WO2008097870A2 - Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc- asgpr) - Google Patents

Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc- asgpr) Download PDF

Info

Publication number
WO2008097870A2
WO2008097870A2 PCT/US2008/052865 US2008052865W WO2008097870A2 WO 2008097870 A2 WO2008097870 A2 WO 2008097870A2 US 2008052865 W US2008052865 W US 2008052865W WO 2008097870 A2 WO2008097870 A2 WO 2008097870A2
Authority
WO
WIPO (PCT)
Prior art keywords
antigen
asgpr
cells
antibody
immunoglobulin
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2008/052865
Other languages
English (en)
French (fr)
Other versions
WO2008097870A3 (en
Inventor
Jacques F. Banchereau
Sangkon Oh
Gerard Zurawski
Sandra Zurawski
Dapeng Li
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Baylor Research Institute
Original Assignee
Baylor Research Institute
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to MX2009008211A priority Critical patent/MX2009008211A/es
Priority to EP08714180.0A priority patent/EP2115129B1/en
Priority to BRPI0807152-7A priority patent/BRPI0807152A2/pt
Priority to CN2008800113498A priority patent/CN101952414A/zh
Priority to AU2008214036A priority patent/AU2008214036B2/en
Priority to NZ578756A priority patent/NZ578756A/en
Priority to JP2009548484A priority patent/JP2010518024A/ja
Priority to CA2715045A priority patent/CA2715045C/en
Application filed by Baylor Research Institute filed Critical Baylor Research Institute
Publication of WO2008097870A2 publication Critical patent/WO2008097870A2/en
Priority to IL200093A priority patent/IL200093A0/en
Anticipated expiration legal-status Critical
Publication of WO2008097870A3 publication Critical patent/WO2008097870A3/en
Priority to IL218085A priority patent/IL218085A0/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/145Orthomyxoviridae, e.g. influenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1027Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10Antimycotics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • A61P33/02Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/37Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/405Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from algae
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0639Dendritic cells, e.g. Langherhans cells in the epidermis
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5154Antigen presenting cells [APCs], e.g. dendritic cells or macrophages
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/74Inducing cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • C12N2760/16122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • C12N2760/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • the present invention relates in general to the field of agents that engage antigen-presenting cells through dendritic cell asialoglycoprotein receptor (DC-ASGPR).
  • DC-ASGPR dendritic cell asialoglycoprotein receptor
  • Dendritic Cells play a pivotal role in controlling the interface of innate and acquired immunity by providing soluble and intercellular signals, followed by recognition of pathogens. These functions of DCs are largely dependent on the expression of specialized surface receptors, 'pattern recognition receptors' (PRRs), represented, most notably, by toll-like receptors (TLRs) and C-type lectins or lectin- like receptors (LLRs) (1-3).
  • PRRs 'pattern recognition receptors'
  • TLRs toll-like receptors
  • LLRs C-type lectins or lectin- like receptors
  • TLRs In the current paradigm, a major role of TLRs is to alert DCs to produce interleukin 12 (IL- 12) and other inflammatory cytokines for initiating immune responses.
  • C-type LLRs operate as constituents of the powerful antigen capture and uptake mechanism of macrophages and DCs (1).
  • LLRs Compared to TLRs, however, LLRs might have broader ranges of biological functions that include cell migrations (4), intercellular interactions (5). These multiple functions of LLRs might be due to the facts that LLRs, unlike TLRs, can recognize both self and nonself.
  • the complexity of LLRs including the redundancy of a number of LLRs expressed in immune cells, has been one of the major obstacles to understand the detailed functions of individual LLRs.
  • DC-ASGPR species were restricted to the CD14-derived DC obtained from CD34- derived progenitors, while absent from the CD la-derived subset. Both monocyte-derived DC and tonsillar interstitial-type DC expressed DC-ASGPR protein, while Langerhans-type cells did not. Furthermore, DC-ASGPR was a feature of immaturity, as expression was lost upon CD40 activation. In agreement with the presence of tyrosine -based and dileucine motifs in the intracytoplasmic domain, mAb against DC-ASGPR was rapidly internalized by DC at 37°C. Finally, intracellular DC-ASGPR was localized to early endosomes, suggesting that the receptor recycles to the cell surface following internalization of ligand.
  • DC-ASGPR is known to be capable of directing the internalization of surrogate antigen into human DC
  • the invention uses novel biological activities of DC-ASGPR to effect particularly desirable changes in the immune system, some in the context of antigen uptake (e.g., vaccination), others through the unique action of DC-ASGPR effectors (alone or in concert with other immune regulatory molecules) capable of eliciting signaling through this receptor on DC, B cells, and monocytes.
  • the invention disclosure reveals means of developing unique agents capable of activating cells bearing DC-ASGPR, as well as the effect of the resulting changes in cells receiving these signals regards action on other cells in the immune system.
  • These effects are highly predictive of therapeutic outcomes for certain disease states or for augmenting protective outcomes in the context of vaccination.
  • the present invention includes compositions and methods for increasing the effectiveness of antigen presentation by a DC-ASGPR-expressing antigen presenting cell by isolating and purifying a DC-ASGPR-specific antibody or fragment thereof to which a targeted agent is attached that forms an antibody-antigen complex, wherein the agent is processed and presented by, e.g., a dendritic cell, that has been contacted with the antibody-agent complex.
  • the antigen presenting cell is a dendritic cell and the DC-ASGPR-specific antibody or fragment thereof is bound to one half of a Coherin/Dockerin pair.
  • the DC-ASGPR-specific antibody or fragment thereof may also be bound to one half of a Coherin/Dockerin pair and an antigen is bound to the complementary half of the Coherin/Dockerin pair to form a complex.
  • agents include one or more peptides, proteins, lipids, carbohydrates, nucleic acids and combinations thereof.
  • the agent may one or more cytokine selected from interleukins, transforming growth factors (TGFs), fibroblast growth factors (FGFs), platelet derived growth factors (PDGFs), epidermal growth factors (EGFs), connective tissue activated peptides (CTAPs), osteogenic factors, and biologically active analogs, fragments, and derivatives of such growth factors, B/T-cell differentiation factors, B/T-cell growth factors, mitogenic cytokines, chemotactic cytokines, colony stimulating factors, angiogenesis factors, IFN- ⁇ , IFN- ⁇ , IFN- ⁇ , ILl, IL2, IL3, IL4, IL5, IL6, IL7, IL8, IL9, ILlO, ILI l, IL12, IL13, IL14, IL15, IL16, IL17, IL18, etc., leptin, myostatin, macrophage stimulating protein, platelet-derived growth factor, TNF- ⁇ , TNF- ⁇
  • the present invention also includes compositions and methods for increasing the effectiveness of antigen presentation by dendritic cells comprising binding a DC-ASGPR-specific antibody or fragment thereof to which an antigen is attached that forms an antibody-antigen complex, wherein the antigen is processed and presented by a dendritic cell that has been contacted with the antibody-antigen complex.
  • Another embodiment is the use of antibodies or other specific binding molecules directed to DC-ASGPR for delivering antigens to antigen-presenting cells for the purpose of eliciting protective or therapeutic immune responses.
  • antigen- targeting reagents specific to DC-ASGPR for vaccination via the skin; antigen-targeting reagents specific to DC-ASGPR in association with co-administered or linked adjuvant for vaccination or use for antigen-targeting (vaccination) purposes of specific antigens which can be expressed as recombinant antigen-antibody fusion proteins.
  • Another embodiment includes a method for increasing the effectiveness of dendritic cells by isolating patient dendritic cells; exposing the dendritic cells to activating amounts of anti-DC- ASGPR antibodies or fragments thereof and antigen to form antigen-loaded, activated dendritic cells; and reintroducing the antigen-loaded, activated dendritic cells into the patient.
  • the antigen may be a bacterial, viral, fungal, protozoan or cancer protein.
  • the present invention also includes an anti-DC-ASGPR immunoglobulin or portion thereof that is secreted from mammalian cells and an antigen bound to the immunoglobulin.
  • the immunoglobulin is bound to one half of a cohesin/dockerin domain, or it may also include a complementary half of the cohesin-dockerin binding pair bound to an antigen that forms a complex with the modular rAb carrier, or a complementary half of the cohesin-dockerin binding pair that is a fusion protein with an antigen.
  • the antigen specific domain may be a full length antibody, an antibody variable region domain, an Fab fragment, a Fab' fragment, an F(ab) 2 fragment, and Fv fragment, and Fabc fragment and/or a Fab fragment with portions of the Fc domain.
  • the anti-DC-ASGPR immunoglobulin may also be bound to a toxin selected from wherein the toxin is selected from the group consisting of a radioactive isotope, metal, enzyme, botulin, tetanus, ricin, cholera, diphtheria, aflatoxins, perfringens toxin, mycotoxins, shigatoxin, staphylococcal enterotoxin B, T2, seguitoxin, saxitoxin, abrin, cyanoginosin, alphatoxin, tetrodotoxin, aconotoxin, snake venom and spider venom.
  • the antigen may be a fusion protein with the immunoglobulin or bound chemically covalently or not.
  • the present invention also includes compositions and methods for increasing the effectiveness of dendritic cells by isolating patient dendritic cells, exposing the dendritic cells to activating amounts of anti-DC-ASGPR antibodies or fragments thereof and antigen to form antigen-loaded, activated dendritic cells; and reintroducing the antigen-loaded, activated dendritic cells into the patient.
  • the agents may be used to engage DC-ASGPR, alone or with co-activating agents, to activate antigen-presenting cells for therapeutic or protective applications, to bind DC-ASGPR and/or activating agents linked to antigens, alone or with co-activating agents, for protective or therapeutic vaccination.
  • Another use of is the development of specific antibody V-region sequences capable of binding to and activating DC-ASGPR, for use as anti-DC-ASGPR agents linked to toxic agents for therapeutic purposes in the context of diseases known or suspected to result from inappropriate activation of immune cells via DC-ASGPR and as a vaccine with a DC-ASGPR-specific antibody or fragment thereof to which an antigen is attached that forms an antibody-antigen complex, wherein the antigen is processed and presented by a dendritic cell that has been contacted with the antibody-antigen complex.
  • Figures IA to IE demonstrate signaling through lectin-like receptor DC-ASGPR activates DCs, resulting in increased levels of costimulatory molecules as well as cytokines and chemokines.
  • Figure IA shows three day and six day GM/IL-4 DCs were stained with FITC-labeled goat anti- mouse IgG followed by mouse monoclonal anti-human DC-ASGPR, antibody.
  • Figure IB shows six day GM/IL-4 DCs were cultured in plates coated with the anti-DC-ASGPR or control mAbs (1-2 ug/ml) for 16-18h.
  • FIG. 1C shows six day GM/IL-4 DCs were cultured in plates coated with the mAbs for 12h, and subjected to RNA isolation and Affymetrix Gene Chip analysis, as described in Methods. Fold increases of gene expression by anti-lectin mAbs were compared with the gene expression levels in DCs stimulated with control mAbs.
  • Figure ID shows the cytokines and chemokines in the culture supernatants from the experiment shown in Figure IB were measured by Luminex.
  • Figure IE shows six day GM/IL-4 DCs were cultured in plates coated with mAbs in the presence or absence of 50 ng/ml soluble CD40L, for 16-18h, and then stained with anti-CD83 antibodies. Cytokines and chemokines in the culture supernatants from the experiment shown in Figure IE were measured by Luminex. Results shown are representative of three independent experiments using cells from different normal donors.
  • Figures 2A to 2D shows that DC-ASGPR expressed on DCs, contributes to enhanced humoral immune responses.
  • Figure 2A is a FACS of day six cells stained with fluorescently labeled antibodies. CD3 + and 7-AAD + cells were gated out. CD38 + and CFSE " cells were purified by FACS sorter and Giemsa staining was performed.
  • Figure 2B are culture supernatants on day thirteen were analyzed for total IgM, IgG, and IgM by sandwich ELISA.
  • Figure 1C shows DCs pulsed with 5 multiplicity of infection (moi) of heat-inactivated influenza virus (PR8), and cultured with B cells. Culture supernatant was analyzed for influenza-specific immunoglobulins (Igs) on day thirteen.
  • Figure ID shows DC cultured with anti-DC- ASGPR or control mAb were stained for cell surface APRIL expression and the supernatants assayed for soluble APRIL.
  • Figures 3A to 3D shows the cell surface expression of DC-ASGPR on B cells contribute to B cell activation and immunoglobulin production.
  • Figure 3A are PBMCs from buffy coats were stained with anti-CD 19, anti-CD3, and anti- DC-ASGPR or control mAb.
  • CD19 + and CD3 + cells were gated and the expression levels of the molecules on CD19 + B cells were measured by flow cytometry.
  • Figure 3B are CD19 + B cells from buffy coats were cultured in plates coated with the mAbs for 12h, and subjected to RNA isolation and Affymetrix Gene Chip analysis as described in Methods.
  • FIG. 3 C shows CD19 + B cells were cultured in plates coated with the mAbs for 16-18h, and then culture supernatants were analyzed for cytokines and chemokines by Luminex.
  • Figure 3D shows 1x10 5 CD19 + B cells were cultured in plates coated with the mAbs for thirteen days. Total Ig levels were measured by ELISA. Data are representative of two repeat experiments using cells from three different normal donors.
  • Figures 4A to 4D shows that the proliferation of purified allogeneic T cells was significantly enhanced by DCs stimulated with mAb specific for DC-ASGPR.
  • Figure 5 shows that certain anti-DC-ASGPR mAbs can activate DC.
  • DC were incubated for 24 hrs with one of a panel of 12 pure anti-ASGPR mAbs.
  • Cells were then tested for expression of cell surface CD86 (a DC activation marker) and supernatants were assayed for secreted cytokines.
  • Three mAbs (36, 38, 43) from the anti-ASGPR mAb panel activated DC.
  • Figure 6 shows that different antigens can be expressed in the context of a DC-ASGPR rAb.
  • Such an anti-DC-ASGPR rAb.Doc protein can be simply mixed with any Cohesin.fusion protein to assemble a stable non-covalent [rAb.Doc:Coh.fusion] complex that functions just as a rAb. fusion protein.
  • FIG. 7 GM-CSF/IFNa DCs (5,000/well) were loaded with 10 or 1 nM anti-DC- ASGPR.Doc:Coh.Flu Ml, or hIgG4.Doc:Coh.Flu Ml complexes. After 6 h, autologous CD8+ T cells (200,000/well) were added into the cultures. At day 8, the CD8+ T cells were analyzed for expansion of cells bearing TCR specific for a HLA- A201 immuno-dominant peptide. The inner boxes indicate the percentage of tetramer- specific CD8+ T cells.
  • DCs Dendritic cells
  • Mellman and Steinman 2001 (Banchereau, Briere et al. 2000), (Cella, Sallusto et al. 1997).
  • DCs capture antigens, process them into peptides, and present these to T cells. Therefore delivering antigens directly to DC is a focus area for improving vaccines.
  • One such example is the development of DC-based vaccines using ex-vivo antigen-loading of autologous DCs that are then re-administrated to patients (Banchereau, Schuler-Thurner et al. 2001), (Steinman and Dhodapkar 2001).
  • Another strategy to improve vaccine efficacy is specific targeting to DC of antigen conjugated to antibodies against internalizing DC-specific receptors.
  • the potential of targeting DCfor vaccination is highlighted by key mouse studies.
  • targeting with an anti-LOX-1 mAb coupled to ovalbumin (OVA) induced a protective CD8+ T cell response, via exogenous antigen cross-presentation toward the MHC class I pathway (Delneste, Magistrelli et al. 2002).
  • OVA conjugated to anti-DEC205 mAb in combination with a CD40L maturation stimulus enhanced the MHC class I-restricted presentation by DCs in vivo and led to the durable formation of effector memory CD8+ T cells (Bonifaz, Bonnyay et al. 2004).
  • the present invention provides for the complexing of multiple antigens or proteins (engineered, expressed, and purified independently from the primary mAb) in a controlled, multivariable fashion, to one single primary recombinant mAb.
  • multiple antigens or proteins engineered, expressed, and purified independently from the primary mAb
  • present invention provides for addition to the primary mAb of multiple combinations, in fixed equimolar ratios and locations, of separately engineered proteins.
  • the term "modular rAb carrier” is used to describe a recombinant antibody system that has been engineered to provide the controlled modular addition of diverse antigens, activating proteins, or other antibodies to a single recombinant monoclonal antibody (mAb).
  • the rAb may be a monoclonal antibody made using standard hybridoma techniques, recombinant antibody display, humanized monoclonal antibodies and the like.
  • the modular rAb carrier can be used to, e.g., target (via one primary recombinant antibody against an internalizing receptor, e.g., a human dendritic cell receptor) multiple antigens and/or antigens and an activating cytokine to dendritic cells (DC).
  • the modular rAb carrier may also be used to join two different recombinant mAbs end-to-end in a controlled and defined manner.
  • the antigen binding portion of the "modular rAb carrier” may be one or more variable domains, one or more variable and the first constant domain, an Fab fragment, a Fab' fragment, an F(ab) 2 fragment, and Fv fragment, and Fabc fragment and/or a Fab fragment with portions of the Fc domain to which the cognate modular binding portions are added to the amino acid sequence and/or bound.
  • the antibody for use in the modular rAb carrier can be of any isotype or class, subclass or from any source (animal and/or recombinant).
  • the modular rAb carrier is engineered to have one or more modular cohesin-dockerin protein domains for making specific and defined protein complexes in the context of engineered recombinant mAbs.
  • the mAb is a portion of a fusion protein that includes one or more modular cohesin-dockerin protein domains carboxy from the antigen binding domains of the mAb.
  • the cohesin-dockerin protein domains may even be attached post- translationally, e.g., by using chemical cross-linkers and/or disulfide bonding.
  • antigen refers to a molecule that can initiate a humoral and/or cellular immune response in a recipient of the antigen.
  • Antigen may be used in two different contexts with the present invention: as a target for the antibody or other antigen recognition domain of the rAb or as the molecule that is carried to and/or into a cell or target by the rAb as part of a dockerin/cohesin-molecule complement to the modular rAb carrier.
  • the antigen is usually an agent that causes a disease for which a vaccination would be advantageous treatment.
  • the peptide is often about 8 to about 25 amino acids.
  • Antigens include any type of biologic molecule, including, for example, simple intermediary metabolites, sugars, lipids and hormones as well as macromolecules such as complex carbohydrates, phospholipids, nucleic acids and proteins.
  • Common categories of antigens include, but are not limited to, viral antigens, bacterial antigens, fungal antigens, protozoal and other parasitic antigens, tumor antigens, antigens involved in autoimmune disease, allergy and graft rejection, and other miscellaneous antigens.
  • the modular rAb carrier is able to carry any number of active agents, e.g., antibiotics, anti- infective agents, antiviral agents, anti-tumoral agents, antipyretics, analgesics, anti-inflammatory agents, therapeutic agents for osteoporosis, enzymes, cytokines, anticoagulants, polysaccharides, collagen, cells, and combinations of two or more of the foregoing active agents.
  • active agents e.g., antibiotics, anti- infective agents, antiviral agents, anti-tumoral agents, antipyretics, analgesics, anti-inflammatory agents, therapeutic agents for osteoporosis, enzymes, cytokines, anticoagulants, polysaccharides, collagen, cells, and combinations of two or more of the foregoing active agents.
  • antibiotics for delivery using the present invention include, without limitation, tetracycline, aminoglycosides, penicillins, cephalosporins, sulfonamide drugs, chloramphenicol sodium succinate, erythromycin, vancomycin, lincomycin, clindamycin, nystatin, amphotericin B, amantidine, idoxuridine, p-amino salicyclic acid, isoniazid, rifampin, antinomy cin D, mithramycin, daunomycin, adriamycin, bleomycin, vinblastine, vincristine, procarbazine, imidazole carboxamide, and the like.
  • anti-tumor agents for delivery using the present invention include, without limitation, doxorubicin, Daunorubicin, taxol, methotrexate, and the like.
  • antipyretics and analgesics include aspirin, Motrin®, Ibuprofen®, naprosyn, acetaminophen, and the like.
  • anti-inflammatory agents for delivery using the present invention include, without limitation, include NSAIDS, aspirin, steroids, dexamethasone, hydrocortisone, prednisolone, Diclofenac Na, and the like.
  • therapeutic agents for treating osteoporosis and other factors acting on bone and skeleton include for delivery using the present invention include, without limitation, calcium, alendronate, bone GLa peptide, parathyroid hormone and its active fragments, histone H4- related bone formation and proliferation peptide and mutations, derivatives and analogs thereof.
  • enzymes and enzyme cofactors for delivery using the present invention include, without limitation, pancrease, L-asparaginase, hyaluronidase, chymotrypsin, trypsin, tPA, streptokinase, urokinase, pancreatin, collagenase, tripsinogen, chymotrypsinogen, plasminogen, streptokinase, adenyl cyclase, superoxide dismutase (SOD), and the like.
  • SOD superoxide dismutase
  • cytokines for delivery using the present invention include, without limitation, interleukins, transforming growth factors (TGFs), fibroblast growth factors (FGFs), platelet derived growth factors (PDGFs), epidermal growth factors (EGFs), connective tissue activated peptides (CTAPs), osteogenic factors, and biologically active analogs, fragments, and derivatives of such growth factors.
  • TGFs transforming growth factors
  • FGFs fibroblast growth factors
  • PDGFs platelet derived growth factors
  • EGFs epidermal growth factors
  • CRFs connective tissue activated peptides
  • osteogenic factors and biologically active analogs, fragments, and derivatives of such growth factors.
  • Cytokines may be B/T-cell differentiation factors, B/T-cell growth factors, mitogenic cytokines, chemotactic cytokines, colony stimulating factors, angiogenesis factors, IFN- ⁇ , IFN- ⁇ , IFN- ⁇ , ILl, IL2, IL3, IL4, IL5, IL6, IL7, IL8, IL9, ILlO, ILI l, IL12, IL13, IL14, IL15, IL16, IL17, IL18, etc., leptin, myostatin, macrophage stimulating protein, platelet-derived growth factor, TNF- ⁇ , TNF- ⁇ , NGF, CD40L, CD137L/4-1BBL, human lymphotoxin- ⁇ , G-CSF, M-CSF, GM-CSF, PDGF, IL-l ⁇ , ILl- ⁇ , IP-IO, PF4, GRO, 9E3, erythropoietin, endostatin, an
  • TGF transforming growth factor
  • Other cytokines include members of the transforming growth factor (TGF) supergene family include the beta transforming growth factors (for example TGF- ⁇ l, TGF- ⁇ 2, TGF- ⁇ 3); bone morphogenetic proteins (for example, BMP-I, BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP- 7, BMP-8, BMP-9); heparin-binding growth factors (for example, fibroblast growth factor (FGF), epidermal growth factor (EGF), platelet-derived growth factor (PDGF), insulin-like growth factor (IGF)); Inhibins (for example, Inhibin A, Inhibin B); growth differentiating factors (for example, GDF-I); and Activins (for example, Activin A, Activin B, Activin AB).
  • TGF transforming growth factor
  • growth factors for delivery using the present invention include, without limitation, growth factors that can be isolated from native or natural sources, such as from mammalian cells, or can be prepared synthetically, such as by recombinant DNA techniques or by various chemical processes.
  • analogs, fragments, or derivatives of these factors can be used, provided that they exhibit at least some of the biological activity of the native molecule.
  • analogs can be prepared by expression of genes altered by site-specific mutagenesis or other genetic engineering techniques.
  • anticoagulants for delivery using the present invention include, without limitation, include warfarin, heparin, Hirudin, and the like.
  • factors acting on the immune system include for delivery using the present invention include, without limitation, factors which control inflammation and malignant neoplasms and factors which attack infective microorganisms, such as chemotactic peptides and bradykinins.
  • viral antigens include, but are not limited to, e.g., retroviral antigens such as retroviral antigens from the human immunodeficiency virus (HIV) antigens such as gene products of the gag, pol, and env genes, the Nef protein, reverse transcriptase, and other HIV components; hepatitis viral antigens such as the S, M, and L proteins of hepatitis B virus, the pre-S antigen of hepatitis B virus, and other hepatitis, e.g., hepatitis A, B, and C, viral components such as hepatitis C viral RNA; influenza viral antigens such as hemagglutinin and neuraminidase and other influenza viral components; measles viral antigens such as the measles virus fusion protein and other measles virus components; rubella viral antigens such as proteins El and E2 and other rubella virus components; rotaviral antigens such as VP7s
  • Antigenic targets that may be delivered using the rAb-DC/DC-antigen vaccines of the present invention include genes encoding antigens such as viral antigens, bacterial antigens, fungal antigens or parasitic antigens.
  • Viruses include picornavirus, coronavirus, togavirus, flavirvirus, rhabdovirus, paramyxovirus, orthomyxovirus, bunyavirus, arenavirus, reovirus, retrovirus, papilomavirus, parvovirus, herpesvirus, poxvirus, hepadnavirus, and spongiform virus.
  • Other viral targets include influenza, herpes simplex virus 1 and 2, measles, dengue, smallpox, polio or HIV.
  • Pathogens include trypanosomes, tapeworms, roundworms, helminthes, malaria. Tumor markers, such as fetal antigen or prostate specific antigen, may be targeted in this manner.
  • kits for vaccination purposes would require that the vector- associated antigens be sufficiently non-immunogenic to enable long term expression of the transgene, for which a strong immune response would be desired.
  • vaccination of an individual may only be required infrequently, such as yearly or biennially, and provide long term immunologic protection against the infectious agent.
  • organisms, allergens and nucleic and amino sequences for use in vectors and ultimately as antigens with the present invention may be found in U.S. Patent No. 6,541,011, relevant portions incorporated herein by reference, in particular, the tables that match organisms and specific sequences that may be used with the present invention.
  • Bacterial antigens for use with the rAb vaccine disclosed herein include, but are not limited to, e.g., bacterial antigens such as pertussis toxin, filamentous hemagglutinin, pertactin, FIM2, FIM3, adenylate cyclase and other pertussis bacterial antigen components; diptheria bacterial antigens such as diptheria toxin or toxoid and other diptheria bacterial antigen components; tetanus bacterial antigens such as tetanus toxin or toxoid and other tetanus bacterial antigen components; streptococcal bacterial antigens such as M proteins and other streptococcal bacterial antigen components; gram-negative bacilli bacterial antigens such as lipopolysaccharides and other gram-negative bacterial antigen components, Mycobacterium tuberculosis bacterial antigens such as mycolic acid, heat shock protein
  • Partial or whole pathogens may also be: haemophilus influenza; Plasmodium falciparum; neisseria meningitidis; streptococcus pneumoniae; neisseria gonorrhoeae; salmonella serotype typhi; shigella; vibrio cholerae; Dengue Fever; Encephalitides; Japanese Encephalitis; lyme disease; Yersinia pestis; west nile virus; yellow fever; tularemia; hepatitis (viral; bacterial); RSV (respiratory syncytial virus); HPIV 1 and HPIV 3; adenovirus; small pox; allergies and cancers.
  • Fungal antigens for use with compositions and methods of the invention include, but are not limited to, e.g., Candida fungal antigen components; histoplasma fungal antigens such as heat shock protein 60 (HSP60) and other histoplasma fungal antigen components; cryptococcal fungal antigens such as capsular polysaccharides and other cryptococcal fungal antigen components; coccidiodes fungal antigens such as spherule antigens and other coccidiodes fungal antigen components; and tinea fungal antigens such as trichophytin and other coccidiodes fungal antigen components.
  • Candida fungal antigen components histoplasma fungal antigens such as heat shock protein 60 (HSP60) and other histoplasma fungal antigen components
  • cryptococcal fungal antigens such as capsular polysaccharides and other cryptococcal fungal antigen components
  • coccidiodes fungal antigens such as spherule antigens and
  • protozoal and other parasitic antigens include, but are not limited to, e.g.,
  • Plasmodium falciparum antigens such as merozoite surface antigens, sporozoite surface antigens, circumsporozoite antigens, gametocyte/gamete surface antigens, blood-stage antigen pf
  • toxoplasma antigens such as SAG-I, p30 and other toxoplasmal antigen components
  • schistosomae antigens such as glutathione- S- transferase, paramyosin, and other schistosomal antigen components
  • leishmania major and other leishmaniae antigens such as gp63, lipophosphoglycan and its associated protein and other leishmanial antigen components
  • trypanosoma cruzi antigens such as the 75-77 kDa antigen, the 56 kDa antigen and other trypanosomal antigen components.
  • Antigen that can be targeted using the rAb of the present invention will generally be selected based on a number of factors, including: likelihood of internalization, level of immune cell specificity, type of immune cell targeted, level of immune cell maturity and/or activation and the like.
  • cell surface markers for dendritic cells include, but are not limited to, MHC class I, MHC Class II, B7-2, CD18, CD29, CD31, CD43, CD44, CD45, CD54, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR and/or ASPGR and the like; while in some cases also having the absence of CD2, CD3, CD4, CD8, CD14, CD15, CD16, CD 19, CD20, CD56, and/or CD57.
  • cell surface markers for antigen presenting cells include, but are not limited to, MHC class I, MHC Class II, CD40, CD45, B7-1, B7-2, IFN- ⁇ receptor and IL-2 receptor, ICAM-I and/or Fc ⁇ receptor.
  • cell surface markers for T cells include, but are not limited to, CD3, CD4, CD8, CD 14, CD20, CDl Ib, CD16, CD45 and HLA-DR.
  • Target antigens on cell surfaces for delivery includes those characteristic of tumor antigens typically will be derived from the cell surface, cytoplasm, nucleus, organelles and the like of cells of tumor tissue.
  • tumor targets for the antibody portion of the present invention include, without limitation, hematological cancers such as leukemias and lymphomas, neurological tumors such as astrocytomas or glioblastomas, melanoma, breast cancer, lung cancer, head and neck cancer, gastrointestinal tumors such as gastric or colon cancer, liver cancer, pancreatic cancer, genitourinary tumors such cervix, uterus, ovarian cancer, vaginal cancer, testicular cancer, prostate cancer or penile cancer, bone tumors, vascular tumors, or cancers of the lip, nasopharynx, pharynx and oral cavity, esophagus, rectum, gall bladder, biliary tree, larynx, lung and bronchus, bladder, kidney, brain and other parts of the nervous system,
  • antigens examples include tumor proteins, e.g., mutated oncogenes; viral proteins associated with tumors; and tumor mucins and glycolipids.
  • the antigens may be viral proteins associated with tumors would be those from the classes of viruses noted above.
  • Certain antigens may be characteristic of tumors (one subset being proteins not usually expressed by a tumor precursor cell), or may be a protein which is normally expressed in a tumor precursor cell, but having a mutation characteristic of a tumor.
  • Other antigens include mutant variant(s) of the normal protein having an altered activity or subcellular distribution, e.g., mutations of genes giving rise to tumor antigens.
  • tumor antigens include: CEA, prostate specific antigen (PSA), HER-2/neu, BAGE, GAGE, MAGE 1-4, 6 and 12, MUC (Mucin) (e.g., MUC-I, MUC-2, etc.), GM2 and GD2 gangliosides, ras, myc, tyrosinase, MART (melanoma antigen), Pmel 17(gpl00), GnT-V intron V sequence (N-acetylglucoaminyltransferase V intron V sequence), Prostate Ca psm, PRAME (melanoma antigen), ⁇ -catenin, MUM-I-B (melanoma ubiquitous mutated gene product), GAGE (melanoma antigen) 1, BAGE (melanoma antigen) 2-10, C-ERB2 (Her2/neu), EBNA (Epstein-Barr Virus nuclear antigen) 1-6, gp75, human pap
  • the immunogenic molecule can be an autoantigen involved in the initiation and/or propagation of an autoimmune disease, the pathology of which is largely due to the activity of antibodies specific for a molecule expressed by the relevant target organ, tissue, or cells, e.g., SLE or MG.
  • a Th2-type immune response to the relevant autoantigen towards a cellular (i.e., a ThI -type) immune response.
  • Autoantigens of interest include, without limitation: (a) with respect to SLE, the Smith protein, RNP ribonucleoprotein, and the SS-A and SS-B proteins; and (b) with respect to MG, the acetylcholine receptor.
  • miscellaneous antigens involved in one or more types of autoimmune response include, e.g., endogenous hormones such as luteinizing hormone, follicular stimulating hormone, testosterone, growth hormone, prolactin, and other hormones.
  • Antigens involved in autoimmune diseases, allergy, and graft rejection can be used in the compositions and methods of the invention.
  • an antigen involved in any one or more of the following autoimmune diseases or disorders can be used in the present invention: diabetes, diabetes mellitus, arthritis (including rheumatoid arthritis, juvenile rheumatoid arthritis, osteoarthritis, psoriatic arthritis), multiple sclerosis, myasthenia gravis, systemic lupus erythematosis, autoimmune thyroiditis, dermatitis (including atopic dermatitis and eczematous dermatitis), psoriasis, Sjogren's Syndrome, including keratoconjunctivitis sicca secondary to Sjogren's Syndrome, alopecia areata, allergic responses due to arthropod bite reactions, Crohn's disease, aphthous ulcer, ulceris, conjunctivitis, keratoconjunctivitis, ulcerative colitis, asthma
  • antigens involved in autoimmune disease include glutamic acid decarboxylase 65 (GAD 65), native DNA, myelin basic protein, myelin proteo lipid protein, acetylcholine receptor components, thyroglobulin, and the thyroid stimulating hormone (TSH) receptor.
  • GID 65 glutamic acid decarboxylase 65
  • native DNA myelin basic protein
  • myelin proteo lipid protein acetylcholine receptor components
  • thyroglobulin thyroid stimulating hormone
  • antigens involved in allergy include pollen antigens such as Japanese cedar pollen antigens, ragweed pollen antigens, rye grass pollen antigens, animal derived antigens such as dust mite antigens and feline antigens, histocompatiblity antigens, and penicillin and other therapeutic drugs.
  • antigens involved in graft rejection include antigenic components of the graft to be transplanted into the graft recipient such as heart, lung, liver, pancreas, kidney, and neural graft components.
  • the antigen may be an altered peptide ligand useful in treating an autoimmune disease.
  • epitope(s) refer to a peptide or protein antigen that includes a primary, secondary or tertiary structure similar to an epitope located within any of a number of pathogen polypeptides encoded by the pathogen DNA or RNA.
  • the level of similarity will generally be to such a degree that monoclonal or polyclonal antibodies directed against such polypeptides will also bind to, react with, or otherwise recognize, the peptide or protein antigen.
  • Various immunoassay methods may be employed in conjunction with such antibodies, such as, for example, Western blotting, ELISA, RIA, and the like, all of which are known to those of skill in the art.
  • pathogen epitopes and/or their functional equivalents, suitable for use in vaccines is part of the present invention. Once isolated and identified, one may readily obtain functional equivalents. For example, one may employ the methods of Hopp, as taught in U.S. Pat. No. 4,554,101, incorporated herein by reference, which teaches the identification and preparation of epitopes from amino acid sequences on the basis of hydrophilicity. The methods described in several other papers, and software programs based thereon, can also be used to identify epitopic core sequences (see, for example, Jameson and Wolf, 1988; Wolf et al, 1988; U.S. Pat. No. 4,554,101). The amino acid sequence of these "epitopic core sequences" may then be readily incorporated into peptides, either through the application of peptide synthesis or recombinant technology.
  • the preparation of vaccine compositions that includes the nucleic acids that encode antigens of the invention as the active ingredient, may be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to infection can also be prepared.
  • the preparation may be emulsified, encapsulated in liposomes.
  • the active immunogenic ingredients are often mixed with carriers which are pharmaceutically acceptable and compatible with the active ingredient.
  • pharmaceutically acceptable carrier refers to a carrier that does not cause an allergic reaction or other untoward effect in subjects to whom it is administered.
  • suitable pharmaceutically acceptable carriers include, for example, one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, or the like and combinations thereof.
  • the vaccine can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and/or adjuvants which enhance the effectiveness of the vaccine.
  • adjuvants examples include but are not limited to: aluminum hydroxide, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N- acetyl-nor-muramyl-L-alanyl-D-isoglutamine, MTP-PE and RIBI, which contains three components extracted from bacteria, monophosporyl lipid A, trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2% squalene/Tween 80 emulsion.
  • thr-MDP N-acetyl-muramyl-L-threonyl-D-isoglutamine
  • MTP-PE N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine
  • MTP-PE N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine
  • adjuvants include DDA (dimethyldioctadecylammonium bromide), Freund's complete and incomplete adjuvants and QuilA.
  • immune modulating substances such as lymphokines (e.g., IFN- ⁇ , IL-2 and IL-12) or synthetic IFN- ⁇ inducers such as poly I:C can be used in combination with adjuvants described herein.
  • compositions may include a naked polynucleotide with a single or multiple copies of the specific nucleotide sequences that bind to specific DNA-binding sites of the apolipoproteins present on plasma lipoproteins as described in the current invention.
  • the polynucleotide may encode a biologically active peptide, antisense RNA, or ribozyme and will be provided in a physiologically acceptable administrable form.
  • Another pharmaceutical product that may spring from the current invention may include a highly purified plasma lipoprotein fraction, isolated according to the methodology, described herein from either the patients blood or other source, and a polynucleotide containing single or multiple copies of the specific nucleotide sequences that bind to specific DNA-binding sites of the apolipoproteins present on plasma lipoproteins, prebound to the purified lipoprotein fraction in a physiologically acceptable, administrable form.
  • Yet another pharmaceutical product may include a highly purified plasma lipoprotein fraction which contains recombinant apolipoprotein fragments containing single or multiple copies of specific DNA-binding motifs, prebound to a polynucleotide containing single or multiple copies of the specific nucleotide sequences, in a physiologically acceptable administrable form.
  • Yet another pharmaceutical product may include a highly purified plasma lipoprotein fraction which contains recombinant apolipoprotein fragments containing single or multiple copies of specific DNA-binding motifs, prebound to a polynucleotide containing single or multiple copies of the specific nucleotide sequences, in a physiologically acceptable administrable form.
  • the dosage to be administered depends to a great extent on the body weight and physical condition of the subject being treated as well as the route of administration and frequency of treatment.
  • a pharmaceutical composition that includes the naked polynucleotide prebound to a highly purified lipoprotein fraction may be administered in amounts ranging from 1 ⁇ g to 1 mg polynucleotide and 1 ⁇ g to 100 mg protein.
  • Administration of an rAb and rAb complexes a patient will follow general protocols for the administration of chemotherapeutics, taking into account the toxicity, if any, of the vector. It is anticipated that the treatment cycles would be repeated as necessary. It also is contemplated that various standard therapies, as well as surgical intervention, may be applied in combination with the described gene therapy.
  • Aqueous compositions of the present invention may include an effective amount of the compound, dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium. Such compositions can also be referred to as inocula.
  • a pharmaceutically acceptable carrier or aqueous medium Such compositions can also be referred to as inocula.
  • the use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients also can be incorporated into the compositions.
  • the compositions of the present invention may include classic pharmaceutical preparations. Dispersions also can be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
  • compositions according to the present invention will be via any common route so long as the target tissue is available via that route in order to maximize the delivery of antigen to a site for maximum (or in some cases minimum) immune response.
  • Administration will generally be by orthotopic, intradermal, subcutaneous, intramuscular, intraperitoneal or intravenous injection.
  • compositions that include physiologically acceptable carriers, buffers or other excipients.
  • Vaccine or treatment compositions of the invention may be administered parenterally, by injection, for example, either subcutaneous Iy or intramuscularly. Additional formulations which are suitable for other modes of administration include suppositories, and in some cases, oral formulations or formulations suitable for distribution as aerosols. In the case of the oral formulations, the manipulation of T-cell subsets employing adjuvants, antigen packaging, or the addition of individual cytokines to various formulation that result in improved oral vaccines with optimized immune responses.
  • binders and carriers may include, for example, polyalkylene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably l%-2%.
  • Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain 10%-95% of active ingredient, preferably 25-70%.
  • the antigen encoding nucleic acids of the invention may be formulated into the vaccine or treatment compositions as neutral or salt forms.
  • Pharmaceutically acceptable salts include the acid addition salts (formed with free amino groups of the peptide) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or with organic acids such as acetic, oxalic, tartaric, maleic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroides, and such organic bases as isopropylamine, trimethylamine, 2- ethylamino ethanol, histidine, procaine, and the like.
  • Vaccine or treatment compositions are administered in a manner compatible with the dosage formulation, and in such amount as will be prophylactically and/or therapeutically effective.
  • the quantity to be administered depends on the subject to be treated, including, e.g., capacity of the subject's immune system to synthesize antibodies, and the degree of protection or treatment desired.
  • Suitable dosage ranges are of the order of several hundred micrograms active ingredient per vaccination with a range from about 0.1 mg to 1000 mg, such as in the range from about 1 mg to 300 mg, and preferably in the range from about 10 mg to 50 mg.
  • Suitable regiments for initial administration and booster shots are also variable but are typified by an initial administration followed by subsequent inoculations or other administrations.
  • nucleic acid molecule or fusion polypeptides of this invention will depend, inter alia, upon the administration schedule, the unit dose of antigen administered, whether the nucleic acid molecule or fusion polypeptide is administered in combination with other therapeutic agents, the immune status and health of the recipient, and the therapeutic activity of the particular nucleic acid molecule or fusion polypeptide.
  • compositions can be given in a single dose schedule or in a multiple dose schedule.
  • a multiple dose schedule is one in which a primary course of vaccination may include, e.g., 1-10 separate doses, followed by other doses given at subsequent time intervals required to maintain and or reinforce the immune response, for example, at 1-4 months for a second dose, and if needed, a subsequent dose(s) after several months.
  • Periodic boosters at intervals of 1-5 years, usually 3 years, are desirable to maintain the desired levels of protective immunity.
  • the course of the immunization can be followed by in vitro proliferation assays of peripheral blood lymphocytes (PBLs) co-cultured with ESAT6 or ST-CF, and by measuring the levels of IFN- ⁇ released from the primed lymphocytes.
  • PBLs peripheral blood lymphocytes
  • the assays may be performed using conventional labels, such as radionucleotides, enzymes, fluorescent labels and the like. These techniques are known to one skilled in the art and can be found in U.S. Pat. Nos. 3,791,932, 4,174,384 and 3,949,064, relevant portions incorporated by reference.
  • the modular rAb carrier and/or conjugated rAb carrier-(cohesion/dockerin and/or dockerin- cohesin)-antigen complex may be provided in one or more "unit doses" depending on whether the nucleic acid vectors are used, the final purified proteins, or the final vaccine form is used.
  • Unit dose is defined as containing a predetermined-quantity of the therapeutic composition calculated to produce the desired responses in association with its administration, i.e., the appropriate route and treatment regimen.
  • the quantity to be administered, and the particular route and formulation, are within the skill of those in the clinical arts.
  • the subject to be treated may also be evaluated, in particular, the state of the subject's immune system and the protection desired.
  • a unit dose need not be administered as a single injection but may include continuous infusion over a set period of time.
  • Unit dose of the present invention may conveniently may be described in terms of DNA/kg (or protein/Kg) body weight, with ranges between about 0.05, 0.10, 0.15, 0.20, 0.25, 0.5, 1, 10, 50, 100, 1,000 or more mg/DNA or protein/kg body weight are administered.
  • the amount of rAb-DC/DC- antigen vaccine delivered can vary from about 0.2 to about 8.0 mg/kg body weight.
  • 0.4 mg, 0.5 mg, 0.8 mg, 1.0 mg, 1.5 mg, 2.0 mg, 2.5 mg, 3.0 mg, 4.0 mg, 5.0 mg, 5.5 mg, 6.0 mg, 6.5 mg, 7.0 mg and 7.5 mg of the vaccine may be delivered to an individual in vivo.
  • the dosage of rAb-DC/DC-antigen vaccine to be administered depends to a great extent on the weight and physical condition of the subject being treated as well as the route of administration and the frequency of treatment.
  • a pharmaceutical composition that includes a naked polynucleotide prebound to a liposomal or viral delivery vector may be administered in amounts ranging from 1 ⁇ g to 1 mg polynucleotide to 1 ⁇ g to 100 mg protein.
  • compositions may include between about 1 ⁇ g, 5 ⁇ g, 10 ⁇ g, 20 ⁇ g, 30 ⁇ g, 40 ⁇ g, 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 100 ⁇ g, 150 ⁇ g, 200 ⁇ g, 250 ⁇ g, 500 ⁇ g, 600 ⁇ g, 700 ⁇ g, 800 ⁇ g, 900 ⁇ g or 1,000 ⁇ g polynucleotide or protein that is bound independently to 1 ⁇ g, 5 ⁇ g, 10 ⁇ g, 20 ⁇ g, 3.0 ⁇ g, 40 ⁇ g 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 100 ⁇ g, 150 ⁇ g, 200 ⁇ g, 250 ⁇ g, 500 ⁇ g, 600 ⁇ g, 700 ⁇ g, 800 ⁇ g, 900 ⁇ g, 1 mg, 1.5 mg, 5 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 80 mg, 90 mg or
  • the present invention was tested in an in vitro cellular system that measures immune stimulation of human Flu-specific T cells by dendritic cells to which Flu antigen has been targeted. The results shown herein demonstrate the specific expansion of such antigen specific cells at doses of the antigen which are by themselves ineffective in this system.
  • the present invention may also be used to make a modular rAb carrier that is, e.g., a recombinant humanized mAb (directed to a specific human dendritic cell receptor) complexed with protective antigens from Ricin, Anthrax toxin, and Staphylococcus B enterotoxin.
  • the potential market for this entity is vaccination of all military personnel and stored vaccine held in reserve to administer to large population centers in response to any biothreat related to these agents.
  • the invention has broad application to the design of vaccines in general, both for human and animal use.
  • Industries of interest include the pharmaceutical and biotechnology industries.
  • the present invention includes compositions and methods, including vaccines, that specifically target (deliver) antigens to antigen-presenting cells (APCs) for the purpose of eliciting potent and broad immune responses directed against the antigen. These compositions evoke protective or therapeutic immune responses against the agent (pathogen or cancer) from which the antigen was derived.
  • the invention creates agents that are directly, or in concert with other agents, therapeutic through their specific engagement of a receptor called DC-ASGPR that is expressed on antigen-presenting cells.
  • the novel recombinant humanized mAb (directed to the specific human dendritic cell receptor DC-ASGPR) fused through the antibody (Ab) heavy chain to antigens known or suspected to encode protective antigens.
  • the present invention may be used as a preventative or therapeutic vaccination for at risk or infected patients.
  • the invention has broad application for vaccination against many diseases and cancers, both for human and animal use.
  • Industries that can use the present invention include the pharmaceutical and biotechnological.
  • the present invention can be used to target antigens to APC for vaccination purposes. It is not known which antigen internalizing receptor will be best suited for this purpose.
  • the invention describes particularly advantageous features of DC-ASGPR as for this purpose. Furthermore, the invention shows that engaging DC-ASGPR can be beneficial in the sense of activating the immune system with highly predicted significant therapeutic benefit.
  • the present invention includes the development of high affinity monoclonal antibodies against human DC-ASGPR.
  • Receptor ectodomain.hlgG human IgGlFc
  • AP human placental alkaline phosphatase
  • An expression vector for hDCIR ectodomain.AP was generated using PCR to amplify AP resides 133-1581 (gb
  • DC- ASGPR ectodomain constructs in the same Ig and AP vector series contained inserts encoding (bp 484-1251, gi
  • DC-ASGPR fusion proteins were produced using the FreeStyleTM 293 Expression System (Invitrogen) according to the manufacturer's protocol (1 mg total plasmid DNA with 1.3 ml 293 Fectin reagent /L of transfection).
  • rAb production equal amounts of vector encoding the H and L chain were co-transfected.
  • Transfected cells are cultured for 3 days, the culture supernatant was harvested and fresh media added with continued incubation for two days. The pooled supernatants were clarified by filtration.
  • Receptor ectodomain.hlgG was purified by HiTrap protein A affinity chromatography with elution by 0.1 M glycine pH 2.7 and then dialyzed versus PBS.
  • mice were immunized intraperitoneal with 20 ⁇ g of receptor ectodomain.hlgGFc fusion protein with Ribi adjuvant, then boosts with 20 ⁇ g antigen 10 days and 15 days later. After 3 months, the mice were boosted again three days prior to taking the spleens. Alternately, mice were injected in the footpad with 1-10 ⁇ g antigen in Ribi adjuvant every 3-4 days over a 30-40 day period. 3-4 days after a final boost, draining lymph nodes were harvested.
  • B cells from spleen or lymph node cells were fused with SP2/O-Ag 14 cells (Shulman, Wilde et al. 1978) using conventional techniques.
  • ELISA was used to screen hybridoma supernatants against the receptor ectodomain fusion protein compared to the fusion partner alone, or versus the receptor ectodomain fused to AP (Bates, Fournier et al. 1999). Positive wells were then screened in FACS using 293F cells transiently transfected with expression plasmids encoding full-length receptor cDNAs. Selected hybridomas were single cell cloned and expanded in CELLine flasks (Intergra).
  • Hybridoma supernatants were mixed with an equal volume of 1.5 M glycine, 3 M NaCl, Ix PBS, pH 7.8 and tumbled with MabSelect resin. The resin was washed with binding buffer and eluted with 0.1 M glycine, pH 2.7. Following neutralization with 2 M Tris, mAbs were dialyzed versus PBS.
  • FIG. IA shows that signaling through DC-ASGPR activates DCs.
  • DCs are the primary immune cells that determine the results of immune responses, either induction or tolerance, depending on their activation (75). The role of LLRs in DC activation is not clear yet. Therefore, we tested whether triggering the LLR DC-ASGPR can result in the activation of DCs.
  • GM/IL-4 DCs express LOX-I, ASGPR, and CLEC-6 (Fig. IA).
  • Six day DCs were stimulated with mAb specific to DC-ASGPR, and data in Fig. IB show that signals through DC-ASGPR could activate DCs, resulting in the increased expression of CD86 and HLA-DR.
  • DC-ASGPR Triggering DC-ASGPR on DCs also resulted in the increased production of IL-6, MCP-I, IL-12p40, and IL-8 from DCs (Fig. 1C).
  • DCs stimulated with DC-ASGPR specific mAb expressed increased levels of multiple genes, including co-stimulatory molecules as well as chemokine and cytokine -related genes (Fig. ID).
  • DCs activated with anti- DC-ASGPR mAb resulted in remarkably enhanced B cell proliferation (CFSE dilution) and plasma cell differentiation (CD38 CD20 ), compared to DCs stimulated with control mAb.
  • CD38 CD20 B cells have a typical morphology of plasma cells, but they do not express CD 138. The majority of proliferating cells did not express CCR2, CCR4, CCR6, or CCR7. The amounts of total immunoglobulins (Igs) produced were measured by ELISA (Fig. 2B). Consistent with the data in Fig. 2A, B cells cultured with anti DC-ASGPR-stimulated DCs resulted in significantly increased production of total IgM, IgG, and IgA.
  • DCs activated by triggering DC-ASGPR are more potent than DCs stimulated with control mAb for the production of influenza- virus-specific IgM, IgG, and IgA (Fig. 2C) by B cells, suggesting that DC-ASGPR-mediated DC activation contributes to both total and antigen specific humoral immune responses.
  • DC-ASGPR in ex vivo antigen presenting cells (APCs) in humoral immune responses.
  • APCs ex vivo antigen presenting cells
  • PBMCs from buffy coats were cultured in the plates coated with anti- DC-ASGPR mAb, and the total Igs and B cell proliferation were measured. Consistent with the data generated from DCs (Fig. 2A), APCs stimulated through DC-ASGPR resulted in enhanced B cell proliferation and plasma cell differentiation in the absence (upper panels in Fig. 2d) or presence (lower panels in Fig. 2D) of TLR9 ligand. The total IgM, IgG, and IgA were also significantly increased when PBMCs were cultured in the plates coated with mAb against DC-ASGPR (Fig. 2e). As shown in Fig.
  • DCs activated by signaling through DC-ASGPR have matured phenotypes and produce large amounts of inflammatory cytokines and chemokines, and both matured DC phenotypes and soluble factors from DCs could contribute to the enhanced B cells responses (Fig. 2).
  • DC- derived B lymphocyte stimulator protein BBL
  • BAFF DC-derived B lymphocyte stimulator protein
  • APRIL proliferation-inducing ligand
  • DC-ASGPR contributes to B cell activation and Ig production.
  • CD19 + B cells express DC- ASGPR (Fig. 3A). Therefore, we tested the role of DC-ASGPR in B cell activation.
  • Data in Fig. 3B show that B cells stimulated through DC-ASGPR produced significantly higher amounts of chemokines.
  • IL-8 and MIP-Ia slight increases in IL-6 and TNF ⁇ were also observed when B cells were stimulated with the anti- DC-ASGPR mAb, compared to control mAb.
  • Genes related to cell activation were also up-regulated (Fig. 3C).
  • B cells produced IgM, IgG, and IgA when they were stimulated through DC-ASGPR (Fig. 3D), suggesting that DC- ASGPR could play an important role in the maintenance of normal immunoglobulin levels in vivo.
  • signaling through DC-ASGPR alone did not induce significant B cell proliferation.
  • DCs stimulated through DC-ASGPR express enhanced levels of co-stimulatory molecules and produce increased amounts of cytokines and chemokines (see Fig. 1), suggesting that DC-ASGPR contributes to cellular immune responses as well as humoral immune responses. This was tested by a mixed lymphocyte reaction (MLR). Proliferation of purified allogeneic T cells was significantly enhanced by DCs stimulated with mAb specific for DC-ASGPR (Fig. 4A). DCs activated through DC-ASGPR could also prime Mart- 1 -specific CD8 T cells more efficiently than DC stimulated with control mAb (upper panels in Fig. 4B).
  • PBMCs were isolated from Buffy coats using PercollTM gradients (GE Healthcare UK Ltd, Buckinghamshire, UK) by density gradient centrifugation.
  • DC activation 1x10 5 DCs were cultured in the mAb-coated 96-well plate for 16-18h. mAbs (1-2 ⁇ g/well) in carbonate buffer, pH 9.4, were incubated for at least 3h at 37 0 C. Culture supernatants were harvested and cytokines / chemokines were measured by Luminex (Biorad, CA). For gene analysis, DCs were cultured in the plates coated with mAbs for 8h. In some experiments, soluble 50 ng/ml of CD40L (R&D, CA) or 50 nM CpG (InVivogen, CA) was added into the cultures.
  • DCs and B cell co-cultures 5x10 3 DCs resuspended in RPMI 1640 with 10% FCS and antibiotics (Biosource, CA) were first cultured in the plates coated with mAbs for at least 6h, and then 1x10 5 purified autologous B cells labeled with CFSE (Molecular Probes, OR) were added.
  • DCs were pulsed with 5 moi (multiplicity of infection) of heat-inactivated influenza virus (A/PR/8 HlNl) for 2h, and then mixed with B cells.
  • A/PR/8 HlNl heat-inactivated influenza virus
  • 5x10 3 DCs were cultured with 1x10 5 purified autologous CD8 T cells or mixed allogeneic T cells.
  • Allogeneic T cells were pulsed with 1 ⁇ Ci/well [H]-thymidine for the final 18h of incubation, and then cpm were measured by a ⁇ -counter (Wallac, MN).
  • 5xlO 5 PBMCs /well were cultured in the plates coated with mAbs.
  • the frequency of Mart-1 and Flu Ml specific CD8 T cells was measured by staining cells with anti-CD8 and tetramers on day ten and day seven of the cultures, respectively.
  • 10 ⁇ M of Mart-1 peptide (ELAGIGILT V) (SEQ ID NO.: 2) and 20 nM of recombinant protein containing Mart-1 peptides (see below) were added to the DC and CD8 T cell cultures.
  • 20 nM purified recombinant Flu Ml protein was add to the PBMC cultures.
  • Monoclonal antibodies - Mouse mAbs were generated by conventional technology. Briefly, six- week-old BALB/c mice were immunized i.p. with 20 ⁇ g of receptor ectodomain.hlgGFc fusion protein with Ribi adjuvant, then boosts with 20 ⁇ g antigen ten days and fifteen days later. After three months, the mice were boosted again three days prior to taking the spleens. Alternately, mice were injected in the footpad with 1-10 ⁇ g antigen in Ribi adjuvant every three to four days over a thirty to forty day period. Three to four days after a final boost, draining lymph nodes were harvested.
  • B cells from spleen or lymph node cells were fused with SP2/O-Ag 14 cells.
  • Hybridoma supernatants were screened to analyze Abs to the receptor ectodomain fusion protein compared to the fusion partner alone, or the receptor ectodomain fused to alkaline phosphatase (44). Positive wells were then screened in FACS using 293F cells transiently transfected with expression plasmids encoding full-length receptor cDNAs. Selected hybridomas were single cell cloned and expanded in CELLine flasks (Integra, CA).
  • Hybridoma supernatants were mixed with an equal volume of 1.5 M glycine, 3 M NaCl, Ix PBS, pH 7.8 and tumbled with MabSelect resin. The resin was washed with binding buffer and eluted with 0.1 M glycine, pH 2.7. Following neutralization with 2 M Tris, mAbs were dialyzed versus PBS.
  • ELISA - Sandwich ELISA was performed to measure total IgM, IgG, and IgA as well as flu- specific immunoglobulins (Igs).
  • Standard human serum (Bethyl) containing known amounts of Igs and human AB serum were used as standard for total Igs and flu-specific Igs, respectively.
  • Flu specific Ab titers, units, in samples were defined as dilution factor of AB serum that shows an identical optical density.
  • the amounts of BAFF and BLyS were measured by ELISA kits (Bender MedSystem, CA).
  • Biotin-labeled cRNA targets were prepared using the Illumina totalprep labeling kit (Ambion) and hybridized to Sentrix Human ⁇ BeadChips (46K transcripts). These microarrays consist of 50mer oligonucleotide probes attached to 3 ⁇ m beads which are lodged into microwells etched at the surface of a silicon wafer. After staining with
  • Streptavidin-Cy3 the array surface is imaged using a sub-micron resolution scanner manufactured by Illumina (Beadstation 500X).
  • Illumina Beadstation 500X.
  • DTTEARHPHPPVTTPTTDRKGTTAEELAGIGILTVILGGKRTNNSTPTKGEFCRYPSHWR P (SEQ ID NO.: 4) - the shaded residues are the immunodominant HL A- A2 -restricted peptide and the underlined residues surrounding the peptide are from MART-I) was inserted between the Nhe I and Xho I sites of the above vector.
  • the proteins were expressed in E. coli strain BL21 (DE3) (Novagen) or T7 Express (NEB), grown in LB at 37°C with selection for kanamycin resistance (40 ⁇ g/ml) and shaking at 200 rounds/min to mid log phase growth when 120 mg/L IPTG was added.
  • E. coli cells from each 1 L fermentation were resuspended in 30 ml ice-cold 50 mM Tris, 1 mM EDTA pH 8.0 (buffer B) with 0.1 ml of protease inhibitor Cocktail II (Calbiochem, CA).
  • the cells were sonicated on ice 2x 5 min at setting 18 (Fisher Sonic Dismembrator 60) with a 5 min rest period and then spun at 17,000 r.p.m. (Sorvall SA-600) for 20 min at 4°C.
  • anti-DC-ASGPR mAbs - The invention encompasses particular amino acid sequences shown below corresponding to anti- DC-ASGPR monoclonal antibodies that are desirable components (in the context of e.g., humanized recombinant antibodies) of therapeutic or protective products. The following are such sequences in the context of chimeric mouse V region - human C region recombinant antibodies. [mAnti-ASGPR_49C 11 7H-LV-hIgG4H-C] is
  • [mAnti-ASGPR_49Cl l_7K-LV-hIgGK-C] is the corresponding L chain chimera - QIVLTQSPAIMSASPGEKVTMTCSASSSVSHMHWYQQKSGTSPKRWIYDTSRLASGVPA RFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSHPWSFGGGTKLEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (SEQ ID NO.: 6).
  • [mAnti- ASGPR_4G2.2_Hv-V-hIgG4H-C] is the corresponding L chain chimera - QIVLTQSPAIMSASPGEKVTMTCSASSSVSHMHWYQQKSGTSPKRWIYDTSRLASGVPA RFSGSGSGTSYSLTISSMEAEDAATY
  • V-region sequences and related sequences modified by those well versed in the art to e.g., enhance affinity for DC-ASGPR and/or integrated into human V-region framework sequences to be engineered into expression vectors to direct the expression of protein forms that can bind to DC-ASGPR on antigen presenting cells.
  • Engineered recombinant anti-DC-ASGPR recombinant antibody - antigen fusion proteins are efficacious prototype vaccines in vitro -
  • Expression vectors can be constructed with diverse protein coding sequence e.g., fused in-frame to the H chain coding sequence.
  • antigens such as Influenza HA5, Influenza Ml, HIV gag, or immuno- dominant peptides from cancer antigens, or cytokines, can be expressed subsequently as rAb. antigen or rAb.
  • cytokine fusion proteins which in the context of this invention, can have utility derived from using the anti-DC-ASGPR V-region sequence to bring the antigen or cytokine (or toxin) directly to the surface of the antigen presenting cell bearing DC-ASGPR.
  • This permits internalization of e.g., antigen - sometimes associated with activation of the receptor and ensuing initiation of therapeutic or protective action (e.g., via initiation of a potent immune response, or via killing of the targeted cell.
  • An exemplative prototype vaccine based on this concept could use a H chain vector such as [mAnti-ASGPR_5F10H-LV-hIgG4H-C-Flex- FluHA5-l-6xHis] or
  • the above sequence corresponds to the chimeric H chain shown already fused via a flexible linker sequence (shown italicized) to HA-I domain of avian Flu HA5 (shown in bold). This can be co-expressed with the corresponding L chain chimeric sequence already shown above.
  • Figure 6 shows that different antigens can be expressed in the context of a DC-ASGPR rAb.
  • Such an anti-DC-ASGPR rAb.Doc protein can be simply mixed with any Cohesin.fusion protein to assemble a stable non-covalent [rAb.Doc:Coh.fusion] complex that functions just as a rAb. fusion protein.
  • Figure 6 shows that such a [rAb.Doc:Coh.fusion] complex can focus antigen to the surface of cells expressing DC-ASGPR.
  • the figure also shows anti-DC- ASGPR.Doc:Coh.Flu Ml complexes deliver Flu Ml to the surface of 293F cells transfected with DC-ASGPR cDNA.
  • Anti-DC-ASGPR rAb complexed to Flu Ml via Dockerin:Cohesin interaction targets the antigen to human DCs and results in the expansion of Flu Ml -specific CD8+ T cells - the potential utility of anti-DC-ASGPR rAbs as devices to deliver antigen to e.g., DC is shown in the figure below.
  • Figure 7 shows the dramatic expansion of Flu Ml -specific CD8+ cells is highly predictive of potency of such an agent as a vaccine directed to eliciting protective immune responses against Flu Ml .
  • Figure 8 demonstrated the cross reactivity of the different antibodies with monkey ASGPR.
  • pIRES_ ASGPR-mon monkey
  • the sequence of final product is base on clone 5S10.
  • Most other clones are either similar to this with one aa difference or identical to this.
  • one clone, 5Sl has an A deletion near the 3' end, which generated a shortened and different C terminus and maybe used as a second variant.
  • DC- ASGPR MoN gaattcgctagcCACCATGACATATGAAAACTTCCAAGACTTGGAGAGTGAGGAGAAAGT CCAAGGGG (SEQ ID NO.: 15); and DC-ASGPR Mo:
  • the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), "including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps.
  • A, B, C, or combinations thereof refers to all permutations and combinations of the listed items preceding the term.
  • A, B, C, or combinations thereof is intended to include at least one of: A, B, C, AB, AC, BC, or ABC, and if order is important in a particular context, also BA, CA, CB, CBA, BCA, ACB, BAC, or CAB.
  • expressly included are combinations that contain repeats of one or more item or term, such as BB, AAA, MB, BBC, AAABCCCC, CBBAAA, CABABB, and so forth.
  • the skilled artisan will understand that typically there is no limit on the number of items or terms in any combination, unless otherwise apparent from the context.
  • compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
  • T. B. Geijtenbeek et al Nat Immunol 1, 353 (Oct, 2000). 5. T. B. Geijtenbeek et al, Cell 100, 575 (Mar 3, 2000).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Genetics & Genomics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Virology (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Mycology (AREA)
  • Hematology (AREA)
  • Optics & Photonics (AREA)
  • Physics & Mathematics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Toxicology (AREA)
  • Pulmonology (AREA)
PCT/US2008/052865 2007-02-02 2008-02-02 Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc- asgpr) Ceased WO2008097870A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
JP2009548484A JP2010518024A (ja) 2007-02-02 2008-02-02 樹状細胞アシアロ糖タンパク質受容体(dc−asgpr)を介して抗原提示細胞に結合する作用物質
BRPI0807152-7A BRPI0807152A2 (pt) 2007-02-02 2008-02-02 Agentes que acoplam células contendo antígeno através do receptor asialoglicoproteina de célula dendrítica (dc-asgpr)
CN2008800113498A CN101952414A (zh) 2007-02-02 2008-02-02 通过树突细胞脱唾液酸糖蛋白受体(dc-asgpr)结合抗原呈递细胞的活性剂
AU2008214036A AU2008214036B2 (en) 2007-02-02 2008-02-02 Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (DC- ASGPR)
NZ578756A NZ578756A (en) 2007-02-02 2008-02-02 Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc- asgpr
MX2009008211A MX2009008211A (es) 2007-02-02 2008-02-02 Agentes que capturan celulas que presentan antigenos mediante un receptor de asialoglicoproteina de celula dendritica (dc-asgpr).
EP08714180.0A EP2115129B1 (en) 2007-02-02 2008-02-02 Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc- asgpr)
CA2715045A CA2715045C (en) 2007-02-02 2008-02-02 Agents that engage antigen-presenting cells through dendritic cell asialoglycoprotein receptor (dc-asgpr)
IL200093A IL200093A0 (en) 2007-02-02 2009-07-27 Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc- asgpr)
IL218085A IL218085A0 (en) 2007-02-02 2012-02-13 Use of antibodies or other specific binding molecules directed to dc-asgpr, in the preparation of medicaments for delivering antigens to antigen-presenting cells

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US88803607P 2007-02-02 2007-02-02
US60/888,036 2007-02-02

Publications (2)

Publication Number Publication Date
WO2008097870A2 true WO2008097870A2 (en) 2008-08-14
WO2008097870A3 WO2008097870A3 (en) 2010-01-07

Family

ID=39682353

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2008/052865 Ceased WO2008097870A2 (en) 2007-02-02 2008-02-02 Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc- asgpr)

Country Status (14)

Country Link
US (7) US8236934B2 (enExample)
EP (1) EP2115129B1 (enExample)
JP (1) JP2010518024A (enExample)
KR (1) KR20090114432A (enExample)
CN (1) CN101952414A (enExample)
AU (1) AU2008214036B2 (enExample)
BR (1) BRPI0807152A2 (enExample)
CA (1) CA2715045C (enExample)
IL (2) IL200093A0 (enExample)
MX (1) MX2009008211A (enExample)
NZ (2) NZ578756A (enExample)
TW (1) TWI422594B (enExample)
WO (1) WO2008097870A2 (enExample)
ZA (1) ZA200905274B (enExample)

Cited By (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012051291A1 (en) * 2010-10-13 2012-04-19 Baylor Research Institute Targeting antigens to human dendritic cells via dc-asialoglycoprotein receptor to produce il-10 regulatory t cells
CN102741295A (zh) * 2009-03-10 2012-10-17 贝勒研究院 靶向抗原呈递细胞的抗病毒疫苗
WO2013009841A1 (en) * 2011-07-11 2013-01-17 Baylor Research Institute Subsets of antigen-presenting cells (apc's) in the human vagina and their distinct functions
EP2406289A4 (en) * 2009-03-10 2013-05-29 Baylor Res Inst ANTIVIRAL VACCINES TREATED ON ANTIGEN PRESENTING CELLS
WO2014012479A1 (en) 2012-07-18 2014-01-23 Shanghai Birdie Biotech, Inc. Compounds for targeted immunotherapy
EP2688591A4 (en) * 2011-03-22 2014-10-01 Baylor Res Inst TARGETING DENDRITIC CELLS FOR A TUBERCULOSIS VACCINE
EP2688592A4 (en) * 2011-03-25 2015-07-22 Baylor Res Inst Compositions and methods for immunization against the hepatitis C virus
US9827329B2 (en) 2014-01-10 2017-11-28 Birdie Biopharmaceuticals, Inc. Compounds and compositions for immunotherapy
WO2017214456A1 (en) 2016-06-08 2017-12-14 Abbvie Inc. Anti-cd98 antibodies and antibody drug conjugates
WO2017214339A1 (en) 2016-06-08 2017-12-14 Abbvie Inc. Anti-b7-h3 antibodies and antibody drug conjugates
WO2017214322A1 (en) 2016-06-08 2017-12-14 Abbvie Inc. Anti-b7-h3 antibodies and antibody drug conjugates
WO2018112334A1 (en) 2016-12-16 2018-06-21 Bluefin Biomedicine, Inc. Anti-cub domain-containing protein 1 (cdcp1) antibodies, antibody drug conjugates, and methods of use thereof
US10087256B2 (en) 2009-03-10 2018-10-02 Baylor Research Institute Method of making an anti-CD40 antibody
WO2018195302A1 (en) 2017-04-19 2018-10-25 Bluefin Biomedicine, Inc. Anti-vtcn1 antibodies and antibody drug conjugates
WO2018231827A1 (en) 2017-06-12 2018-12-20 Bluefin Biomedicine, Inc. Anti-il1rap antibodies and antibody drug conjugates
US10610585B2 (en) 2017-09-26 2020-04-07 Inserm (Institut National De La Sante Et De La Recherche Medicale) Methods and compositions for treating and preventing HIV
US10640563B2 (en) 2016-06-08 2020-05-05 Abbvie Inc. Anti-B7-H3 antibodies and antibody drug conjugates
US10940195B2 (en) 2014-01-13 2021-03-09 Baylor Research Institute Vaccines against HPV and HPV-related diseases
US11046781B2 (en) 2016-01-07 2021-06-29 Birdie Biopharmaceuticals, Inc. Anti-HER2 combinations for treating tumors
US11053240B2 (en) 2017-04-27 2021-07-06 Birdie Biopharmaceuticals, Inc. 2-amino-quinoline derivatives
US11130812B2 (en) 2014-09-01 2021-09-28 Birdie Biopharmaceuticals, Inc. Anti PD-L1 conjugates for treating tumors
US11136397B2 (en) 2016-01-07 2021-10-05 Birdie Pharmaceuticals, Inc. Anti-EGFR combinations for treating tumors
US11220552B2 (en) 2016-01-07 2022-01-11 Birdie Biopharmaceuticals, Inc. Anti-CD20 combinations for treating tumors
US11279761B2 (en) 2014-07-09 2022-03-22 Birdie Biopharmaceuticals, Inc. Anti-PD-L1 combinations for treating tumors
US11517567B2 (en) 2017-06-23 2022-12-06 Birdie Biopharmaceuticals, Inc. Pharmaceutical compositions
EP4218929A1 (en) 2014-03-21 2023-08-02 AbbVie Inc. Anti-egfr antibodies and antibody drug conjugates
US11759527B2 (en) 2021-01-20 2023-09-19 Abbvie Inc. Anti-EGFR antibody-drug conjugates
WO2025027529A1 (en) 2023-07-31 2025-02-06 Advesya Anti-il-1rap antibody drug conjugates and methods of use thereof
WO2025126157A1 (en) 2023-12-15 2025-06-19 Advesya Anti-il-1rap binding domains and antibody-drug conjugates thereof

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TWI422594B (zh) 2007-02-02 2014-01-11 Baylor Res Inst 經由樹狀細胞去唾液酸糖蛋白受體(dc-asgpr)接合抗原呈現細胞之藥劑
ES2536900T3 (es) * 2007-02-02 2015-05-29 Baylor Research Institute Antígenos multivariables en complejo con anticuerpo monoclonal humanizado de dirección
FR2955773B1 (fr) * 2010-02-01 2017-05-26 Commissariat Energie Atomique Complexe moleculaire de ciblage des antigenes vers les cellules presentatrices d'antigene et ses applications pour la vaccination
US20110274653A1 (en) * 2010-05-07 2011-11-10 Baylor Research Institute Dendritic cell immunoreceptors (dcir)-mediated crosspriming of human cd8+ t cells
US9850296B2 (en) 2010-08-10 2017-12-26 Ecole Polytechnique Federale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US9517257B2 (en) 2010-08-10 2016-12-13 Ecole Polytechnique Federale De Lausanne (Epfl) Erythrocyte-binding therapeutics
AU2011289579B2 (en) 2010-08-10 2016-11-17 Ecole Polytechnique Federale De Lausanne Erythrocyte-binding therapeutics
WO2014031984A1 (en) * 2012-08-24 2014-02-27 Baylor Research Institute Immunological detection methods and compositions
WO2014085580A1 (en) * 2012-11-28 2014-06-05 Baylor Research Institute Methods and compositions involving a flu vaccine
EP3013362B1 (en) * 2013-06-28 2021-08-04 Baylor Research Institute Dendritic cell asgpr targeting immunotherapeutics for multiple sclerosis
CN103409451A (zh) * 2013-06-28 2013-11-27 扬州维克斯生物科技有限公司 一种向树突状细胞dc靶向加载肿瘤抗原肽的方法
RU2016129744A (ru) * 2013-12-24 2018-01-30 Астеллас Фарма Инк. Новое антитело против bdca-2 человека
LT3107563T (lt) 2014-02-21 2021-07-12 Ecole Polytechnique Fédérale De Lausanne (Epfl) Epfl-Tto Gliko-nukreipiantys terapiniai agenai
US10946079B2 (en) 2014-02-21 2021-03-16 Ecole Polytechnique Federale De Lausanne Glycotargeting therapeutics
US10046056B2 (en) 2014-02-21 2018-08-14 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US10953101B2 (en) 2014-02-21 2021-03-23 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
CN106659774A (zh) * 2014-05-16 2017-05-10 贝勒研究院 用于治疗自身免疫和炎性病症的方法和组合物
US11000597B2 (en) 2015-01-21 2021-05-11 University Of Florida Research Foundation, Incorporated Engineered receptor/ligand system for delivery of therapeutic agents
CA3114549A1 (en) 2017-02-21 2018-08-30 University Of Florida Research Foundation, Incorporated Modified aav capsid proteins and uses thereof
US11253579B2 (en) 2017-06-16 2022-02-22 The University Of Chicago Compositions and methods for inducing immune tolerance
EA202092723A1 (ru) 2018-05-09 2021-04-09 Зе Юниверсити Оф Чикаго Композиции и способы, касающиеся иммунной толерантности

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3791932A (en) 1971-02-10 1974-02-12 Akzona Inc Process for the demonstration and determination of reaction components having specific binding affinity for each other
US3949064A (en) 1973-10-26 1976-04-06 Baxter Laboratories, Inc. Method of detecting antigens or antibodies
US4174384A (en) 1975-06-30 1979-11-13 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US6541011B2 (en) 1998-02-11 2003-04-01 Maxygen, Inc. Antigen library immunization

Family Cites Families (44)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2159639A1 (en) 1993-04-02 1994-10-13 Vincent J. Miles Method for selective inactivation of viral replication
US20040258688A1 (en) * 1995-01-31 2004-12-23 Daniel Hawiger Enhanced antigen delivery and modulation of the immune response therefrom
JPH11513568A (ja) 1995-10-17 1999-11-24 ジェネンコア インターナショナル インコーポレーテッド 酵素配列体およびそれを製造する方法
WO1997034634A1 (en) 1996-03-20 1997-09-25 Sloan-Kettering Institute For Cancer Research Single chain fv constructs of anti-ganglioside gd2 antibodies
FR2748479A1 (fr) 1996-05-10 1997-11-14 Pasteur Institut Polypeptide comportant un nouveau domaine cohesine de type ii, composition enzymatique en comportant et fragments d'adn codant pour ces polypeptides
US6046158A (en) 1996-12-20 2000-04-04 Board Of Regents The University Of Texas Systems Unique dendritic cell-associated C-type lectins, dectin-1 and dectin-2; compositions and uses thereof
PL337942A1 (en) 1997-07-09 2000-09-11 Schering Corp Isolated genes of dendricall cell membranic proteins
US6777546B2 (en) * 1997-10-07 2004-08-17 Loma Linda University Methods and substances for preventing and treating autoimmune disease
US5945308A (en) 1998-04-03 1999-08-31 Incyte Pharmaceuticals, Inc. Human oxidized LDL receptor
JP2000157282A (ja) 1998-11-30 2000-06-13 Toyota Central Res & Dev Lab Inc 酵素配列複合体及び固定化酵素配列複合体とそれらの製造方法、担体分子及び酵素
AU783294B2 (en) 1999-03-24 2005-10-13 Board Of Regents, The University Of Texas System Linear and circular expression elements
EP1046651A1 (en) 1999-04-19 2000-10-25 Koninklijke Universiteit Nijmegen Composition and method for modulating dendritic cell-T interaction
ATE261929T1 (de) 1999-04-21 2004-04-15 Basf Ag Gemisch von diestern der adipin- oder phthalsäure mit isomeren nonanolen
EP1418234A4 (en) 2000-03-02 2005-03-16 Abgenix Inc HUMAN MONOCLONAL ANTIBODIES DIRECTED AGAINST OXIDIZED LDL RECEPTORS AND THEIR MEDICAL USE
FR2816060A1 (fr) 2000-10-27 2002-05-03 Pf Medicament Procede d'identification de nouvelles molecules se liant au recepteur lox et utilisation de ces molecules
WO2003018749A2 (en) 2001-08-22 2003-03-06 Shengfeng Li Compositions and methods for generating antigen-binding units
EP1441030A4 (en) 2001-10-11 2007-08-15 Katakura Ind Co Ltd PROCESS FOR CLEANING A RECOMBINANT FUSION PROTEIN AND METHOD FOR PRODUCING PROTEIN THEREWITH
JPWO2003036895A1 (ja) 2001-10-25 2005-02-17 株式会社ルネサステクノロジ 通信用半導体集積回路および変復調装置並びに通信状態診断方法
WO2003046012A1 (en) 2001-11-30 2003-06-05 Crucell Holland B.V. Antigen presenting cell targeting conjugate, an antigen presenting cell contacted with such conjugate, their use for vaccination or as medicament, and methods for their production or generation
AU2003213640A1 (en) 2002-02-28 2003-09-16 Corixa Corporation Methods of modulating dendritic cells using adjuvants
US6738985B2 (en) 2002-05-14 2004-05-25 David S. Hahn Disposable sweatband liner
US7217420B2 (en) * 2002-07-13 2007-05-15 The University Of Georgia Research Foundation, Inc. Mycoplasma gallisepticum formulation
US20040091503A1 (en) 2002-08-20 2004-05-13 Genitrix, Llc Lectin compositions and methods for modulating an immune response to an antigen
JP2004236504A (ja) 2003-02-03 2004-08-26 Toyota Central Res & Dev Lab Inc 酵素配列複合体及び固定化酵素配列複合体とそれらの製造方法、担体分子及び酵素
EP1605974B1 (en) 2003-03-04 2014-11-12 Alexion Pharmaceuticals, Inc. Method of treating autoimmune disease by inducing antigen presentation by tolerance inducing antigen presenting cells
US20050064509A1 (en) 2003-09-23 2005-03-24 The Regents Of The University Of California Use of templated self assembly to create novel multifunctional species
US20060019342A1 (en) * 2004-06-25 2006-01-26 Medimmune, Inc. Increasing the production of recombinant antibodies in mammalian cells by site-directed mutagenesis
CN101484182B (zh) 2005-04-06 2014-06-11 Ibc药品公司 由同二聚体、同四聚体或二聚体的二聚体组成的稳定连接复合体的生产方法及用途
US7666596B2 (en) 2005-05-23 2010-02-23 University Of Alberta Tissue rejection
AU2006297259A1 (en) 2005-09-30 2007-04-12 Oklahoma Medical Research Foundation Regulation of toll-like receptors on stem cells
GB0605735D0 (en) 2006-03-22 2006-05-03 Immunobiology Ltd Composition and method for mediating an immune response
SG170799A1 (en) * 2006-03-28 2011-05-30 Biogen Idec Inc Anti-igf-ir antibodies and uses thereof
TWI422594B (zh) 2007-02-02 2014-01-11 Baylor Res Inst 經由樹狀細胞去唾液酸糖蛋白受體(dc-asgpr)接合抗原呈現細胞之藥劑
ES2536900T3 (es) 2007-02-02 2015-05-29 Baylor Research Institute Antígenos multivariables en complejo con anticuerpo monoclonal humanizado de dirección
BRPI0807160A2 (pt) 2007-02-02 2018-09-25 Baylor Res Institute vacinas baseadas no direcionamento de antígeno ao dcir expresso em células apresentadoras de antígeno
EP2132226B1 (en) 2007-02-23 2019-03-27 Baylor Research Institute Activation of human antigen-presenting cells through dendritic cell lectin-like oxidized ldl receptor-1 (lox-1)
TWI423985B (zh) 2007-02-23 2014-01-21 Baylor Res Inst 利用dectin-1活化人類抗原呈現細胞之醫療應用
TWI506035B (zh) 2010-08-13 2015-11-01 Baylor Res Inst 以直接針對抗原呈現細胞之抗體的標靶佐劑為主之新穎疫苗佐劑
US20120121592A1 (en) 2010-10-13 2012-05-17 Baylor Research Institute Targeting Antigens to Human Dendritic Cells Via DC-Asialoglycoprotein Receptor to Produce IL-10 Regulatory T-Cells
TW201247706A (en) 2011-03-08 2012-12-01 Baylor Res Inst Novel vaccine adjuvants based on targeting adjuvants to antibodies directly to antigen-presenting cells
EP2688591A4 (en) 2011-03-22 2014-10-01 Baylor Res Inst TARGETING DENDRITIC CELLS FOR A TUBERCULOSIS VACCINE
CA2831294A1 (en) 2011-03-25 2012-10-04 Baylor Research Institute Compositions and methods to immunize against hepatitis c virus
AR086287A1 (es) 2011-05-05 2013-12-04 Baylor Res Inst Composicion inmunoestimulante, metodo
EP3013362B1 (en) * 2013-06-28 2021-08-04 Baylor Research Institute Dendritic cell asgpr targeting immunotherapeutics for multiple sclerosis

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3791932A (en) 1971-02-10 1974-02-12 Akzona Inc Process for the demonstration and determination of reaction components having specific binding affinity for each other
US3949064A (en) 1973-10-26 1976-04-06 Baxter Laboratories, Inc. Method of detecting antigens or antibodies
US4174384A (en) 1975-06-30 1979-11-13 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US6541011B2 (en) 1998-02-11 2003-04-01 Maxygen, Inc. Antigen library immunization

Non-Patent Citations (10)

* Cited by examiner, † Cited by third party
Title
A. CAMBI ET AL., EUR J IMMUNOL, vol. 33, February 2003 (2003-02-01), pages 532
C. F. D'OSTIANI ET AL., J EXP MED, vol. 191, 15 May 2000 (2000-05-15), pages 1661
C. FRADIN; D. POULAIN; T. JOUAULT, INFECT IMMUN, vol. 68, August 2000 (2000-08-01), pages 4391
C. G. FIGDOR; Y. VAN KOOYK; G. J. ADEMA, NAT REV IMMUNOL, vol. 2, February 2002 (2002-02-01), pages 77
E. PYZ; A. S. MARSHALL; S. GORDON; G. D. BROWN, ANN MED, vol. 38, 2006, pages 242
G. D. BROWN, NAT REV IMMUNOL, vol. 6, January 2006 (2006-01-01), pages 33
See also references of EP2115129A4
T. B. GEIJTENBEEK ET AL., CELL, vol. 100, 3 March 2000 (2000-03-03), pages 575
T. B. GEIJTENBEEK ET AL., NAT IMMUNOL, vol. 1, October 2000 (2000-10-01), pages 353
VALLADEAU ET AL., THE JOURNAL OF IMMUNOLOGY, vol. 167, 2001, pages 5767 - 5774

Cited By (52)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10980869B2 (en) 2009-03-10 2021-04-20 Baylor Research Institute Fusion proteins comprising an anti-CD40 antibody and cancer antigens
CN102741295A (zh) * 2009-03-10 2012-10-17 贝勒研究院 靶向抗原呈递细胞的抗病毒疫苗
EP2406289A4 (en) * 2009-03-10 2013-05-29 Baylor Res Inst ANTIVIRAL VACCINES TREATED ON ANTIGEN PRESENTING CELLS
US10087256B2 (en) 2009-03-10 2018-10-02 Baylor Research Institute Method of making an anti-CD40 antibody
US9102734B2 (en) 2009-03-10 2015-08-11 Baylor Research Institute Fusion proteins comprising antibody and HPV E6 and E7 antigens
US10683361B2 (en) 2009-03-10 2020-06-16 Baylor Research Institute Anti-CD40 antibodies
US11806390B2 (en) 2009-03-10 2023-11-07 Baylor Research Institute Fusion proteins comprising an anti-CD40 antibody and cancer antigens
US11267895B2 (en) 2009-03-10 2022-03-08 Baylor Research Institute Nucleic acids encoding anti-CD40 antibodies
WO2012051291A1 (en) * 2010-10-13 2012-04-19 Baylor Research Institute Targeting antigens to human dendritic cells via dc-asialoglycoprotein receptor to produce il-10 regulatory t cells
EP2688591A4 (en) * 2011-03-22 2014-10-01 Baylor Res Inst TARGETING DENDRITIC CELLS FOR A TUBERCULOSIS VACCINE
EP2688592A4 (en) * 2011-03-25 2015-07-22 Baylor Res Inst Compositions and methods for immunization against the hepatitis C virus
WO2013009841A1 (en) * 2011-07-11 2013-01-17 Baylor Research Institute Subsets of antigen-presenting cells (apc's) in the human vagina and their distinct functions
WO2014012479A1 (en) 2012-07-18 2014-01-23 Shanghai Birdie Biotech, Inc. Compounds for targeted immunotherapy
US9878052B2 (en) 2012-07-18 2018-01-30 Birdie Biopharmaceuticals Inc. Compounds for targeted immunotherapy
EP2874651A4 (en) * 2012-07-18 2016-04-27 Shanghai Birdie Biotech Inc COMPOUNDS FOR TARGETED IMMUNOTHERAPY
US10548988B2 (en) 2012-07-18 2020-02-04 Birdie Biopharmaceuticals, Inc. Compounds for targeted immunotherapy
US10660971B2 (en) 2012-07-18 2020-05-26 Birdie Biopharmaceuticals, Inc. Compounds for targeted immunotherapy
US11633495B2 (en) 2014-01-10 2023-04-25 Birdie Biopharmaceuticals, Inc. Compounds and compositions for immunotherapy
US10548985B2 (en) 2014-01-10 2020-02-04 Birdie Biopharmaceuticals, Inc. Compounds and compositions for treating EGFR expressing tumors
US9827329B2 (en) 2014-01-10 2017-11-28 Birdie Biopharmaceuticals, Inc. Compounds and compositions for immunotherapy
US11786604B2 (en) 2014-01-10 2023-10-17 Birdie Biopharmaceuticals, Inc. Compounds and compositions for treating HER2 positive tumors
US10328158B2 (en) 2014-01-10 2019-06-25 Birdie Biopharmaceuticals, Inc. Compounds and compositions for immunotherapy
US11633494B2 (en) 2014-01-10 2023-04-25 Birdie Biopharmaceuticals, Inc. Compounds and compositions for immunotherapy
US10744206B2 (en) 2014-01-10 2020-08-18 Birdie Biopharmaceuticals, Inc. Compounds and compositions for immunotherapy
US10780180B2 (en) 2014-01-10 2020-09-22 Birdie Biopharmaceuticals, Inc. Compounds and compositions for immunotherapy
US10940195B2 (en) 2014-01-13 2021-03-09 Baylor Research Institute Vaccines against HPV and HPV-related diseases
US12214034B2 (en) 2014-01-13 2025-02-04 Baylor Research Institute Vaccines against HPV and HPV-related diseases
US11717567B2 (en) 2014-01-13 2023-08-08 Baylor Research Institute Vaccines against HPV and HPV-related diseases
EP4218929A1 (en) 2014-03-21 2023-08-02 AbbVie Inc. Anti-egfr antibodies and antibody drug conjugates
US11279761B2 (en) 2014-07-09 2022-03-22 Birdie Biopharmaceuticals, Inc. Anti-PD-L1 combinations for treating tumors
US11130812B2 (en) 2014-09-01 2021-09-28 Birdie Biopharmaceuticals, Inc. Anti PD-L1 conjugates for treating tumors
US11136397B2 (en) 2016-01-07 2021-10-05 Birdie Pharmaceuticals, Inc. Anti-EGFR combinations for treating tumors
US11702476B2 (en) 2016-01-07 2023-07-18 Birdie Biopharmaceuticals, Inc. Anti-EGFR combinations for treating tumors
US11046781B2 (en) 2016-01-07 2021-06-29 Birdie Biopharmaceuticals, Inc. Anti-HER2 combinations for treating tumors
US11220552B2 (en) 2016-01-07 2022-01-11 Birdie Biopharmaceuticals, Inc. Anti-CD20 combinations for treating tumors
WO2017214339A1 (en) 2016-06-08 2017-12-14 Abbvie Inc. Anti-b7-h3 antibodies and antibody drug conjugates
WO2017214322A1 (en) 2016-06-08 2017-12-14 Abbvie Inc. Anti-b7-h3 antibodies and antibody drug conjugates
WO2017214456A1 (en) 2016-06-08 2017-12-14 Abbvie Inc. Anti-cd98 antibodies and antibody drug conjugates
US10640563B2 (en) 2016-06-08 2020-05-05 Abbvie Inc. Anti-B7-H3 antibodies and antibody drug conjugates
WO2018112334A1 (en) 2016-12-16 2018-06-21 Bluefin Biomedicine, Inc. Anti-cub domain-containing protein 1 (cdcp1) antibodies, antibody drug conjugates, and methods of use thereof
WO2018195302A1 (en) 2017-04-19 2018-10-25 Bluefin Biomedicine, Inc. Anti-vtcn1 antibodies and antibody drug conjugates
US11834448B2 (en) 2017-04-27 2023-12-05 Birdie Biopharmaceuticals, Inc. 2-amino-quinoline derivatives
US11053240B2 (en) 2017-04-27 2021-07-06 Birdie Biopharmaceuticals, Inc. 2-amino-quinoline derivatives
WO2018231827A1 (en) 2017-06-12 2018-12-20 Bluefin Biomedicine, Inc. Anti-il1rap antibodies and antibody drug conjugates
US12295950B2 (en) 2017-06-23 2025-05-13 Birdie Biopharmaceuticals, Inc. Pharmaceutical compositions
US11517567B2 (en) 2017-06-23 2022-12-06 Birdie Biopharmaceuticals, Inc. Pharmaceutical compositions
US10722572B2 (en) 2017-09-26 2020-07-28 Institut National De La Sante Et De La Recherche Medicale Inserm Methods and compositions for treating and preventing HIV
US10610585B2 (en) 2017-09-26 2020-04-07 Inserm (Institut National De La Sante Et De La Recherche Medicale) Methods and compositions for treating and preventing HIV
US11219683B2 (en) 2017-09-26 2022-01-11 INSTITUT NATIONAL DE LA SANTÉ ET DE LA RECHERCHE M{circumflex over (D)}DICALE (INSERM) Methods and compositions for treating and preventing HIV
US11759527B2 (en) 2021-01-20 2023-09-19 Abbvie Inc. Anti-EGFR antibody-drug conjugates
WO2025027529A1 (en) 2023-07-31 2025-02-06 Advesya Anti-il-1rap antibody drug conjugates and methods of use thereof
WO2025126157A1 (en) 2023-12-15 2025-06-19 Advesya Anti-il-1rap binding domains and antibody-drug conjugates thereof

Also Published As

Publication number Publication date
US20080206262A1 (en) 2008-08-28
US11173202B2 (en) 2021-11-16
US12016915B2 (en) 2024-06-25
EP2115129B1 (en) 2013-11-13
NZ593639A (en) 2012-08-31
US20250018025A1 (en) 2025-01-16
CA2715045A1 (en) 2008-08-14
US8236934B2 (en) 2012-08-07
MX2009008211A (es) 2009-08-12
US20140227268A1 (en) 2014-08-14
IL218085A0 (en) 2012-03-29
ZA200905274B (en) 2010-04-28
NZ578756A (en) 2012-02-24
US20120282281A1 (en) 2012-11-08
EP2115129A4 (en) 2011-11-02
US20160375126A1 (en) 2016-12-29
BRPI0807152A2 (pt) 2014-04-22
US8728481B2 (en) 2014-05-20
WO2008097870A3 (en) 2010-01-07
AU2008214036A1 (en) 2008-08-14
IL200093A0 (en) 2010-04-15
AU2008214036B2 (en) 2012-11-01
CN101952414A (zh) 2011-01-19
JP2010518024A (ja) 2010-05-27
EP2115129A2 (en) 2009-11-11
TWI422594B (zh) 2014-01-11
US20220152192A1 (en) 2022-05-19
KR20090114432A (ko) 2009-11-03
CA2715045C (en) 2020-08-04
TW200846370A (en) 2008-12-01
US9453074B2 (en) 2016-09-27
US10279030B2 (en) 2019-05-07
US20190231865A1 (en) 2019-08-01

Similar Documents

Publication Publication Date Title
US12016915B2 (en) Agents that engage antigen-presenting cells through dendritic cell asialoglycoprotein receptor (DC-ASGPR)
EP2522718B1 (en) Therapeutic applications of activation of human antigen-presenting cells through dectin-1
EP3489260B1 (en) Activation of human antigen-presenting cells through dendritic cell lectin-like oxidized ldl receptor-1 (lox-1)
AU2008218184B2 (en) Activation of human antigen-presenting cells through CLEC-6
AU2012245170B2 (en) Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc-asgpr)
AU2014240262B2 (en) Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc-asgpr)
HK1135431B (en) Therapeutic applications of activation of human antigen-presenting cells through dectin-1

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200880011349.8

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 08714180

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2009548484

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 200093

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2008214036

Country of ref document: AU

Ref document number: 578756

Country of ref document: NZ

Ref document number: MX/A/2009/008211

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2008714180

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2008214036

Country of ref document: AU

Date of ref document: 20080202

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020097018344

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 2715045

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 218085

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 224539

Country of ref document: IL

ENP Entry into the national phase

Ref document number: PI0807152

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20090731