -O(CH 2 ) 3 C(O)NH 2 , -O(CH 2 ) 3 C(O)OH, -O(CH 2 ) 4 NH 2 , - O(CH 2 ) 2 NH 2 , -OCH 2 CH 2 CH(NH 2 )CH 2 OH, -OCH 2 Ph(4-methoxy), -O(CH 2 ) 4 OCH 2 Ph, -OCH 2 C
  • R a is a member selected from -O(CH 2 ) 3 NH 2 , -O(CH 2 ) 3 NHS(O) 2 CH 3 , - O(CH 2 ) 3 CN, -O(CH 2 ) 3 NHC(O)CH 3 , -O(CH 2 ) 3 NHCH 3 , -O(CH 2 ) 4 OH, - O(CH 2 ) 3 NHC(O)NHCH 2 CH 3 , -O(CH 2 ) 3 C(O)NH 2 , -O(CH 2 ) 3 C(O)OH, -O(CH 2 ) 4 NH 2 , - O(CH 2 ) 2 NH 2 , -OCH 2 CH 2 CH(NH 2 )CH 2 OH; when R 3 is -CH 2 NH 2 , R a is a member selected from H, -O(CH 2 ) 3 NH 2 , -O(CH 2 ) 3 NHS(O) 2 CH 3 ,
  • R a is a member selected from -O(CH 2 ) 3 NH 2 , -O(CH 2 ) 3 CN, - O(CH 2 ) 3 NHC(O)CH 3 , -O(CH 2 ) 3 NHCH 3 ; and when R 3 is -CH 2 NH 2 , R a is a member selected from H, -O(CH 2 ) 3 OH, and -OCH 2 CH 3 .
  • the invention provides a compound having a structure according to a formula which is a member selected from:
  • R* is a member selected from H and a negative charge
  • R q is a member selected from H and -SO 2 -R b
  • R b is a member selected from unsubstituted phenyl and unsubstituted pyridinyl
  • R is a member selected from H, cyano, substituted or unsubstituted nitroalkyl and substituted or unsubstituted aminoalkyl; or a salt thereof.
  • C* is a carbon atom; with the proviso that when R is not H, C* is a stereocenter which has a configuration which is a member selected from (R) and (S).
  • R 3 is a member selected from H, -CH 2 NH 2 and -CH 2 NO 2 .
  • R* is H.
  • said alkyl is a member selected from linear alkyl and branched alkyl
  • said heteroalkyl is a member selected from linear heteroalkyl and branched heteroalkyl
  • the invention provides a composition comprising: a) a first stereoisomer of the compound described herein, wherein R is not H; b) at least one additional stereoisomer of the first stereoisomer; wherein the first stereoisomer is present in an enantiomeric excess of at least 80% relative to said at least one additional stereoisomer.
  • said enantiomeric excess is at least 92%.
  • the C* stereocenter of the first stereoisomer is in a (S) configuration.
  • R is -CH 2 NH 2 .
  • the invention provides a composition comprising a compound described herein, wherein R is not H and the C* stereocenter is in a (S) configuration, and said composition is substantially free of the enantiomer of the compound.
  • the invention provides a composition comprising a compound described herein, wherein the composition is substantially free of the enantiomer of the compound. [0391] In an exemplary embodiment, according to any of the above paragraphs, the invention provides a combination comprising a compound described herein, or a pharmaceutically acceptable salt thereof, together with at least one other therapeutically active agent.
  • the combination is a unit dosage form.
  • the invention provides a pharmaceutical formulation comprising: a) a compound described herein, or a pharmaceutically acceptable salt thereof; and b) a pharmaceutically acceptable excipient.
  • the pharmaceutical formulation is a unit dosage form.
  • the invention provides a method of inhibiting an enzyme, comprising: contacting the enzyme with the compound described herein, thereby inhibiting the enzyme.
  • the invention provides a method of inhibiting an enzyme, comprising: contacting the enzyme with a pharmaceutical formulation described herein, thereby inhibiting the enzyme.
  • the enzyme is a t-RNA synthetase which comprises an editing domain.
  • the enzyme is a leucyl t-RNA synthetase.
  • the invention provides a method of killing and/or preventing the growth of a microorganism, comprising: contacting the microorganism with an effective amount of the compound described herein, thereby killing and/or preventing the growth of the microorganism.
  • the invention provides a method of killing and/or preventing the growth of a microorganism, comprising: contacting the microorganism with an effective amount of the pharmaceutical formulation described herein, thereby killing and/or preventing the growth of the microorganism.
  • the microorganism is a bacterium.
  • the invention provides a method of treating and/or preventing a disease in an animal, comprising: administering to the animal a therapeutically effective amount of a compound described herein, or a pharmaceutically-acceptable salt thereof, thereby treating and/or preventing the disease.
  • the invention provides a method of treating and/or preventing a disease in an animal, comprising: administering to the animal a therapeutically effective amount of a pharmaceutical formulation described herein, or a pharmaceutically-acceptable salt thereof, thereby treating and/or preventing the disease.
  • the disease is pneumonia.
  • the animal is a human.
  • the salt is a pharmaceutically acceptable salt.
  • Mass spectra were recorded on a Waters MS consisting of an Alliance 2795 (LC) and Waters Micromass ZQ detector at 120 0 C.
  • the mass spectrometer was equipped with an electrospray ion source (ESI) operated in a positive or negative mode.
  • Elemental Analysis for C, H and N composition was performed using a Costech Instrument Elemental Combustion System ECS4010 with a helium flow of 100 mL/min (14 psi), oxygen 20 mL/min (10 psi), air 25 psi and purge of 50 mL/min. The reported analyses are an average of two runs.
  • HPLC analyses were performed on a Water 600 Controller system with a Waters 717 Plus Autosampler and a Waters 2996 Photodiode Array Detector.
  • the column used was an ACE C 18 , 5 ⁇ m, 4.6 x 150 mm.
  • a linear gradient was applied, starting at 95% A (A: 0.1% H 3 PO 4 in water) and ending at 90% B (B: MeCN) over 6 min and then maintained at 90% B until the 10 min mark.
  • the column was then re- equilibrated over 3 min to 95:5 with a total run time of 20 min.
  • the column temperature was at rt with the flow rate of 1.0 mL/min.
  • the Diode Array Detector was scanned from 200-400 nm.
  • TLC Thin layer chromatography
  • Alugram ® Silica gel 60 F254 from Mancherey-Nagel and UV was typically used to visualize the spots. Additional visualization methods were also employed in some cases.
  • the TLC plate was developed with iodine (generated by adding approximately 1 g of I 2 to 10 g silica gel and thoroughly mixing), vanillin (generated by dissolving about 1 g vanillin in 100 mL 10% H 2 SO 4 ), potassium permanganate (generated by dissolving 1.5 g KMnO 4 and 10 g K 2 CO 3 in 1.25 mL NaOH and 200 mL H 2 O), ninhydrin (available commercially from Aldrich), or Magic Stain (generated by thoroughly mixing 25 g (NH 4 ) 6 Mo 7 O 2 4*4H 2 O, 5 g (NH 4 ) 2 Ce(IV)(NO 3 ) 6 in 450 mL H 2 O and 50 mL cone H 2 SO 4 ) to
  • Flash chromatography was preformed using typically 40-63 ⁇ m (230-400 mesh) silica gel from Silicycle following analogous techniques to those disclosed by Still et al.
  • Typical solvents used for flash chromatography or thin layer chromatography (TLC) were mixtures of CHCl 3 /MeOH, CH 2 Cl 2 MeOH, EtOAc/MeOH and hexane/EtOAc.
  • Reverse phase flash chromatography were performed on a Biotage ® using a Biotage C 18 cartridges and a H 2 0/Me0H gradient (typically eluting from 5% MeOH/H 2 O to 90% MeOH/H 2 O).
  • Preparative chromatography was performed on either a Waters Prep LC 4000 System using a Waters 2487 Diode Array or on a Waters LC Module 1 plus.
  • the column used were either a Waters x Terra Prep C 18 , 5 ⁇ m, 30 x 100 mm, Phenomenex Luna C 18 , 5 ⁇ m, 21.6 x 250 mm, or a Phenomenex Gemini C 18 , 5 ⁇ m, 100 x 30 mm.
  • Narrow gradients with MeCNZH 2 O water containing either 0.1% TFA, 0.1% AcOH, 0.1% HCO 2 H or 0.1% NH 4 OAc) were used to elute the compound at a flow rate of approximately 20 mL/min and a total run time between 20-30 min.
  • Raney-nickel as the catalyst has the advantage of dramatically acceleraterating the reaction time, but is highly pyrophoric and needs to be kept moist to avoid fire hazard.
  • Large scale (25 g) reductions have been achieved in a Parr apparatus with palladium hydroxide catalyst and acetic acid as solvent. This methodology provides good yields and strikes a balance between the speed of Raney-nickel and the ease of use of palladium on carbon.
  • n-Butyl lithium (17.7 mL, 2.5 M in hexanes, 44.2 mmol, 1.15 eq) was added dropwise to the reaction mixture at -78°C and then stirred for 30 minutes at this temperature. The reaction mixture was then allowed to warm to room temperature where it was stirred for 3 hours before being quenched with 6 M HCl (30 mL). The reaction mixture was concentrated under reduced pressure and the resulting residue was subjected to flash column chromatography (20 % Et 2 O : petrol ether to 30 % Et 2 O : petrol ether) to give the product (5) as a viscous yellow oil (4.9 g, 67%).
  • n-Butyl lithium (43.5 mL, 2.5 M in hexanes, 108.8 mmol, 1.15 eq) was added dropwise to the reaction mixture at -78°C and then stirred for 30 minutes at this temperature. The reaction mixture was then allowed to warm to room temperature where it was stirred for 3 hours before being quenched with 6 M HCl (70 mL). The reaction mixture was concentrated under reduced pressure and the resulting residue was subjected to flash column chromatography (20 % Et 2 O : petrol ether to 30 % Et 2 O : petrol ether) to give the product (9) as a viscous orange oil (6.1 g, 34%).
  • BocAl was resolved via chiral HPLC using CHIRALPAK AY column and 10% ethanol / hexane as eluent @ 25 0 C. UV detection was monitored at 265nm. Two peaks (BocA2 and BocA60) were collected and evaporated to yellow oils. Analysis of the pooled fractions using a CHIRALPAK AY 4.6mm ID x 250mm analytical column and same mobile phase showed BocA2 [910mg (86.7% yield)] with a retention time of 3.998 min. and a 99.8% ee. BocA60 [600mg (57.1% yield)] had a retention time of 4.889 min and a 97.5% ee.
  • BocA2 (91 Omg) was dissolved in EtOAc (200 mL), treated with cone HCl and sonicated for 3hrs until a precipitate began to form. The reaction was cooled to - 10 0 C overnight and then filtered. An off-white solid was collected and air dried to 340 mg. This material was re-crystallized from aqueous acetonitrile to yield 242mg of white solid after drying.
  • Ethyl chloroformate (80 ⁇ L, 0.84 mmol) was added dropwise to a solution of A9 (105 mg, 0.44 mmol) and Et 3 N (0.32 mL, 2.3 mmol) in anhydrous THF (4 mL) at 0 0 C (bath temp). The solution was stirred at 0 0 C (bath temp) for 15 min and then 28% NH 4 OH (0.5 mL) was added resulting in the formation of a white precipitate. The suspension was stirred for a further 20 min at rt. The solid was isolated by filtration and then dissolved in H 2 O and lyophilized to give AlO (48 mg, 46%) as a white solid.
  • NMM (0.114 niL, 1.04 mmol) was added to a solution of Al 1 (0.120 g, 0.493 mmol) in DMF (1.0 mL) at 0 0 C (bath temp). After 1 h, Ac 2 O (56 ⁇ L, 0.59 mmol) was added and the mixture warmed to rt and stirred for 6 h. H 2 O (5 mL) was added and the mixture extracted with EtOAc (50 mL). The aqueous layer was acidified to pH 5 using a 2 N HCl and extracted with EtOAc (50 mL). The combined organic fractions were washed with brine (10 mL), dried (Na 2 SO 4 ), and concentrated in vacuo. The residue was precipitated from 1 : 1 EtOHZH 2 O to give the title compound as a white solid: yield 45 mg (37%).
  • Ethyl isocyanate (0.081 rnL, 1.04 mmol) was added to a suspension of NMM (0.170 rnL, 1.56 mmol) and Al 1 (0.126 g, 0.518 mmol) in THF (5 mL) at rt. The mixture was stirred O/N and then DMF (3 mL) was added. The cloudy solution was then stirred for an additional 24 h. The mixture was acidified to ⁇ pH 4 using 2 N HCl and then extracted with EtOAc. The organic layer was dried (Na 2 SO 4 ) and concentrated in vacuo. The residue was purified by preparative HPLC to give Al 4 as a light yellow solid: yield 45 mg (31%).
  • NMM (0.190 mL, 1.75 mmol) was added to a solution of methanesulfonyl chloride (0.081 mL, 1.05 mmol) and Al 1 (0.170 g, 0.700 mmol) in DMF (3 mL) at rt. The mixture was stirred O/N then H 2 O was added and the mixture extracted with EtOAc. The organic layer was washed with brine, dried (Na 2 SO 4 ), and concentrated in vacuo. The residue was purified by flash chromatography (50% EtOAc/hexane, then 5% MeOH/EtOAc). The residue was crystallized from EtOAc and washed with Et 2 O to give Al 5 as white crystals: yield 60 mg (30%).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Pulmonology (AREA)
  • Dermatology (AREA)
  • Urology & Nephrology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
PCT/US2008/067550 2007-06-20 2008-06-19 Boron-containing small molecules Ceased WO2008157726A1 (en)

Priority Applications (18)

Application Number Priority Date Filing Date Title
NO08825921A NO2164331T3 (https=) 2007-06-20 2008-06-19
ES08825921.3T ES2655299T3 (es) 2007-06-20 2008-06-19 Moléculas pequeñas que contienen boro
DK08825921.3T DK2164331T3 (da) 2007-06-20 2008-06-19 Borholdige små molekyler
KR1020167009966A KR101685656B1 (ko) 2007-06-20 2008-06-19 붕소를 함유하는 소분자
JP2010513416A JP5530923B2 (ja) 2007-06-20 2008-06-19 ホウ素含有小分子
CA2692135A CA2692135C (en) 2007-06-20 2008-06-19 Boron-containing small molecules
CN200880101464.4A CN101772302B (zh) 2007-06-20 2008-06-19 含硼小分子
BRPI0813450A BRPI0813450B8 (pt) 2007-06-20 2008-06-19 composto, formulação farmacêutica, e, usos do composto
MX2015007480A MX347688B (es) 2007-06-20 2008-06-19 Moleculas pequeñas que contienen boro.
EA200901617A EA020530B1 (ru) 2007-06-20 2008-06-19 Борсодержащие молекулы небольшого размера
AU2008265630A AU2008265630B2 (en) 2007-06-20 2008-06-19 Boron-containing small molecules
EP08825921.3A EP2164331B1 (en) 2007-06-20 2008-06-19 Boron-containing small molecules
KR1020157021997A KR20150100945A (ko) 2007-06-20 2008-06-19 붕소를 함유하는 소분자
NZ582706A NZ582706A (en) 2007-06-20 2008-06-19 1-Hydroxy-1,3-dihydro-benzo[c][1,2]oxaboroles and their derivatives
IL202379A IL202379A (en) 2007-06-20 2009-11-26 Benzoxaborols, their pharmaceutical preparations and their use in the preparation of bacteria to inhibit the growth of germs
ZA2009/09003A ZA200909003B (en) 2007-06-20 2009-12-17 Boron-containing small molecules
MA32517A MA31675B1 (fr) 2007-06-20 2010-01-15 Petites molecules contenant du bore
US12/848,051 US8895534B2 (en) 2007-06-20 2010-07-30 Boron containing small molecules

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US94529407P 2007-06-20 2007-06-20
US60/945,294 2007-06-20
US4117808P 2008-03-31 2008-03-31
US61/041,178 2008-03-31

Publications (1)

Publication Number Publication Date
WO2008157726A1 true WO2008157726A1 (en) 2008-12-24

Family

ID=40156702

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2008/067550 Ceased WO2008157726A1 (en) 2007-06-20 2008-06-19 Boron-containing small molecules

Country Status (29)

Country Link
US (4) US7816344B2 (https=)
EP (1) EP2164331B1 (https=)
JP (3) JP5530923B2 (https=)
KR (3) KR20150100945A (https=)
CN (2) CN101772302B (https=)
AR (1) AR067105A1 (https=)
AU (1) AU2008265630B2 (https=)
BR (1) BRPI0813450B8 (https=)
CA (1) CA2692135C (https=)
CL (1) CL2008001855A1 (https=)
CO (1) CO6251209A2 (https=)
CR (1) CR11224A (https=)
DK (1) DK2164331T3 (https=)
DO (1) DOP2009000281A (https=)
EA (1) EA020530B1 (https=)
ES (1) ES2655299T3 (https=)
IL (1) IL202379A (https=)
JO (1) JO3396B1 (https=)
MA (1) MA31675B1 (https=)
MX (1) MX347688B (https=)
MY (1) MY162692A (https=)
NO (1) NO2164331T3 (https=)
NZ (1) NZ582706A (https=)
PE (1) PE20090840A1 (https=)
SG (1) SG182219A1 (https=)
TW (1) TW200911822A (https=)
UY (1) UY31171A1 (https=)
WO (1) WO2008157726A1 (https=)
ZA (2) ZA200909003B (https=)

Cited By (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2011019618A1 (en) 2009-08-14 2011-02-17 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
WO2011019616A1 (en) 2009-08-14 2011-02-17 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
WO2011019612A1 (en) 2009-08-14 2011-02-17 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
WO2011037731A1 (en) * 2009-09-25 2011-03-31 Anacor Pharmaceuticals, Inc. Boron containing small molecules
WO2011049971A1 (en) 2009-10-20 2011-04-28 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
US8039451B2 (en) 2005-02-16 2011-10-18 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8039450B2 (en) 2008-03-06 2011-10-18 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
US8106031B2 (en) 2006-05-02 2012-01-31 Anacor Pharmaceuticals, Inc. Hydrolytically-resistant boron-containing therapeutics and methods of use
US8115026B2 (en) 2005-02-16 2012-02-14 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8168614B2 (en) 2006-02-16 2012-05-01 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
WO2012033858A3 (en) * 2010-09-07 2012-05-10 Anacor Pharmaceuticals, Inc. Benzoxaborole derivatives for treating bacterial infections
EP2378886A4 (en) * 2008-12-17 2012-08-29 Anacor Pharmaceuticals Inc POLYMORPHIC FORMS OF (S) -3-AMINOMETHYL-7- (3-HYDROXY-PROPOXY) -3H-BENZO [C] [1,2] OXABOROL-1-OL
US8343944B2 (en) 2009-07-28 2013-01-01 Anacor Pharmaceuticals, Inc. Trisubstituted boron-containing molecules
WO2013078071A1 (en) 2011-11-21 2013-05-30 Eli Lilly And Company Isoxazoline derivatives used in the control of ectoparasites
WO2013078070A1 (en) 2011-11-21 2013-05-30 Eli Lilly And Company Boron-containing small molecules
US8461134B2 (en) 2009-11-11 2013-06-11 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8461336B2 (en) 2008-09-04 2013-06-11 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
JP2013523826A (ja) * 2010-04-07 2013-06-17 グラクソスミスクライン エルエルシー ベンゾオキサボロールの調製方法
US8470803B2 (en) 2008-09-04 2013-06-25 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
WO2013093615A1 (en) 2011-12-22 2013-06-27 Micurx Pharmaceuticals, Inc. Tricyclic boron compounds for antimicrobial therapy
US8623911B2 (en) 2010-03-19 2014-01-07 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-protozoal agent
US8716478B2 (en) 2010-01-27 2014-05-06 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
WO2015016558A1 (ko) 2013-07-30 2015-02-05 동아에스티 주식회사 트리사이클릭 벤즈옥사보롤 화합물, 이의 제조방법 및 용도
WO2015121442A1 (en) * 2014-02-17 2015-08-20 Syngenta Participations Ag Microbiocidally active benzoxaboroles
US9138002B2 (en) 2013-01-30 2015-09-22 Agrofresh Inc. Compounds and compositions
WO2016001834A1 (en) 2014-07-01 2016-01-07 Daiichi Sankyo Company, Limited Tricyclic benzoxaboroles as antibacterial agents
KR20160038901A (ko) * 2013-08-09 2016-04-07 글락소스미스클라인 인털렉츄얼 프로퍼티 (넘버 2) 리미티드 트리시클릭 벤족사보롤 화합물 및 이의 용도
JP2016523234A (ja) * 2013-06-05 2016-08-08 アグロフレッシュ インコーポレイテッド 抗菌化合物および組成物
WO2016128949A1 (en) 2015-02-12 2016-08-18 Glaxosmithkline Intellectual Property (No.2) Limited Benzoxaborole compounds and uses thereof
US9426996B2 (en) 2013-01-30 2016-08-30 Agrofresh Inc. Use of benzoxaboroles as volatile antimicrobial agents on meats, plants, or plant parts
US9493489B2 (en) 2008-10-15 2016-11-15 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-protozoal agents
US9585396B2 (en) 2013-01-30 2017-03-07 Agrofresh Inc. Volatile applications against pathogens
US9796735B2 (en) 2007-06-20 2017-10-24 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
EP3212196A4 (en) * 2014-10-29 2018-07-11 Wisconsin Alumni Research Foundation Boronic acid inhibitors of hiv protease
US10070649B2 (en) 2013-01-30 2018-09-11 Agrofresh Inc. Volatile applications against pathogens
US10961261B2 (en) 2017-03-01 2021-03-30 Anacor Pharmaceuticals, Inc. Oxaborole analogs and uses thereof
US10966429B2 (en) 2016-03-07 2021-04-06 Agrofresh Inc. Synergistic methods of using benzoxaborole compounds and preservative gases as an antimicrobial for crops
US11039617B2 (en) 2013-01-30 2021-06-22 Agrofresh Inc. Large scale methods of uniformly coating packaging surfaces with a volatile antimicrobial to preserve food freshness
EA038093B1 (ru) * 2013-12-20 2021-07-05 Глаксосмитклайн Интеллекчуал Проперти (№2) Лимитед Способ лечения заболевания, вызванного инфекцией комплекса mycobacterium tuberculosis, с использованием (s)-(3-хлор-7,8-дигидро-2h-1,6,9-триокса-9a-борабензо[cd]азулен-2-ил)метанамина или его фармацевтически приемлемой соли
WO2022043936A1 (en) 2020-08-31 2022-03-03 Pfizer Inc. Methods of protecting rna
US11578087B2 (en) 2016-05-12 2023-02-14 Anacor Pharmaceuticals, Inc. Oxaborole esters and uses thereof
WO2023246842A1 (en) 2022-06-23 2023-12-28 Shanghai Micurx Pharmaceutical Co., Ltd. Prodrugs of boron compounds and their use in treating bacterial infections

Families Citing this family (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2285384A4 (en) * 2008-05-12 2012-04-25 Anacor Pharmaceuticals Inc BORN SMALL MOLECULES
WO2010132833A1 (en) * 2009-05-14 2010-11-18 The Regents Of The University Of Michigan Streptococcus vaccine compositions and methods of using the same
WO2011022337A1 (en) * 2009-08-19 2011-02-24 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
US8979820B2 (en) 2009-10-09 2015-03-17 Cynthia S. Bailey Method and apparatus for improving the appearance of nails affected by onychomycosis through the topical application of an aqueous solution containing boric acid and camphor or other terpenes
WO2013025975A1 (en) * 2011-08-17 2013-02-21 Glaxosmithkline Llc Combination treatments for hepatitis c
US9162999B2 (en) 2011-09-28 2015-10-20 Wisconsin Alumni Research Foundation Catalytic conversion of cellulose to fuels and chemicals using boronic acids
WO2013154759A1 (en) * 2012-04-14 2013-10-17 Anacor Pharmaceuticals, Inc. Benzoxaborole compounds and uses thereof
US8778365B1 (en) 2013-01-31 2014-07-15 Merz Pharmaceuticals, Llc Topical compositions and methods for making and using same
US9446131B2 (en) 2013-01-31 2016-09-20 Merz Pharmaceuticals, Llc Topical compositions and methods for making and using same
US9433680B2 (en) 2013-01-31 2016-09-06 Merz Pharmaceuticals, Llc Topical compositions and methods for making and using same
US9452173B2 (en) 2013-01-31 2016-09-27 Merz Pharmaceuticals, Llc Topical compositions and methods for making and using same
US9598443B2 (en) 2013-02-01 2017-03-21 Anacor Pharmaceuticals, Inc. Boron containing small molecules as antiprotozoal agents
US9737075B2 (en) * 2015-04-09 2017-08-22 The Penn State Research Foundation Synergistic benzoxaborole-containing anti-fungicidal composition
WO2017024022A1 (en) * 2015-08-06 2017-02-09 The Penn State Research Foundation Benzoxaborole-containing coating resistant to cellulose-supportable fungus
US10874679B2 (en) 2016-03-02 2020-12-29 Bill & Melinda Gates Foundation Boron-containing small molecules
WO2017151492A1 (en) 2016-03-02 2017-09-08 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
CN109195608B (zh) 2016-03-02 2021-05-11 比尔及梅琳达盖茨基金会 含硼小分子
CN107090000B (zh) * 2017-04-27 2019-07-12 上海交通大学 一种苯并硼唑7位脂肪酸的衍生物及其制备与用途
FI4265332T3 (fi) 2017-06-13 2025-05-21 Veterinary Diagnostics Inst Inc Järjestelmä ja menetelmä verinäytteiden stabiloimiseksi, säilyttämiseksi ja ottamiseksi talteen
MX2020005464A (es) * 2017-11-30 2020-12-03 Boragen Inc Compuestos de benzoxaborol y formulaciones de los mismos.
CA3120974A1 (en) * 2017-11-30 2019-06-06 Boragen, Inc. Combinatorial compositions of benzoxaboroles and biologic agents
WO2020041200A1 (en) 2018-08-18 2020-02-27 Boragen Inc. Solid forms of substituted benzoxaborole and compositions thereof
AR116305A1 (es) * 2018-09-07 2021-04-21 Boragen Inc Compuestos que contienen boro y sus usos
US11058695B2 (en) * 2019-11-08 2021-07-13 Myongji University Industry And Academia Cooperation Foundation Inhibitor of carbapenem-hydrolyzing class D beta-lactamases
CA3239096A1 (en) * 2022-06-23 2023-12-28 Shanghai Micurx Pharmaceutical Co., Ltd. Methods and uses of boron compounds in the treatment of nontuberculous mycobacterium infections and pharmaceutical compositions for treatment of same
US12482208B2 (en) 2023-05-30 2025-11-25 Snap Inc. Mirroring 3D assets for virtual experiences

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3873279A (en) 1972-08-11 1975-03-25 Ici Ltd Method for the control of micro-organisms
US4919934A (en) 1989-03-02 1990-04-24 Richardson-Vicks Inc. Cosmetic sticks
EP0765331A1 (en) 1994-06-09 1997-04-02 Zeneca Limited Oxaboroles and salts thereof, and their use as biocides
WO2005013892A2 (en) 2003-06-16 2005-02-17 Anacor Pharmaceuticals, Inc. Hydrolytically-resistant boron-containing therapeutics and methods of use
WO2006089067A2 (en) 2005-02-16 2006-08-24 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US20070155699A1 (en) 2005-02-16 2007-07-05 Anacor Pharmaceuticals Boron-containing small molecules
WO2007095638A2 (en) 2006-02-16 2007-08-23 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
WO2007146965A2 (en) 2006-06-12 2007-12-21 Anacor Pharmaceuticals, Inc. Compounds for the treatment of periodontal disease

Family Cites Families (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2260336A (en) 1939-10-16 1941-10-28 Dow Chemical Co Method of preparation of organic borates
US5962498A (en) 1986-06-11 1999-10-05 Procyon Pharmaceuticals, Inc. Protein kinase C modulators. C. indolactam structural-types with anti-inflammatory activity
US5594151A (en) 1994-01-28 1997-01-14 Prolinx, Inc. Phenylboronic acid complexing reagents derived from aminosalicylic acid
US6083903A (en) 1994-10-28 2000-07-04 Leukosite, Inc. Boronic ester and acid compounds, synthesis and uses
US5831046A (en) 1996-08-05 1998-11-03 Prolinx, Incorporated Boronic acid-contaning nucleic acid monomers
US6306628B1 (en) 1999-08-25 2001-10-23 Ambergen, Incorporated Methods for the detection, analysis and isolation of Nascent proteins
WO2001025226A1 (en) 1999-10-05 2001-04-12 Bethesda Pharmaceuticals, Inc. Dithiolane derivatives
AU7593001A (en) 2000-07-14 2002-01-30 Zycos Inc Alpha-msh related compounds and methods of use
US6537733B2 (en) * 2001-02-23 2003-03-25 Applied Materials, Inc. Method of depositing low dielectric constant silicon carbide layers
GB0117645D0 (en) 2001-07-19 2001-09-12 Isis Innovation Therapeutic stratergies for prevention and treatment of alzheimers disease
DE10143979A1 (de) 2001-09-07 2003-03-27 Clariant Gmbh Verfahren zur Herstellung von Bisallylboranen und nicht-aromatischen Boronsäuren
WO2003033002A1 (en) 2001-10-11 2003-04-24 Ono Pharmaceutical Co Intracellular calcium concentration increase inhibitors
EP1463739A2 (en) 2002-01-10 2004-10-06 The Pennsylvania State Research Foundation Methods for the preparation of alkyl diaryl borinates and complexed diarylborinic acids
US7138530B2 (en) * 2002-05-28 2006-11-21 3-Dimensional Pharmaceuticals, Inc. Thiophene amidines, compositions thereof, and methods of treating complement-mediated diseases and conditions
EP1755661B1 (en) 2004-05-12 2014-03-12 The Brigham And Women's Hospital, Inc. Gelsolin for use in treating infections
US20070286822A1 (en) 2006-06-12 2007-12-13 Anacor Pharmaceuticals Inc. Compounds for the Treatment of Periodontal Disease
DE102006038471A1 (de) 2006-08-17 2008-04-10 Wala-Heilmittel Gmbh Platanencreme, Verfahren zu ihrer Herstellung und Verwendung
JO3396B1 (ar) 2007-06-20 2019-10-20 Anacor Pharmaceuticals Inc جزيئات صغيرة تحتوي على البورون
EP2285384A4 (en) * 2008-05-12 2012-04-25 Anacor Pharmaceuticals Inc BORN SMALL MOLECULES

Patent Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3873279A (en) 1972-08-11 1975-03-25 Ici Ltd Method for the control of micro-organisms
US4919934A (en) 1989-03-02 1990-04-24 Richardson-Vicks Inc. Cosmetic sticks
EP0765331A1 (en) 1994-06-09 1997-04-02 Zeneca Limited Oxaboroles and salts thereof, and their use as biocides
WO2005013892A2 (en) 2003-06-16 2005-02-17 Anacor Pharmaceuticals, Inc. Hydrolytically-resistant boron-containing therapeutics and methods of use
WO2006089067A2 (en) 2005-02-16 2006-08-24 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US20060234981A1 (en) 2005-02-16 2006-10-19 Anacor Pharmaceuticals Boron-containing small molecules
US20070155699A1 (en) 2005-02-16 2007-07-05 Anacor Pharmaceuticals Boron-containing small molecules
WO2007078340A2 (en) 2005-12-30 2007-07-12 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
WO2007095638A2 (en) 2006-02-16 2007-08-23 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
US20070293457A1 (en) 2006-02-16 2007-12-20 Baker Stephen J Boron-containing small molecules as anti-inflammatory agents
WO2007146965A2 (en) 2006-06-12 2007-12-21 Anacor Pharmaceuticals, Inc. Compounds for the treatment of periodontal disease

Non-Patent Citations (33)

* Cited by examiner, † Cited by third party
Title
"Harrison's Principles of Internal Medicine", 1991, pages: 93 - 98
"McCutcheon's Detergent and Emulsifiers", 1980, MC PUBLISHING COMPANY
"POLYMERIC DRUGS AND DRUG DELIVERY SYSTEMS", vol. 469, 1991, AMERICAN CHEMICAL SOCIETY, article "ACS Symposium Series"
"Remington: The Science and Practice of Pharmacy", 1995, MACK PUBLISHING CO., pages: 1399 - 1404
"Remington: The Science and Practice of Pharmacy", 2005, LIPPINCOTT, WILLIAMS & WILKINS
ALA RS; TSUI, W. C.; FERSHT, A. R., NUCLEIC ACIDS RESEARCH, vol. 9, 1981, pages 7529 - 7539
BAKER S.J. ET AL.: "Discovery of a New Boron-Containing Antifungal Agent, 5-Fluoro-1,3-dihydro-1-hydroxy-2,1-benzoxaborole (AN2690), for the Potential Treatment of Onychomycosis", JOURNAL OF MEDICINAL CHEMISTRY, vol. 49, no. 15, 27 June 2006 (2006-06-27), pages 4447 - 4450, XP002416532 *
BERGE ET AL.: "Pharmaceutical Salts", JOURNAL OF PHARMACEUTICAL SCIENCE, vol. 66, 1977, pages 1 - 19, XP002675560, DOI: doi:10.1002/jps.2600660104
DALE WESLEY J ET AL.: "Journal of Organic Chemistry", vol. 27, 1 January 1962, AMERICAN CHEMICAL SOCIETY, article "Substituted styrenes. VII. Syntheses and some reactions of the vinylbenzeneboronic acids", pages: 2598 - 2603
ELDRED, E. W.; SCHIMMEL, P. R., J. BIOL. CHEM., vol. 247, 1972, pages 2961 - 2964
FERRER: "Targeting Aminoacyl-tRNA Synthetases for the Treatment of Fungal Infections", DRUG NEWS PERSPECT, vol. 19, no. 6, July 2006 (2006-07-01) - August 2006 (2006-08-01), pages 347 - 348, XP008104873 *
GEIDUSCHEK E. O.; TOCCHINI-VALENTINI: "Annu. Rev. Biochem.", vol. 57, 1988, article "Transcription by RNA polymerase III", pages: 873 914
J. BIOL. CHEM., vol. 241, 1966, pages 839 - 845
JAKUBOWSKI, H., BIOCHEMISTRY, vol. 36, 1997, pages 11077 - 11085
KUHNZ; GIESCHEN, DRUG METABOLISM AND DISPOSITION, vol. 26, 1998, pages 1120 - 1127
KUHNZ; GLESCHEN, DRUG METABOLISM AND DISPOSITION, vol. 26, 1998, pages 1120 - 1127
LAMPE J W ET AL.: "Journal of Medicinal Chemistry", vol. 45, 1 January 2002, AMERICAN CHEMICAL SOCIETY, article "Synthesis and protein kinase inhibitory activity of balanol analogues with modified benzophenone subunits", pages: 2624 - 2643
LEU RS; ENGLISH, S. ET AL., NUCLEIC ACIDS RESEARCH, vol. 14, no. 19, 1986, pages 7529 - 7539
MAEHR, J. CHEM. ED., vol. 62, 1985, pages 114 - 120
MALHOTRA ET AL., J. PHARM. SCI., vol. 91, no. 2, 2002, pages 312 - 323
MERRITT ET AL.: "Diffusion Apparatus for Skin Penetration", J OF CONTROLLED RELEASE, vol. 1, 1984, pages 161 - 162, XP023843582, DOI: doi:10.1016/0168-3659(84)90010-5
MUSIER-FORYTH, K.; BEUNING, P. J., NAT. STRUCT. BIOL., vol. 7, 2000, pages 435 - 436
ORAVCOVA ET AL., J. CHROMAT., vol. B677, 1996, pages 1 - 27
ORAVCOVA ET AL., JOURNAL OF CHROMATOGRAPHY B, vol. 677, 1996, pages 1 - 27
PAUL L. LINDNER: "Emulsions and Emulsion", 1974, DEKKER, pages: 188 - 190
PRO RS; BEUNING, P. J.; MUSIER- FORSYTH, K., PNAS, vol. 97, no. 16, 2000, pages 8916 - 8920
SAGARIN: "Cosmetics, Science and Technology", vol. 1, 1972, pages: 32 - 43
SANKARANARAYANAN, R. ET AL., NAT. STRUCT. BIOL., vol. 7, 2000, pages 461 - 465
SHARP S. J.; SCHAACK J.; COOLEN L.; BURKE D. J.; SOIL D.: "Structure and transcription of eukaryotic tRNA genes", CRIT. REV. BIOCHEM, vol. 19, 1985, pages 107 144
VAL RS; FERSHT, A. R.; KAETHNER, M. M., BIOCHEMISTRY, vol. 15, no. 15, 1976, pages 3342 - 3346
WALLHAUSSER, K.-H., DEVELOP. BIOL. STANDARD, vol. 24, 1974, pages 9 - 28
WILLIAMS ET AL., J. OF MEDICINAL CHEM., vol. 42, 1999, pages 1481 - 1485
YARUS, M., PNAS, vol. 69, 1972, pages 1915 - 1919

Cited By (99)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8115026B2 (en) 2005-02-16 2012-02-14 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US9353133B2 (en) 2005-02-16 2016-05-31 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US9566289B2 (en) 2005-02-16 2017-02-14 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US9566290B2 (en) 2005-02-16 2017-02-14 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US9549938B2 (en) 2005-02-16 2017-01-24 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8039451B2 (en) 2005-02-16 2011-10-18 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8889656B2 (en) 2005-02-16 2014-11-18 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8722917B2 (en) 2005-02-16 2014-05-13 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US9572823B2 (en) 2005-02-16 2017-02-21 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8440642B2 (en) 2005-02-16 2013-05-14 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8168614B2 (en) 2006-02-16 2012-05-01 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
US8501712B2 (en) 2006-02-16 2013-08-06 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
US9029353B2 (en) 2006-02-16 2015-05-12 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
US9682092B2 (en) 2006-02-16 2017-06-20 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
US8106031B2 (en) 2006-05-02 2012-01-31 Anacor Pharmaceuticals, Inc. Hydrolytically-resistant boron-containing therapeutics and methods of use
US10533021B2 (en) 2007-06-20 2020-01-14 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US9796735B2 (en) 2007-06-20 2017-10-24 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8461135B2 (en) 2008-03-06 2013-06-11 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
US9416146B2 (en) 2008-03-06 2016-08-16 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
US9012431B2 (en) 2008-03-06 2015-04-21 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
US8039450B2 (en) 2008-03-06 2011-10-18 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-inflammatory agents
US8461336B2 (en) 2008-09-04 2013-06-11 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8470803B2 (en) 2008-09-04 2013-06-25 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US9493489B2 (en) 2008-10-15 2016-11-15 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-protozoal agents
US8461364B2 (en) 2008-12-17 2013-06-11 Glaxosmithkline Llc Polymorphs of (S)-3-aminomethyl-7-(3-hydroxy-propoxy)-3H-benzo[C][1,2]oxaborol-1-OL
EP2378886A4 (en) * 2008-12-17 2012-08-29 Anacor Pharmaceuticals Inc POLYMORPHIC FORMS OF (S) -3-AMINOMETHYL-7- (3-HYDROXY-PROPOXY) -3H-BENZO [C] [1,2] OXABOROL-1-OL
US8343944B2 (en) 2009-07-28 2013-01-01 Anacor Pharmaceuticals, Inc. Trisubstituted boron-containing molecules
US10301329B2 (en) 2009-08-14 2019-05-28 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
US9440994B2 (en) 2009-08-14 2016-09-13 Anacor Pharmaceuticals, Inc. Boron containing small molecules as antiprotozoal agents
WO2011019618A1 (en) 2009-08-14 2011-02-17 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
WO2011019612A1 (en) 2009-08-14 2011-02-17 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
WO2011019616A1 (en) 2009-08-14 2011-02-17 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
WO2011037731A1 (en) * 2009-09-25 2011-03-31 Anacor Pharmaceuticals, Inc. Boron containing small molecules
WO2011049971A1 (en) 2009-10-20 2011-04-28 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
US9346834B2 (en) 2009-10-20 2016-05-24 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as antiprotozoal agents
US8461134B2 (en) 2009-11-11 2013-06-11 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US9499570B2 (en) 2010-01-27 2016-11-22 Anacor Pharmaceuticals, Inc. Boron containing small molecules
US9145429B2 (en) 2010-01-27 2015-09-29 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8716478B2 (en) 2010-01-27 2014-05-06 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8623911B2 (en) 2010-03-19 2014-01-07 Anacor Pharmaceuticals, Inc. Boron-containing small molecules as anti-protozoal agent
JP2013523826A (ja) * 2010-04-07 2013-06-17 グラクソスミスクライン エルエルシー ベンゾオキサボロールの調製方法
AU2011299243B2 (en) * 2010-09-07 2015-09-17 Anacor Pharmaceuticals, LLC. Benzoxaborole derivatives for treating bacterial infections
WO2012033858A3 (en) * 2010-09-07 2012-05-10 Anacor Pharmaceuticals, Inc. Benzoxaborole derivatives for treating bacterial infections
AU2011299243C1 (en) * 2010-09-07 2016-06-02 Anacor Pharmaceuticals, LLC. Benzoxaborole derivatives for treating bacterial infections
US9751898B2 (en) 2010-09-07 2017-09-05 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
EA033311B1 (ru) * 2010-09-07 2019-09-30 Анакор Фармасьютикалс, Инк. Производные бензоксаборола в качестве антибактериальных средств
JP2013541514A (ja) * 2010-09-07 2013-11-14 アナコール ファーマシューティカルズ,インコーポレーテッド 細菌感染治療用のベンゾオキサボロール誘導体
JP2018058836A (ja) * 2010-09-07 2018-04-12 アナコール ファーマシューティカルズ,インコーポレーテッド 細菌感染治療用のベンゾオキサボロール誘導体
EA028743B1 (ru) * 2010-09-07 2017-12-29 Анакор Фармасьютикалс, Инк. Производные бензоксаборолов в качестве антибактериальных средств
EP3251678A1 (en) * 2010-09-07 2017-12-06 Anacor Pharmaceuticals, Inc. Benzoxaborole derivatives for treating bacterial infections
US20190345173A1 (en) * 2010-09-07 2019-11-14 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US20120115813A1 (en) * 2010-09-07 2012-05-10 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
US8703742B2 (en) * 2010-09-07 2014-04-22 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
JP2016199558A (ja) * 2010-09-07 2016-12-01 アナコール ファーマシューティカルズ,インコーポレーテッド 細菌感染治療用のベンゾオキサボロール誘導体
JP2019112431A (ja) * 2010-09-07 2019-07-11 アナコール ファーマシューティカルズ,インコーポレーテッド 細菌感染治療用のベンゾオキサボロール誘導体
US11008345B2 (en) 2010-09-07 2021-05-18 Anacor Pharmaceuticals, Inc. Boron-containing small molecules
WO2013078071A1 (en) 2011-11-21 2013-05-30 Eli Lilly And Company Isoxazoline derivatives used in the control of ectoparasites
WO2013078070A1 (en) 2011-11-21 2013-05-30 Eli Lilly And Company Boron-containing small molecules
US8530452B2 (en) 2011-12-22 2013-09-10 Micurx Pharmaceuticals, Inc. Tricyclic boron compounds for antimicrobial therapy
WO2013093615A1 (en) 2011-12-22 2013-06-27 Micurx Pharmaceuticals, Inc. Tricyclic boron compounds for antimicrobial therapy
US10070649B2 (en) 2013-01-30 2018-09-11 Agrofresh Inc. Volatile applications against pathogens
US11771089B2 (en) 2013-01-30 2023-10-03 Agrofresh Inc. Large-scale methods of uniformly coating packaging surfaces with a volatile antimicrobial to preserve food freshness
US9138002B2 (en) 2013-01-30 2015-09-22 Agrofresh Inc. Compounds and compositions
US9585396B2 (en) 2013-01-30 2017-03-07 Agrofresh Inc. Volatile applications against pathogens
US12490742B2 (en) 2013-01-30 2025-12-09 Agrofresh Inc. Volatile applications against pathogens
US9426996B2 (en) 2013-01-30 2016-08-30 Agrofresh Inc. Use of benzoxaboroles as volatile antimicrobial agents on meats, plants, or plant parts
US10765117B2 (en) 2013-01-30 2020-09-08 Agrofresh Inc. Volatile applications against pathogens
US12329158B2 (en) 2013-01-30 2025-06-17 Agrofresh Inc. Large-scale methods of uniformly coating packaging surfaces with a volatile antimicrobial to preserve food freshness
US11917997B2 (en) 2013-01-30 2024-03-05 Agrofresh Inc. Volatile applications against pathogens
US11039617B2 (en) 2013-01-30 2021-06-22 Agrofresh Inc. Large scale methods of uniformly coating packaging surfaces with a volatile antimicrobial to preserve food freshness
US11202448B2 (en) 2013-01-30 2021-12-21 Agrofresh Inc. Volatile applications against pathogens
JP2016523234A (ja) * 2013-06-05 2016-08-08 アグロフレッシュ インコーポレイテッド 抗菌化合物および組成物
US20160168167A1 (en) * 2013-07-30 2016-06-16 Dong-A St Co., Ltd. Tricyclic Benzoxaborole Compound, Preparation Method and Use Thereof
US9676796B2 (en) 2013-07-30 2017-06-13 Dong-A St Co., Ltd. Tricyclic benzoxaborole compound, preparation method and use thereof
WO2015016558A1 (ko) 2013-07-30 2015-02-05 동아에스티 주식회사 트리사이클릭 벤즈옥사보롤 화합물, 이의 제조방법 및 용도
RU2639153C2 (ru) * 2013-07-30 2017-12-20 Донг-А Ст Ко., Лтд. Трициклическое бензоксабороловое соединение, способ его получения и его применение
EP3029043A4 (en) * 2013-07-30 2017-04-05 Dong-A ST Co., Ltd. Tricyclic benzoxaborole compound, preparation method therefor, and use thereof
KR102093783B1 (ko) 2013-08-09 2020-03-26 글락소스미스클라인 인털렉츄얼 프로퍼티 (넘버 2) 리미티드 트리시클릭 벤족사보롤 화합물 및 이의 용도
US10526352B2 (en) 2013-08-09 2020-01-07 Glaxosmithkline Intellectual Property (No.2) Limited Tricyclic benzoxaborole compounds and uses thereof
US10858376B2 (en) 2013-08-09 2020-12-08 Glaxosmithkline Intellectual Property (No.2) Limited Tricyclic benzoxaborole compounds and uses thereof
KR20160038901A (ko) * 2013-08-09 2016-04-07 글락소스미스클라인 인털렉츄얼 프로퍼티 (넘버 2) 리미티드 트리시클릭 벤족사보롤 화합물 및 이의 용도
US10308668B2 (en) 2013-08-09 2019-06-04 Glaxosmithkline Intellectual Property (No. 2) Limited Tricyclic benzoxaborole compounds and uses thereof
EA038093B1 (ru) * 2013-12-20 2021-07-05 Глаксосмитклайн Интеллекчуал Проперти (№2) Лимитед Способ лечения заболевания, вызванного инфекцией комплекса mycobacterium tuberculosis, с использованием (s)-(3-хлор-7,8-дигидро-2h-1,6,9-триокса-9a-борабензо[cd]азулен-2-ил)метанамина или его фармацевтически приемлемой соли
US20160347773A1 (en) * 2014-02-17 2016-12-01 Syngenta Participations Ag Microbiocidally active benzoxaboroles
WO2015121442A1 (en) * 2014-02-17 2015-08-20 Syngenta Participations Ag Microbiocidally active benzoxaboroles
US10040806B2 (en) 2014-02-17 2018-08-07 Syngenta Participations Ag Microbiocidally active benzoxaboroles
WO2016001834A1 (en) 2014-07-01 2016-01-07 Daiichi Sankyo Company, Limited Tricyclic benzoxaboroles as antibacterial agents
EP3212196A4 (en) * 2014-10-29 2018-07-11 Wisconsin Alumni Research Foundation Boronic acid inhibitors of hiv protease
US11214582B2 (en) 2015-02-12 2022-01-04 Glaxosmithkline Intellectual Property (No.2) Limited 4-substituted benzoxaborole compounds and uses thereof
WO2016128949A1 (en) 2015-02-12 2016-08-18 Glaxosmithkline Intellectual Property (No.2) Limited Benzoxaborole compounds and uses thereof
WO2016128948A1 (en) 2015-02-12 2016-08-18 Glaxosmithkline Intellectual Property (No.2) Limited 4 -substituted benzoxaborole compounds and uses thereof
US10774096B2 (en) 2015-02-12 2020-09-15 Glaxosmithkline Intellectual Property (No.2) Limited 4-substituted benzoxaborole compounds and uses thereof
US10966429B2 (en) 2016-03-07 2021-04-06 Agrofresh Inc. Synergistic methods of using benzoxaborole compounds and preservative gases as an antimicrobial for crops
US11578087B2 (en) 2016-05-12 2023-02-14 Anacor Pharmaceuticals, Inc. Oxaborole esters and uses thereof
US11691992B2 (en) 2017-03-01 2023-07-04 Anacor Pharmaceuticals, Inc. Oxaborole analogs and uses thereof
US10961261B2 (en) 2017-03-01 2021-03-30 Anacor Pharmaceuticals, Inc. Oxaborole analogs and uses thereof
WO2022043936A1 (en) 2020-08-31 2022-03-03 Pfizer Inc. Methods of protecting rna
WO2023246842A1 (en) 2022-06-23 2023-12-28 Shanghai Micurx Pharmaceutical Co., Ltd. Prodrugs of boron compounds and their use in treating bacterial infections
EP4384527A4 (en) * 2022-06-23 2025-09-03 Micurx Pharmaceuticals Inc PRODRUGS OF BORON COMPOUNDS AND THEIR USE IN THE TREATMENT OF BACTERIAL INFECTIONS

Also Published As

Publication number Publication date
JP6570391B2 (ja) 2019-09-04
EA020530B1 (ru) 2014-11-28
NO2164331T3 (https=) 2018-04-28
US20180016285A1 (en) 2018-01-18
CN104017008A (zh) 2014-09-03
KR101685656B1 (ko) 2016-12-12
US9796735B2 (en) 2017-10-24
ZA201104573B (en) 2014-03-26
JP5530923B2 (ja) 2014-06-25
SG182219A1 (en) 2012-07-30
CA2692135A1 (en) 2008-12-24
EP2164331B1 (en) 2017-11-29
NZ582706A (en) 2012-07-27
US8895534B2 (en) 2014-11-25
MY162692A (en) 2017-07-14
MX347688B (es) 2017-05-09
MA31675B1 (fr) 2010-09-01
DK2164331T3 (da) 2018-01-29
KR101578351B1 (ko) 2015-12-17
US20100292504A1 (en) 2010-11-18
EA200901617A1 (ru) 2010-06-30
KR20100051615A (ko) 2010-05-17
IL202379A (en) 2016-02-29
US10533021B2 (en) 2020-01-14
ES2655299T3 (es) 2018-02-19
CN101772302B (zh) 2014-05-07
AU2008265630B2 (en) 2013-06-20
ZA200909003B (en) 2022-03-30
JP2010530881A (ja) 2010-09-16
CO6251209A2 (es) 2011-02-21
JP2014148531A (ja) 2014-08-21
TW200911822A (en) 2009-03-16
CR11224A (es) 2010-06-28
EP2164331A4 (en) 2011-09-07
AR067105A1 (es) 2009-09-30
US20090227541A1 (en) 2009-09-10
BRPI0813450B1 (pt) 2019-05-07
KR20150100945A (ko) 2015-09-02
JP2016040275A (ja) 2016-03-24
CN101772302A (zh) 2010-07-07
AU2008265630A1 (en) 2008-12-24
UY31171A1 (es) 2009-04-30
US20150133402A1 (en) 2015-05-14
CL2008001855A1 (es) 2009-05-29
JO3396B1 (ar) 2019-10-20
IL202379A0 (en) 2010-06-30
BRPI0813450A2 (pt) 2014-12-30
PE20090840A1 (es) 2009-07-08
BRPI0813450B8 (pt) 2021-05-25
EP2164331A1 (en) 2010-03-24
KR20160049025A (ko) 2016-05-04
DOP2009000281A (es) 2010-07-31
US7816344B2 (en) 2010-10-19
CA2692135C (en) 2017-01-24

Similar Documents

Publication Publication Date Title
EP2164331B1 (en) Boron-containing small molecules
EP3251678B1 (en) Benzoxaborole derivatives for treating bacterial infections
US20130059803A1 (en) Boron-containing small molecules
EP2015757A2 (en) Hydrolytically-resistant boron-containing therapeutics and methods of use
WO2011037731A1 (en) Boron containing small molecules
HK1141681B (en) Boron-containing small molecules
HK1141681A (en) Boron-containing small molecules
HK1247841B (en) Benzoxaborole derivatives for treating bacterial infections
HK1186397A (en) Benzoxaborole derivatives for treating bacterial infections

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200880101464.4

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08825921

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2008825921

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2008825921

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2008265630

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2010513416

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 2009121845

Country of ref document: EG

WWE Wipo information: entry into national phase

Ref document number: 2692135

Country of ref document: CA

Ref document number: 09145296

Country of ref document: CO

Ref document number: 12009502461

Country of ref document: PH

Ref document number: MX/A/2009/014143

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 4472/KOLNP/2009

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2008265630

Country of ref document: AU

Date of ref document: 20080619

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 200901617

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: DZP2010000035

Country of ref document: DZ

ENP Entry into the national phase

Ref document number: 20107001062

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 201011224

Country of ref document: CR

Ref document number: CR2010-011224

Country of ref document: CR

WWE Wipo information: entry into national phase

Ref document number: 582706

Country of ref document: NZ

WWE Wipo information: entry into national phase

Ref document number: A200912802

Country of ref document: UA

WWE Wipo information: entry into national phase

Ref document number: PI 20095460

Country of ref document: MY

ENP Entry into the national phase

Ref document number: PI0813450

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20091218