WO2006121610A2 - Personal care compositions and methods for their use - Google Patents
Personal care compositions and methods for their use Download PDFInfo
- Publication number
- WO2006121610A2 WO2006121610A2 PCT/US2006/015711 US2006015711W WO2006121610A2 WO 2006121610 A2 WO2006121610 A2 WO 2006121610A2 US 2006015711 W US2006015711 W US 2006015711W WO 2006121610 A2 WO2006121610 A2 WO 2006121610A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition
- skin
- seq
- personal care
- present
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CO[C@](*O[C@](C1O*)O[C@](*O[C@](C2O*)OC)C2O*)C1O* Chemical compound CO[C@](*O[C@](C1O*)O[C@](*O[C@](C2O*)OC)C2O*)C1O* 0.000 description 3
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
- A61K8/66—Enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q1/00—Make-up preparations; Body powders; Preparations for removing make-up
- A61Q1/02—Preparations containing skin colorants, e.g. pigments
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q1/00—Make-up preparations; Body powders; Preparations for removing make-up
- A61Q1/02—Preparations containing skin colorants, e.g. pigments
- A61Q1/04—Preparations containing skin colorants, e.g. pigments for lips
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q1/00—Make-up preparations; Body powders; Preparations for removing make-up
- A61Q1/02—Preparations containing skin colorants, e.g. pigments
- A61Q1/10—Preparations containing skin colorants, e.g. pigments for eyes, e.g. eyeliner, mascara
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q15/00—Anti-perspirants or body deodorants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q17/00—Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings
- A61Q17/04—Topical preparations for affording protection against sunlight or other radiation; Topical sun tanning preparations
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/02—Preparations for care of the skin for chemically bleaching or whitening the skin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/04—Preparations for care of the skin for chemically tanning the skin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/10—Washing or bathing preparations
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q7/00—Preparations for affecting hair growth
- A61Q7/02—Preparations for inhibiting or slowing hair growth
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q9/00—Preparations for removing hair or for aiding hair removal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
Definitions
- the present invention provides peptides and supported peptides for treating various diseases and conditions.
- the present invention provides compositions and methods for personal care.
- the present invention provides compositions for use in skin and/or hair care, as well as cosmetic compositions.
- the present invention provides peptides and supported peptides for treating diseases of the skin, such as rosacea.
- the supported peptides of the present invention are anti-VEGF peptides.
- the anti-VEGF peptides are expressed on a scaffold protein.
- the scaffold protein comprises BBI.
- Angiogenesis is the development of a blood supply to a given area of tissue. Angiogenesis is part of normal embryonic development and revascularization of wound beds, as well as due to the stimulation of vessel growth by inflammatory or malignant cells. Angiogenesis is also the process through which tumors or inflammatory conditions derive a blood supply through the generation of microvessels.
- VEGF Vascular endothelial growth factor-A
- VPF vascular permeability factor
- VEGF vascular endothelial growth factor
- Inhibitory anti-VEGF receptor antibodies, soluble receptor constructs, antisense strategies, RNA aptamers against VEGF and low molecular weight VEGF receptor tyrosine kinase (RTK) inhibitors have all been proposed for use in interfering with VEGF signaling (See, Sieffle et al, [1998]).
- RTKs comprise a large family of transmembrane receptors for polypeptide growth factors with diverse biological activities.
- the intrinsic function of RTKs is activated upon ligand binding, which results in phosphorylation of the receptor and multiple cellular substrates, and subsequently in a variety of cellular responses. (See, Ullrich & Schlessinger, Cell 61:203-212 [1990]).
- Angiogenesis involving VEGF and RTKs is not only involved in cancer development, as many other diseases or conditions affecting different physiological systems are angiogenesis-dependent, such as arthritis and atherosclerotic plaques (bone and ligaments), diabetic retinopathy, neovascular glaucoma, macular degeneration, ocular herpes, trachoma and corneal graft neovascularization (eye), psoriasis, scleroderma, rosacea, hemangioma and hypertrophic scarring (skin), vascular adhesions and angiofibroma (blood system).
- arthritis and atherosclerotic plaques bone and ligaments
- diabetic retinopathy neovascular glaucoma
- macular degeneration macular degeneration
- ocular herpes trachoma and corneal graft neovascularization (eye)
- psoriasis scleroderma
- rosacea hemangiom
- VEGF is an angiogenesis factor of major importance for skin vascularization (Detmar [2000]). VEGF expression is upregulated in the hyperplastic epidermis of psoriasis (Detmar and Yeo et al. [1995]), in healing wounds and in other skin diseases characterized by enhanced angiogenesis (Detmar [2000], supra). Targeted overexpression of VEGF in the epidermis of transgenic mice was reported to result in enhanced skin vascularization with equal numbers of tortuous and leaky blood vessels ⁇ See e.g., Brown et al. [1998]). Also, chronic synthesis of VEGF in mouse skin leads to the first histologically equivalent murine model of human psoriasis (Xia et al. [2003]) that is reversible by binding agents specific for VEGF.
- the ECM is a barrier to cell movement and cancer cells must devise ways to break their attachments, degrade, and move through the ECM in order to metastasize.
- Proteases are enzymes that degrade other proteins and have long been thought to aid in freeing the tumor cells from their original location by chewing up the ECM.
- Recent studies have suggested that they may promote cell shape changes and motility through the activation of a protein in the tumor cell membrane called Protease-Activated Receptor-2 (PAR2). This leads to a cascade of intracellular reactions that activates the motility apparatus of the cell.
- PAR2 Protease-Activated Receptor-2
- human prostatic epithelial cells constitutively secrete prostate-specific antigen (PSA), a kallikrein-like serine protease, which is a normal component of the seminal plasma.
- PSA prostate-specific antigen
- the protease acts to degrade the extracellular matrix and facilitate invasion of cancerous cells.
- protease inhibitors have been shown to inhibit tumor promotion in vivo and in vitro. Previous investigations have indicated that certain protease inhibitors belonging to a family of structurally-related proteins classified as serine protease inhibitors or SERPINS, are known to inhibit several proteases including trypsin, cathepsin G, thrombin, and tissue kallikrein, as well as neutrophil elastase.
- SERPINS serine protease inhibitors
- SERPINS serine protease inhibitors
- Topical administration of protease inhibitors finds use in such conditions as atopic dermatitis, a common form of inflammation of the skin, which may be localized to a few patches or involve large portions of the body.
- the depigmenting activity of protease inhibitors and their capability to prevent ultraviolet- induced pigmentation have been demonstrated both in vitro and in vivo (See e.g., Paine et al, J. Invest. Dermatol., 116:587-595 [2001]).
- Protease inhibitors have also been reported to facilitate wound healing. For example, secretory leukocyte protease inhibitor was demonstrated to reverse the tissue destruction and speed the wound healing process when topically applied.
- serine protease inhibitors can also help to reduce pain in lupus erythematosus patients (See e.g., US Patent No. 6537968).
- the Bowman-Birk protease inhibitor is a designation of a family of stable, low molecular weight trypsin and chymotrypsin enzyme inhibitors found in soybeans and various other seeds, mainly leguminous seeds and vegetable materials.
- BBI comprises a family of disulfide bonded proteins with a molecular weight of about 8 kD (See e.g., Chou et al, Proc. Natl. Acad. Sci. USA 71: 1748-1752 [1974]; Yavelow et al, Proc. Natl. Acad. Sci. USA 82:5395-5399 [1985]; and Yavelow et al, Cancer Res.
- STI inhibits the proteolytic activity of trypsin by the formation of a stable stoichiometric complex (See e.g., Liu, Chemistry and Nutritional Value of Soybean Components, In: Soybeans, Chemistry, Technology and Utilization, pp. 32-35, Aspen Publishers, Inc., Gaithersburg, Md., [1999]).
- STI consists of 181 amino acid residues with two disulfide bridges and is roughly spherically shaped (See e.g., Song et al, J. MoI. Biol., 275:347-63 [1998]).
- the trypsin inhibitory loop lies within the first disulfide bridge.
- soybeans One source of interest is the soybean.
- the average level of protease inhibitors present in soybeans is around 1.4 percent and 0.6 percent for Kunitz and Bowman-Birk respectively, two of the most important protease inhibitors. Notably, these low levels make it impractical to isolate the natural protease inhibitor for clinical and other applications. Indeed, despite much research in the personal care arena, there remains a need in the art for personal care compositions that have desired characteristics without undesirable chemical modification of the proteins. There also remains a need in the art for a method of delivering a protein into a personal care composition so as to effectively deliver the protein in a useable form.
- the present invention provides peptides and supported peptides for treating various diseases and conditions.
- the present invention provides compositions and methods for personal care.
- the present invention provides compositions for use in skin and/or hair care, as well as cosmetic compositions.
- the present invention provides peptides and supported peptides for treating diseases of the skin, such as rosacea.
- the supported peptides of the present invention are anti-VEGF peptides.
- the anti-VEGF peptides are expressed on a scaffold protein.
- the scaffold protein comprises BBI.
- the present invention provides cosmetic and/or pharmaceutical compounds suitable for improving the appearance of skin.
- the present invention further provides peptides that block binding of a protein.
- the protein is VEGF.
- the peptide is expressed in a protease-resistant scaffold.
- the scaffold is a protease inhibitor (e.g., BBI, STI, or Eglin chymotrypsin inhibitor).
- the protease inhibitor is BBI.
- the present invention provides personal care compositions comprising a scaffold, wherein the scaffold comprises at least one protease inhibitor and at least one peptide selected from the group consisting of SEQ ID NOS: 1-17. In alternative embodiments, any of the additional peptide sequences provided herein find use in the present invention.
- additional sequences find use in the present invention, including but not limited to SEQ H) NOS:20-25, 31, 32-34, 43, and 238.
- the at least one peptide sequence is selected from the group consisting of YNLYGWT (SEQ ID NO:1), KYYLYWW (SEQ ID NO:239), WYTLYKW (SEQ ID NO:240), TYRLYWW (SEQ ID NO:241), RYSLYYW (SEQ ID NO:242), YYLYYWK (SEQ ID NO:243), NYQLYGW (SEQ ID NO:244), TLWKSYW (SEQ ID NO:245), TKWPSYW (SEQ ID NO:246), PLWPSYW (SEQ ID NO:247), RLWPSYW (SEQ ID NO:248), TLWPKYW (SEQ ID NO:249), KYDLYWW (SEQ ID NO:33), RYDLYWW
- the scaffold comprises from about 0.001 weight percent to about 5 weight percent of the personal care composition, while in alternative embodiments, the scaffold comprises from about 0.01 weight percent to about 2.0 weight percent of the personal care composition, and in yet additional embodiments, the scaffold comprises from about 0.01 weight percent to about 1 weight percent of the personal care composition.
- the skin care compositions are moisturizing body washes, body washes, antimicrobial cleansers, skin protective creams, body lotions, facial creams, moisturizing creams, facial cleansing emulsions, facial gels, facial sera, surfactant-based facial cleansers, facial exfoliating gels, antiacne treatments, facial toners, exfoliating creams, facial masks, after shave balms, pre-shave balms, tanning compositions, skin lightening compositions, skin redness reduction compositions, sunscreens, depilatories, hair growth inhibitors, and radioprotectives.
- the skin care compositions comprise topically applied over-the-counter compositions, anti-fungal treatments, anti-acne treatments, skin protectants, sunscreens, deodorants, and antiperspirants.
- the skin care compositions are capable of lightening the skin tone, while in alternative embodiments the skin care compositions are capable of reducing redness in skin tone. In yet further embodiments, the skin care compositions are capable of preventing skin tone darkening, while in additional embodiments, the skin care compositions are capable of preventing skin color development, hi some preferred embodiments, the skin care compositions are radioprotective. In alternative embodiments, the skin care compositions comprise at least one radioprotectives. In some particularly preferred embodiments, the radioprotectives are selected from the group consisting of sunscreens. In some most preferred embodiments, the sunscreens are selected from non-water-resistant sunscreens, very water- resistant sunscreens, and water-in-silicone sunscreens.
- the present invention also provides personal care compositions that are capable of preventing hair growth.
- the hair is selected from the group consisting of facial hair, leg hair, arm hair, and torso hair.
- the present invention also provides personal care compositions that are hair care compositions.
- the hair care composition is selected from the group consisting of shampoos, conditioners, hair styling compositions, hair colorants, permanent wave formulations, creams, gels, mousses, sprays, emulsions, colloidal suspensions, liquids, foams, and solids.
- the hair care compositions comprise at least one radioprotectant.
- the radioprotectant is a sunscreen selected from non-water-resistant sunscreens, very water-resistant sunscreens, and water-in- silicone sunscreens.
- the hair care composition is radioprotective.
- the present invention also provides personal care compositions that are cosmetic compositions.
- the cosmetic compositions are selected from eye gels, eye shadows, high- melting point lipsticks, lipsticks, lip glosses, lip balms, mascaras, eyeliners, pressed powder formulations, and foundations.
- the makeup compositions comprise at least one pigment.
- the makeup composition comprising at least one pigment is a mascara selected from non-waterproof mascaras, waterproof mascaras, volumizing mascaras, lengthening mascaras, curling mascaras, anhydrous waterproof mascaras, water-based mascaras, and eyelash or eyebrow treatments.
- the makeup compositions are pressed powder formulations selected from loose powders, blushes, eye shadows, and bronzing powders.
- the makeup compositions are foundations selected from water-in-oil foundations, water-in-silicone foundations, oil-in- water foundations, anhydrous makeup sticks, and cream-to-powder foundations.
- the present invention further provides personal care compositions having a scaffold, wherein the scaffold comprises the amino acid sequence set forth in SEQ ID NO: 19.
- the scaffold further comprises the amino acid sequence(s) set forth in SEQ ID NOS:20 and/or 21.
- the amino acid sequence(s) set forth in SEQ ID NOS: 20 and/or 21 is/are replaced by at least one peptide having an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-17.
- any of the peptide sequences provided herein find use as a replacement of SEQ ID NOS: 20 and/or 21.
- any of the additional peptide sequences provided herein find use in the present invention.
- additional sequences find use in the present invention, including but not limited to SEQ ID NOS:20-25, 31, 32-34, 43, and 238.
- the at least one peptide sequence is selected from the group consisting of YNLYGWT (SEQ ID NO:1), KYYLYWW (SEQ ID NO:239), WYTLYKW (SEQ ID NO:240), TYRLYWW (SEQ ID NO:241), RYSLYYW (SEQ ID NO:242), YYLYYWK (SEQ ID NO:243), NYQLYGW (SEQ ID NO:244), TLWKSYW (SEQ ID NO:245), TKWPSYW (SEQ ID NO:246), PLWPSYW (SEQ ID NO:247), RLWPSYW (SEQ ID NO:248), TLWPKYW (SEQ ID NO:249), KYDLYWW (SEQ ID NO:33), RYDLYWW (SEQ ID NO:1), KY
- the present invention also provides methods for making the personal care compositions of the present invention, comprising combining an effective amount of the scaffold and at least one physiologically acceptable carrier or excipient.
- the present invention further provides methods for modifying the skin tone of a subject, comprising the steps of: providing at least one composition comprising a personal care composition of the present invention; ii) providing a subject to be treated; and applying the composition to the subject in an area in which modifications to the subject's skin tone is desired.
- the modification of skin tone comprises lightening the subject's skin tone.
- the modification of skin tone comprises reducing redness in the subject's skin tone.
- the methods comprise a personal care composition comprising the amino acid sequence set forth in SEQ ID NO: 19.
- the personal care composition comprises at least one of the amino acid sequences set forth in SEQ ID NOS:20 and 21.
- at least one of the amino acid sequences set forth in SEQ ID NOS: 20 and 21 is replaced by at least one peptide having an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-17.
- any of the additional peptide sequences provided herein find use as a replacement of SEQ ID NOS:20 and/or 21.
- additional sequences find use in the present invention, including but not limited to SEQ ID NOS:20-25, 31, 32-34, 43, and 238.
- the at least one peptide sequence is selected from the group consisting of YNLYGWT (SEQ ID NO:1), KYYLYWW (SEQ ID NO:239), WYTLYKW (SEQ ID NO:240), TYRLYWW (SEQ ID NO:241), RYSLYYW (SEQ ID NO:242), YYLYYWK (SEQ ID NO:243), NYQLYGW (SEQ ID NO:244), TLWKSYW (SEQ ID NO:245), TKWPSYW (SEQ ID NO:246), PLWPSYW (SEQ ID NO:247), RLWPSYW (SEQ ID NO:248), TLWPKYW (SEQ ID NO:249), KYDLYWW (SEQ ID NO:33), RYDLYWW (SEQ ID NO:250), DYRLYWW (SEQ ID NO:251), DYKLYWW (SEQ ID NO:34), EYKLY
- the present invention also provides methods for modifying the hair growth of a subject, comprising the steps of: providing the personal care composition of the present invention; providing a subject to be treated; and applying the composition to the subject in an area in which modifications to the subject's hair growth is desired.
- the modification of hair modification of hair growth comprises inhibiting the growth of the subject's hair, wherein the hair to be inhibited is selected from the group consisting of facial air, underarm hair, leg hair, torso hair, and arm hair, and head hair.
- the methods comprise a personal care composition comprising the amino acid sequence set forth in SEQ ID NO: 19.
- the personal care composition comprises at least one of the amino acid sequences set forth in SEQ ID NOS:20 and 21.
- at least one of the amino acid sequences set forth in SEQ ID NOS :20 and 21 is replaced by at least one peptide having an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-17.
- any of the additional peptide sequences provided herein find use as a replacement of SEQ ID NOS: 20 and/or 21.
- additional sequences find use in the present invention, including but not limited to SEQ H) NOS:20-25, 31, 32-34, 43, and 238.
- the at least one peptide sequence is selected from the group consisting of YNLYGWT (SEQ ID NO:1), KYYLYWW (SEQ ID NO:239), WYTLYKW (SEQ ID NO:240), TYRLYWW (SEQ ID NO:241), RYSLYYW (SEQ ID NO:242), YYLYYWK (SEQ ID NO:243), NYQLYGW (SEQ ID NO:244), TLWKSYW (SEQ ID NO:245), TKWPSYW (SEQ ID NO:246), PLWPSYW (SEQ ID NO:247), RLWPSYW (SEQ ID NO:248), TLWPKYW (SEQ ID NO:249), KYDLYWW (SEQ ID NO:33), RYDLYWW (SEQ ID NO:250), DYRLYWW (SEQ ID NO:251), DYKLYWW (SEQ ID NO:34), EYKLY
- the present invention provides cosmetic and/or pharmaceutical compounds for improving the appearance of skin comprising at least one polypeptide or a peptide.
- the polypeptide or peptide binds to VEGF.
- the binding of the polypeptide or peptide to VEGF blocks the downstream activity of VEGF.
- the compounds comprise at least one peptide, while in other embodiments, the compounds comprise at least one polypeptide.
- the peptide has an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-17.
- the peptide has an amino acid sequence selected from the group consisting of KYDLYWW (SEQ ID NO:33) and DYKLYWW (SEQ H) NO:34).
- the peptide has a conserved binding sequence, the sequence being XXLWPXWC (SEQ ID NO: 15).
- the sequence comprises SEQ ID NO: 15.
- the sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-17.
- the sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOS:22-25.
- the compounds have a sequence, the sequence being at least 70%, preferably 80%, more preferably 90%, and most preferably 95% homologous to the sequences set forth herein.
- the polypeptide has a molecular weight that is preferably between 500 Daltons and 30,000 Daltons, more preferably between 1000 Daltons and 10,000 Daltons, and most preferably from 1500 Daltons to 8,000 Daltons.
- the compounds find use in the improvement of skin in an organism
- the skin disorder is an angiogenic skin disorder.
- the skin disorder is at least one selected from the group consisting of psoriasis, venous ulcers, acne, rosacea, warts, eczema, hemangiomas and lymphangiogenesis, etc.
- the skin disorder is rosacea.
- the present invention provides cosmetic and/or pharmaceutical compounds for improving the appearance of skin.
- the compounds comprise at least one peptide or polypeptide and at least one scaffold, the peptide or polypeptide being expressed in the scaffold.
- the compounds further comprise at least one peptide.
- the peptide has an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-17.
- the compounds comprise an amino acid sequence selected from the group consisting of SEQ ID NOS:22-25.
- the peptide has a conserved binding sequence, the sequence being XXLWPXWC (SEQ ID NO: 15).
- the compounds have a sequence, the sequence being at least 70%, preferably 80%, more preferably 90%, and most preferably 95% identical to the sequences set forth herein.
- the peptide molecular weight is preferably between 500 Daltons and 45,000 Daltons, more preferably between 1000 Daltons and 12,000 Daltons, and most preferably from 1500 Daltons to 10,000 Daltons.
- the compounds comprise at least one polypeptide.
- the present invention provides compositions comprising at least one peptide selected from the group consisting of SEQ ID NOS: 1-17, wherein the peptide binds to a vascular endothelial growth factor.
- the peptide is expressed in a protease resistant scaffold.
- the scaffold comprises a protease inhibitor.
- the protease inhibitor is selected from the group consisting of Bowman-Birk Inhibitor, soybean trypsin inhibitor, and Eglin chymotrypsin inhibitor.
- the scaffold is Bowman- Birk inhibitor.
- the protease resistant scaffold and the peptide comprise a fusion protein.
- the composition comprises an amino acid sequence selected from the group consisting of SEQ ID NOS:22-25.
- the scaffold comprises the amino acid sequence set forth in SEQ ID NO: 19.
- the scaffold comprises at least one of the amino acid sequences set forth in SEQ ID NOS:20 and 21.
- at least one of the amino acid sequences set forth in SEQ ID NOS:20 and 21 is replaced by at least one peptide having an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-17.
- the scaffold comprises at least one of the amino acid sequences set forth in SEQ ID NOS: 20 and 21. In further preferred embodiments, at least one of the amino acid sequences set forth in SEQ ID NOS: 20 and 21 is replaced by at least one peptide having an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-17.
- the present invention also provides methods for modulating angiogenesis comprising: i) providing a composition comprising a peptide contained within a scaffold; ii) providing a subject to be treated; and iii) applying the composition to the subject in an area in which angiogenesis modulation is desired.
- the peptide binds to a vascular endothelial growth factor (VEGF).
- VEGF vascular endothelial growth factor
- the vascular endothelial growth factor (VEGF) is VEGF-A.
- the scaffold is selected from the group consisting of Bowman-Birk inhibitor, soybean trypsin inhibitor, and Eglin chymotrypsin inhibitor. In some particularly preferred embodiments, the scaffold is Bowman-Birk inhibitor.
- the scaffold comprises the amino acid sequence set forth in SEQ ID NO: 19. In still further embodiments, the scaffold comprises at least one of the amino acid sequences set forth in SEQ DO NOS:20 and 21. In some particularly preferred embodiments, at least one of the amino acid sequences set forth in SEQ ID NOS:20 and 21 is replaced by at least one peptide having an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-17. In still further particularly preferred embodiments, the scaffold and the peptide are encoded by an amino acid sequence selected from the group consisting of SEQ ID NOS:22-25.
- the present invention also provides methods for decreasing the activity of a vascular endothelial growth factor comprising the steps of: i) providing a subject; and ii) administering the composition comprising at least one peptide that binds to the vascular endothelial growth factor to the subject, under conditions such that the activity of the vascular endothelial growth factor is decreased.
- the vascular endothelial growth factor VEGF
- the composition comprises an amino acid sequence selected from the group consisting of SEQ ID NOS:22-25.
- the compounds are used for the improvement of skin in an organism (i.e., a subject) having a skin disorder.
- the skin disorder is at least one selected from the group consisting of psoriasis, venous ulcers, acne, rosacea, warts, eczema, hemangiomas and lymphangiogenesis, etc.
- the skin disorder is rosacea.
- the present invention provides cosmetic and/or pharmaceutical compositions comprising at least one polypeptide or peptide, as set forth herein, and a physiologically acceptable carrier or excipient.
- the compound is present in an amount of about 0.0001% to about 5% by weight based on the total weight of the composition.
- the compound is present in an amount of about 0.001% to about 0.5% by weight based on the total weight of the composition.
- the composition may be in the form of an emulsified vehicle, such as a nutrient cream or lotion, a stabilized gel or dispersion system, a treatment serum, a liposomal delivery system, a topical pack or mask, a surfactant- based cleansing system such as a shampoo or body wash, an aerosolized or sprayed dispersion or emulsion, a hair or skin conditioner, styling aid, or a pigmented product such as makeup, as well as other suitable make-up and cosmetic preparations.
- the carrier is preferably at least one selected from the group consisting of water, propylene glycol, ethanol, propanol, glycerol, butylene glycol and polyethylene glycol.
- the present invention provides means for decreasing VEGF activity and/or levels.
- the VEGF activity and/or levels are decreased in the epidermis.
- the method comprising applying an effective amount of at least one of the compounds described herein to an organism in need thereof.
- Figure 1 provides a sequence summary of VEGF binding phage clones (SEQ ID NOS: 1-12). Twenty-four phage clones were sequenced after 3 rounds of panning. The sequence alignment tree indicates a highly conserved sequence motif ACXLWPXXWC (SEQ ID NO: 14). The number in parentheses represents the frequency of that sequence within the 24 clones sequenced after the third round of panning.
- Figure 9 provides the BBI gene and amino acid sequences (SEQ ID NOS:18 and 19, respectively) designed for efficient cloning. This sequence comprises the expression cassette used in E.coli. It codes for the pro-BBI protein with a C-terminal His tag and has extra sequences at the 5' and 3' ends for cloning into the E. coli expression vector.
- BBI was refolded in the presence or absence of subtilisin BPN' Y217L.
- the lanes are as follows: Lane 1: Hampton Foldit 11, refolding buffer, -subtilisin; Lane 2: Hampton Foldit 11 refolding buffer, +subtilisin; Lane 3: Hampton Foldit 13 refolding buffer, -subtilisin; Lane 4, Hampton Foldit 13 refolding buffer, + subtilisin; and Lane 5, molecular weight markers.
- Figure 11 provides a graph showing that BBI-VEGFl (SEQ ID NO:22) binds specifically to VEGF.
- Figure 12 provides a graph showing HUVEC results for designated peptides.
- Figure 13 provides sequences of three BBI-VEGF fusions, BBI-VEGFl (SEQ ID NO:22), BBI- VEGF2 (SEQ ID NO:23) and BBI-VEGF12 (SEQ ID NO:24). Fusions BBI-VEGFl and BBI-VEGF2 have only one of the binding loops replaced; fusion BBI-VEGF12 has both of the binding loops replaced.
- Figure 14 provides the DNA and amino acid sequences of the apr.E-BCE103-BBI-Histag expression cassette (EcoRI-Hindll ⁇ ) cloned into the pJM103 integration vector (SEQ ID NOS:35 and 36).
- Figure 15 provides a schematic map of the pJM103BBIhis expression vector.
- Figure 16 provides the DNA and amino acid sequences of 12BBIck81 from the BCE103 fusion site (at the BamRl) to the end of the gene (SEQ ID NOS:37 and 38).
- the CK37281 peptide sequences (ACYNLYGWTC (SEQ ID NO:43)) are inserted into both the trypsin and chymotrypsin inhibitory loops.
- Figure 17 provides a graph showing titers of active versus inactive 2BBIck81 (by trypsin inhibition) and the ratio of the activities of BCE103 cellulase to 2BBck81 with various thiol reducing agents added during the growth of the culture.
- BME 2-mercaptoethanol
- Cyt cysteine
- Glut reduced glutathione
- DTT dithiothreitol
- Figure 18 provides a graph showing activation of BCE-lnk2-2BBIck81 with 2-mercaptoethanol
- Figure 19 provides a graph showing results from a competition analysis of 2BBlck81 versus anti- VegF antibody binding to VegF.
- Figure 20 provides the sequence of the synthetic DNA fragment carrying the H. insolens PDI (hiPDI) that was inserted into the B. subtilis BBI expression vector, as well as the amino acid sequence (SEQ ID NOS:39 and 40)
- Figure 21 provides the DNA and amino acid sequences of the ⁇ prE-cutinase expression cassette that was ligated into the EcoRl-BaniHl sites of p2JM103-lnk2-2BBIck81 (SEQ ID NOS:41 and 42).
- the present invention provides peptides and supported peptides for treating various diseases and conditions.
- the present invention provides compositions and methods for personal care.
- the present invention provides compositions for use in skin and/or hair care, as well as cosmetic compositions.
- the present invention provides peptides and supported peptides for treating diseases of the skin, such as rosacea.
- the supported peptides of the present invention are anti-VEGF peptides.
- the anti-VEGF peptides are expressed on a scaffold protein.
- the scaffold protein comprises BBI.
- the present invention provides compositions for use in numerous aspects of personal care, including but not limited to hair and skin care, as well as cosmetics (e.g., make-up).
- the present invention provides compositions that find use in daily personal care, skin care, sun care (e.g., sunscreens, as well as tanners), hair care (e.g., shampoos, leave-on and/or rinse off conditioners, hair tonics, hair sprays, gels, foams, mousses, setting products, hair colorants, permanent formulations, other styling and cleaning products, etc.), after-sun care for skin, hair and lips, oral care (e.g., toothpastes and gels, mouthwashes, rinses, etc.), bathing (e.g., washes, shower soaps, bath soaps, salts, pearls, etc.), skin lighteners, cleansing treatments for skin conditions (e.g., pimples, acne, skin toners, etc.), depilatories, wet wipes,
- hair care e.g
- the present invention also provides compositions that find use in cosmetics (e.g., foundations, mascara, eye shadows, eye liners, lipsticks, lip glosses, blushers, etc.). It is contemplated that the compositions of the present invention will find use various forms, including but not limited to solids, liquids, colloidal suspensions, emulsions, oils, gels, aerosols, foams, powders, pump sprays, etc., as well as being used in conjunction with items such as wet wipes, etc. Indeed, it is contemplated that the present invention will find use in any suitable form for the intended use(s).
- cosmetics e.g., foundations, mascara, eye shadows, eye liners, lipsticks, lip glosses, blushers, etc.
- the compositions of the present invention will find use various forms, including but not limited to solids, liquids, colloidal suspensions, emulsions, oils, gels, aerosols, foams, powders, pump sprays, etc., as well as being used in conjunction
- vascular endothelial growth factor refers to proteins with the ability to stimulate vascular growth, including those designated “VEGF-A” known to those of skill in the art.
- VEGF-A vascular endothelial growth factor
- anti-VEGF refers to peptides and other compositions that recognize (i.e., bind) to VEGF. In preferred embodiments, these peptides/compositions modulate VEGF activity.
- angiogenesis refers to the biological processes which result in the development of blood vessels and/or increase in the vascularity of tissue in an organism.
- the term refers to the process through which tumors or other rapidly proliferating tissue derive a blood supply through the generation of microvessels.
- angiogenic disease angiogenic disorder
- angiogenic skin disorder angiogenic skin disorder
- angiogenic disease generally a skin disorder or related disorder which occurs as a consequence of or which results in increased vascularization in tissue.
- etiology of the angiogenic disease is unknown.
- angiogenesis is an actual cause of a disease state or is simply a condition of the disease state is unimportant, but the inhibition of angiogenesis in treating or reversing the disease state or condition is an important aspect of the present invention.
- the present invention be limited to any particular mechanisms of action.
- angiogenic skin disorders which are suitable for treatment utilizing compounds of the present invention include, but are not limited to psoriasis, acne, rosacea, warts, eczema, hemangiomas and lymphangiogenesis, Sturge-Weber syndrome, neurofibromatosis, tuberous sclerosis, chronic inflammatory disease, and arthritis. Any skin disorder which has as a primary or secondary characterization, increased vascularization, is considered an angiogenic skin disorder herein.
- the compounds provided by the present invention find use in treatment of a wide variety of diseases and/or conditions.
- rosacea is used to describe acne, rosacea, or erythematosa characterized by vascular and follicular dilation typically involving the nose and contiguous portions of the cheeks. Rosacea may vary from very mild but persistent erythema to extensive hyperplasia of the sebaceous glands with deep-seated papules and pustules and be accompanied by telangiectasia at the affected erythematous sites. This condition is also referred to as “hypertrophic rosacea” or “rhinophyma,” depending upon the severity of the condition. It is intended that the term encompass all of the various forms of the condition.
- wart is used to describe a small, usually hard growth on the skin. Also known as a
- verruca warts are flesh-colored growths of the skin which are characterized by circumscribed hypertrophy of the papillae of the corium, with thickening of the malpighian, granulation and keratin layers of the epidermis.
- Verucca vulgaris a subset of warts or verruca, is characterized by infection of the keratinocytes with human papillomavirus.
- psoriasis is used to describe a skin condition which is characterized by the eruption of circumscribed, discrete and confluent, reddish, silvery-scaled maculopapules.
- psoriatic lesions typically occur on the elbows, knees, scalp and trunk. Microscopically, these lesions demonstrate characteristic parakeratosis and elongation of rete ridges.
- the term "acne” is used to describe a condition of the skin characterized by inflammatory follicular, papular and pustular eruptions involving the sebaceous apparatus.
- acne simplex or acne vulgaris which is characterized by eruptions of the face, upper back and chest and is primarily comprised of comedones, cysts, papules and pustules on an inflammatory base. The condition occurs primarily during puberty and adolescence due to an overactive sebaceous apparatus which is believed to be affected by hormonal activity.
- eczema is a generic term used to describe acute or chronic inflammatory conditions of the skin, typically erythematous, edematous, papular, vesicular and/or crusting. These conditions are often followed by lichenification, scaling and occasionally, by duskiness of the erythema and, infrequently, hyperpigmentation. Eczema is often accompanied by the sensation of itching and burning. Eczema vesicles form due to intraepidermal spongiosis.
- Eczema is sometimes referred to colloquially as “tetter,” “dry tetter,” and “scaly tetter.” There are numerous subcategories of eczema, all of which are treated by one or more of the compounds according to the present invention.
- CK followed by an integer refers to a specific peptide.
- Various peptide sequences that find use with the present invention are provided herein (See e.g., Figure 1).
- CK37281 refers to the peptide sequence YNLYGWT (SEQ ID NO: 1) which is also is included in various other sequences (e.g., "ACYNLYGWTCGGG” (SEQ ID NO:238).
- the “compound” comprises the "complete” protein, (i.e., in its entire length as it occurs in nature (or as mutated)), while in other embodiments it comprises a truncated form of a protein.
- the compounds of the present invention are either truncated or be "full-length.”
- the truncation is located at the N-terminal end, while in other embodiments the truncation is located at the C-terminal end of the protein.
- the compound lacks one or more portions (e.g., sub-sequences, signal sequences, domains or moieties), whether active or not.
- organism is used throughout the specification to describe an animal; preferably a human, to whom treatment, including prophylactic treatment, with the compounds according to the present invention is provided.
- treatment including prophylactic treatment
- organism refers to that specific animal.
- the "host cells" used in the present invention generally are prokaryotic or eukaryotic hosts which contain an expression vector and/or gene of interest. Host cells are transformed or transfected with vectors constructed using recombinant DNA techniques. Such transformed host cells are capable of either replicating vectors encoding the protein variants or expressing the desired protein variant. In the case of vectors which encode the pre- or prepro-form of the protein variant, such variants, when expressed, are typically secreted from the host cell into the host cell medium.
- active refers to a composition that imparts a benefit to a subject being treated.
- the present invention provides personal care compositions comprising BBI-AV, a "primary active” which functions to provide benefit to the area to which it is applied.
- BBI-AV is present in skin care formulations and serves to modify the skin tone of subjects to which is applied. It is not intended that the term be limited to BBI-AV, as there are additional constituents present in the personal care compositions of the present invention which impart benefits. In some preferred embodiments, these additional constituents are encompassed by the designation “secondary actives.” Primary and secondary actives are collectively referred to as “actives” herein.
- vitamin B3 compound means a compound having the formula:
- R is - CONH2 (i.e., niacinamide), - COOH [Ie., nicotinic acid) or - CH2OH ⁇ i.e., nicotinyl alcohol); derivatives thereof; and salts of any of the foregoing.
- non-vasodilating means that an ester does not commonly yield a visible flushing response after application to the skin in the subject compositions. It is contemplated that the majority of the general population would not experience a visible flushing response, although such compounds may cause vasodilation not visible to the naked eye.
- retinoid includes all natural and/or synthetic analogs of Vitamin A and/or retinol- like compounds which possess the biological activity of Vitamin A in/on the skin, as well as the geometric isomers and stereoisomers of these compounds.
- the term encompasses vitamin A alcohol (retinol) and its derivatives such as vitamin A aldehyde (retinal), vitamin A acid (retinoic acid) and vitamin A esters (e.g., retinyl acetate, retinyl propionate and retinyl palmitate), etc. It is further intended that the term encompass all-trans-retinoic acids and 13-cis-retinoic acids.
- retinol and “retinal” preferably comprise the all-trans compounds.
- the retinoid preferably used for the formulation of the present invention is all-trans-retinol, generally referred to as “retinol” herein.
- carotenoids are used in reference to ⁇ -carotene, lycopene, lutein, astaxanthin, zeaxanthin, cryptoxanthin, citranaxanthin, canthaxanthin, bixin, ⁇ -apo-4- carotenal, ⁇ -apo-8-carotenal, ⁇ -apo-8-carotenoic esters, alone, as well as in combination.
- Carotenoids which are preferably used are ⁇ -carotene, lycopene, lutein, astaxanthin, zeaxanthin, citranaxanthin and canthaxanthin.
- carotenoids are utilized in crystalline form, as well as in formulations, including but not limited to dry powders (See e.g., dry powders, as described in EP 0 065 193; hereby incorporated by reference).
- the preferred use in the case of lycopene, astaxanthin and canthaxanthin is of lycopene-, astaxanthin- and canthaxanthin-containing dry powders, for example LYCOVIT ® , LUCANTIN ® Pink and LUCANTIN ® Red (10% dry powders respectively of lycopene, astaxanthin and canthaxanthin, commercially available from BASF AG, Ludwigshafen, Germany.
- bioactivity refers to a cause and effect relationship between a composition and a biological system.
- the term is used as by those skilled in the art of biotechnology and biological sciences as the phrase that describes a cause and effect relationship between a molecular composition and living biological matter ⁇ e.g., tissue, cells, etc.).
- bioactive refers a composition that exhibits bioactivity upon administration to living biological matter ⁇ e.g., tissue, cells, etc.).
- biological matter e.g., tissue, cells, etc.
- silicone gum means high molecular weight silicones having an average molecular weight in excess of about 200,000 and preferably from about 200,000 to about 4,000,000. It is intended that the definition encompass non-volatile polyalkyl and polyaryl siloxane gums.
- polypeptide refers to a compound made up of a single chain of amino acid residues linked by peptide bonds.
- protein herein may be synonymous with the term
- polypeptide or may refer, in addition, to a complex of two or more polypeptides. The exact meaning is that known to those in the art.
- expression cassette and "expression vector” refer to nucleic acid constructs generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a target cell.
- the recombinant expression cassette can be incorporated into a plasmid, chromosome, mitochondrial DNA, plastid DNA, virus, or nucleic acid fragment.
- the recombinant expression cassette portion of an expression vector includes, among other sequences, a nucleic acid sequence to be transcribed and a promoter.
- expression cassette may be used interchangeably herein with "DNA construct” and its grammatical equivalents.
- vector and “cloning vector” refer to nucleic acid constructs designed to transfer nucleic acid sequences into cells.
- expression vector refers to a vector that has the ability to incorporate and express heterologous DNA fragments in a foreign cell.
- Many prokaryotic and eukaryotic expression vectors are commercially available. Selection of appropriate expression vectors is within the knowledge of those of skill in the art.
- plasmid refers to a circular double-stranded (ds) DNA construct used as a cloning vector, and which forms an extrachromosomal self-replicating genetic element in some eukaryotes or integrates into the host chromosomes.
- the term "expression” refers to the process by which a polypeptide is produced based on the nucleic acid sequence of the gene or the chemical synthetic peptide. The process includes both transcription and translation of the gene to produce polypeptide/protein.
- the term "gene” means the segment of DNA involved in producing a polypeptide chain that may or may not include regions preceding or following the coding region.
- nucleic acid molecule and “nucleic acid sequence” include sequences of any form of nucleic acid, including, but not limited to RNA, DNA and cDNA molecules. It will be understood that, as a result of the degeneracy of the genetic code, a multitude of nucleotide sequences encoding a given protein may be produced, in addition to mutant proteins.
- cognate refers to a sequence of three nucleotides in a DNA or mRNA molecule that represents the instruction for incorporation of a specific amino acid into a polypeptide chain.
- disulfide bridge or “disulfide bond” refers to the bond formed between the sulfur atoms of cysteine residues in a polypeptide or a protein, hi this invention, a disulfide bridge or disulfide bond may be non-naturally occurring and introduced by way of point mutation.
- salt bridge refers to the bond formed between oppositely charged residues, amino acids in a polypeptide or protein.
- a salt bridge may be non-naturally occurring and introduced by way of point mutation.
- an “enzyme” refers to a protein or polypeptide that catalyzes at least one chemical reaction.
- protease refers to an enzyme that degrades peptide bonds.
- peptide bond refers to the chemical bond between the carbonyl group of one amino acid and the amino group of another amino acid.
- wild-type refers to a sequence or a protein that is native or naturally occurring.
- point mutations refers to a change in a single nucleotide of DNA, especially where that change results in a sequence change in a protein.
- mutant refers to a version of an organism or protein where the version is other than wild-type.
- the change may be effected by methods well known to one skilled in the art, for example, by point mutation in which the resulting protein may be referred to as a mutant.
- mutagenesis refers to the process of changing a composition (e.g., protein) from a wild-type composition (e.g., protein) into a mutant or variant composition (e.g., protein).
- substituted and “substitutions” refer to replacement(s) of an amino acid residue or nucleic acid base in a parent sequence. In some embodiments, the substitution involves the replacement of a naturally occurring residue or base.
- modification and “modify” refer to any change(s) in an amino acid or nucleic acid sequence, including, but not limited to deletions, insertions, interruptions, and substitutions. In some embodiments, the modification involves the replacement of a naturally occurring residue or base.
- functional portion of a secreted polypeptide and its grammatical equivalents refers to a truncated secreted polypeptide that retains its ability to fold into a normal, albeit truncated, configuration. In some embodiments, it is contemplated that sufficient residues of a domain of the naturally secreted polypeptide must be present to allow it to fold in its normal configuration independently of the desired polypeptide to which it is attached.
- the portion of the secreted polypeptide are both correctly folded and result in increased secretion as compared to its absence.
- the truncation of the secreted polypeptide means that the functional portion retains a biological function.
- the catalytic domain of a secreted polypeptide is used, although other functional domains may be used, for example, the substrate binding domains. Additionally preferred embodiments utilize the catalytic domain and all or part of the linker region.
- recombinant DNA molecule refers to a DNA molecule which is comprised of segments of DNA joined together by means of molecular biological techniques.
- recombinant protein or “recombinant polypeptide” as used herein refers to a protein
- cosmetic compositions are incorporated into pharmaceutical compositions to provide cosmetic benefits (e.g., products that treat skin or hair diseases, but also contain cosmetic' compositions for their coloring or other benefits). Also, it is intended that the present invention encompass the use of cosmetics on animals other than humans.
- leave-on refers to a composition that is applied to a subject and not removed (e.g., cleansed by washing, rinsing, etc.) for a period of typically at least several hours (e.g., 4-12 hours) before the area exposed to the composition is cleansed.
- cosmetic .benefit refers to a desired cosmetic change that results from the administration of a personal care composition.
- Cosmetic benefits include but are not limited to improvements in the condition of skin, hair, nails, and the oral cavity.
- at least one cosmetic benefit is provided by the skin care, hair care, nail care, and makeup compositions of the present invention.
- skin care composition refers to compositions that are applied to skin in order to provide beneficial properties, including but not limited to wrinkle minimizing, wrinkle removal, decoloring, coloring, skin softening, skin smoothing, depilation, cleansing, etc.
- the present invention provides skin care compositions that improve skin tone.
- the improvement comprises lessening of wrinkles, smoothing skin texture, modifying skin coloration, and other desired cosmetic benefits.
- the skin care composition is in a form selected from the group consisting of body washes, moisturizing body washes, deodorant body washes, antimicrobial cleansers, skin protecting treatments, body lotions, facial creams, moisturizing creams, facial cleansing emulsions, surfactant-based facial cleansers, facial exfoliating gels, facial toners, exfoliating creams, facial masks, after shave lotions, balms, and/or radioprotective compositions (e.g., sunscreens).
- body washes moisturizing body washes
- deodorant body washes deodorant body washes
- antimicrobial cleansers skin protecting treatments, body lotions, facial creams, moisturizing creams, facial cleansing emulsions, surfactant-based facial cleansers, facial exfoliating gels, facial toners, exfoliating creams, facial masks, after shave lotions, balms, and/or radioprotective compositions (e.g., sunscreens).
- “improving the visual appearance of skin” refers to any benefit achieved through use of the personal care compositions of the present invention.
- benefits include but are not limited to reducing the visual appearance of pores (e.g., by reducing pore size), reducing imperfections and/or blemishes in skin color, including lightening hyperpigmented regions of skin and/or evening skin pigmentation, relieving dryness, eliminating rough, dry spots, improving the skin's ability to retain moisture and/or protect itself from environmental stresses, reducing the appearance of fine lines and wrinkles, improving appearance and skin tone, increasing skin firmness and/or suppleness, decreasing sagging of skin, increasing skin glow, and clarity, increasing the skin renewal process, and/or removing vellus hair. Improving the visual appearance of skin also encompasses regulating wrinkles, atrophy, skin lightening, skin darkening, skin smoothness, and/or reducing the visual appearance of pores.
- modifying skin tone refers to a change in skin color, either darkening or lightening the color of the skin.
- the term is also used in reference to modifications in the muscular and connective tissue health of the skin (i.e., it is not related to the color of the skin, but the firmness of the skin).
- lightening skin tone and “lightening skin” refer to a decrease in skin darkness visualized by eye and/or mechanical means. It is intended that the term encompass any range of observable lightening (i.e., "whitening") of the skin tone.
- the term encompasses decreasing the concentration of melanin present in the skin, including skin areas with hyperpigmentation due to the presence of age spots, melasma, chloasma, freckles, post-inflammatory hyperpigmentation, and/or skin- induced hyperpigmentation.
- hyperpigmented region refers to a localize region of darker skin relative to the base skin tone of a particular individual.
- hyperpigmented regions are areas with localized increases in melanin.
- reducing redness in skin tone refers to a lessening of red color in skin, as observed visually or by other means.
- hair care composition refers to compositions that are applied to hair to provide beneficial properties such as thickening, thinning, coloring, decoloring, cleansing, conditioning, softening, shaping, etc.
- the hair care composition is in a form selected from the group consisting of shampoos, conditioners, anti-dandruff treatments, styling aids, styling conditioners, hair repair or treatment sera, lotions, creams, pomades, and chemical treatments.
- the styling aids are selected from the group consisting of sprays, mousses, rinses, gels, foams, and combinations thereof.
- the chemical treatments are selected from the group consisting of permanent waves, relaxers, and permanents, semi-permanents, temporary color treatments and combinations thereof.
- penetration enhancers refer to compositions that facilitate penetration through the upper stratum corneum barrier to the deeper skin layers.
- penetration enhancers include, but are not limited to, propylene glycol, azone, ethoxydiglycol, dimethyl isosorbide, urea, ethanol, dimethyl sulfoxide, micoroemulsions, liposomes, and nanoemulsions.
- emulsifier and “surfactant” refer to compounds that disperse and suspend the dispersed phase within the continuous phase of a material.
- surfactants find particular use in products intended for skin and/or hair cleansing, hi particular embodiments, the term “surfactant(s)” is used in reference to surface-active agents, whether used as emulsifiers or for other surfactant purposes such as skin cleansing.
- compositions comprising any organic UV-A and UV-B filter, for example but not limited to the following:
- the present invention provides compositions comprising pigments, including, but not limited to inorganic pigments based on metaloxides and/or other in water slightly soluble or insoluble metal compounds such as zinc oxides (ZnO), titanium (TiO 2 ), iron (e.g., Fe 2 O 3 ), zirconium (ZrO 2 ), silica (SiO 2 ), manganese (e.g., MnO), aluminium (Al 2 Os), cer (e-g-, Ce 2 O 3 ), and mixed compositions of these oxides, as well as blends thereof.
- the metaloxides are microfine, while in alternative preferred embodiments, the metaloxides are pigment grade.
- the pigments are "coated" such that they are surface treated.
- the coating comprises a thin, hydrophobic film layer, while in other embodiments, the coating comprises a thin, hydrophilic film layer.
- 1 ,4-B is(o-sulfo-p-toluidino)anthraquinone 61570 green
- silicon atoms may be substituted by identical or different alkyl radicals and/or aryl radicals, which are represented here in general terms by the radicals Ri to R 4 , where the number of different radicals is not necessarily limited to 4.
- n can assume values of 3/2 to 20. Fractional values for "n" take into consideration that uneven numbers of siloxyl groups may be present in the cycle.
- W/O emulsifiers are used with or without additional co-emulsifiers.
- W/O emulsions of the present invention comprise one or more coemulsifiers, including, but not limited to the following: glyceryl stearate in a mixture with ceteareth-20, ceteareth-25, ceteareth-6 in a mixture with stearyl alcohol, cetylstearyl alcohol in a mixture with PEG-40 castor oil and sodium cetylstearyl sulfate, triceteareth-4 phosphate, sodium cetylstearyl sulfate, lecithin trilaureth-4 phosphate, laureth-4 phosphate, stearic acid, propylene glycol stearate SE, PEG-25 hydrogenated castor oil, PEG-54 hydrogenated castor oil, PEG-6 caprylic/capric glycerides, glyceryl oleate in a mixture with propylene glycol, ceteth-2, ceteth-20, polysorbate 60, glyceryl stearate, PEG-25 hydrogenated cast
- silicone emulsifiers find use.
- the silicone emulsifiers are selected from the group of interface-active substances, alkylmethicone copolyols, and/or alkyl dimethicone copolyols, particularly from the group of compounds characterized by the following chemical structure:
- X and Y independently of one another, are chosen from the group H and the branched and unbranched alkyl groups, acyl groups and alkoxy groups having 1 to 24 carbon atoms, p is a number from 0 to 200, q is a number from 1 to 40, and r is a number from 1 to 100.
- the total amount of emulsifiers used in the personal care compositions are present in the range from about 0.1 to about 10.0% by weight, preferably about 0.5 to about 5.0% by weight, based on the total weight of the preparations.
- the present invention be limited to any specific concentration of emulsifier and/or co-emulsifier, as various embodiments of the present invention have different preferred concentrations and/or concentration ranges.
- the present invention provides emulsions in various forms, including skin protection creams, skin lotions, cosmetic milks, sunscreen creams, and sun protection milks.
- these compositions comprise fats, oils, waxes, and/or other fatty substances, as well as water, and one or more emulsifiers as are customarily used for such a type of formulation.
- various embodiments of the present invention include additional components, such as auxiliaries and additives, including but not limited to bodying agents, fillers, perfume, dyes, emulsifiers, additional active ingredients (e.g., vitamins and proteins), light protection agents, stabilizers, insect repellents, alcohol, self-tanning substances, water, salts, antimicrobials, proteases, and/or keratinase, etc.
- additional active ingredients e.g., vitamins and proteins
- light protection agents e.g., stabilizers, insect repellents, alcohol, self-tanning substances, water, salts, antimicrobials, proteases, and/or keratinase, etc.
- the present invention will find use in numerous and various medicinal preparations.
- UV protection components but which are not primarily sunscreens.
- UV-A and/or UV-B filter substances are incorporated into day creams and/or hair care compositions.
- the personal care compositions of the present invention comprise cosmetically active ingredients, auxiliaries and/or additives, as are customarily used in such preparations (e.g., antioxidants, preservatives, bacteriocides, perfumes, antifoams, dyes, pigments which have a coloring action, thickeners, surface-active substances, emulsifiers, emollients, moisturizers and/or humectants, fats, oils, waxes or other customary constituents of a cosmetic or dermatological formulation, such as alcohols, polyols, polymers, foam stabilizers, electrolytes, organic solvents or silicone derivatives).
- various compounds will find use in the various embodiments of the present invention, as appropriate for the product and the user.
- preservatives such as those used in food and feed applications find use in various compositions of the present invention.
- the following table provides a list of such compounds, as well as the E number for each compound.
- the present invention be limited to these specific preservatives, as it is contemplated that additional preservatives will find use in various embodiments of the present invention.
- Additional preservatives that find use in various embodiments include but are not limited to dibromodicyanobutane (2-bromo-2-bromomethylglutarodinitrile), 3-iodo-2-propinylbutylcarbamate, 2- bromo-2-nitropropane-l,3-diol, imidazolidinylurea, 5-chloro-2-methyl-4-isothiazolin-3-one, 2- chloroacetamide, benzalkonium chloride, benzyl alcohol, and formaldehyde donors.
- phenyl hydroxyalkyl ethers in particular the compounds known as "phenoxyethanol,” due to their bactericidal and fungicidal effects on a number of microorganisms.
- antioxidants are incorporated in the personal care compositions. It is contemplated that any suitable antioxidants will find use in the personal care compositions of the present invention. Suitable antioxidants include, but are not limited to amino acids (e.g., glycine, histidine, tyrosine, and tryptophan) and derivatives thereof, imidazoles (e.g.
- buthionine sulfoximines in very small tolerated doses (e.g., typically pmol to mmol/kg)
- chelating agents e.g., ⁇ - hydroxy fatty acids, palmitic acid, phytic acid, and lactoferrin
- ⁇ -hydroxy acids e.g.
- any of the active ingredients which commonly find use in such preparations will also find use in various embodiments of the present invention.
- Additional components that are commonly used in such preparations also find use in various embodiments of the present invention.
- actives and inactive compounds include, but are not limited to odor maskers (e.g., perfumes), odor absorber (e.g., phyllosilicates described in DE-P 40 09 347); as well as montmorillonite, kaolinite, illite, beidellite, nontronite, saponite, hectorite, bentonite, smectite, and zinc salts of ricinoleic acid.
- the range of active ingredients (i.e., one or more compounds) in such preparations is preferably from about 0.001 to about 30% by weight; more preferably from about 0.05 to about 20% by weight; and most particularly in the range of from about 1 to about 10% by weight, based on the total weight of the preparation.
- the water phase has a gel character which, in 11
- an effective content of compounds and solvents preferably comprises water, further organic and/or inorganic thickeners, and/or hydrocolloids.
- inorganic thickeners are selected from the group consisting of modified, unmodified, naturally occurring, and synthetic phyllosilicates. Although it is generally preferable to use pure components, in some embodiments, mixtures of different modified and/or unmodified phyllosilicates find use in various compositions of the present invention.
- phyllosilicates are silicates and alumosilicates in which the silicate or aluminate units are linked together via three Si-O- or Al- O- bonds and form a wavy sheet or layer structure. The fourth Si-O- or Al-O- valence is saturated by cations. Relatively weak electrostatic interactions (e.g. hydrogen bridge bonds), exist between the individual layers.
- the layer structure is largely defined by strong, covalent bonds.
- the stochiometry of the sheet silicates is (Si 2 O 5 2" ) for pure silicate structures and (Al m Si 2" m O 5 (2+m)" ) for alumosilicates, wherein "m” is a number greater than zero and less than 2.
- each Si 4+ group replaced by Al 3+ requires another singly charged cation to neutralize the charge.
- the charge balance is preferably evened out by H + , alkali metal ions or alkaline earth metal ions.
- aluminum is used as a counterion.
- alumosilicates In contrast to the alumosilicates, these compounds are referred to as “aluminum silicates.” "Aluminum alumosilicates,” in which aluminum is present both in the silicate network, and also as counterion, also find use in some embodiments of the present invention.
- Phyllosilicates are well known in the art (See e.g., Hollemann et al., Lehrbuch der Anorganischen Chemie [Textbook of Inorganic Chemistry], 91st-100th Ed., Walter de Gruyter - Verlag [1985]; Remy, Lehrbuch der Anorganischen Chemie, 12 th Ed., Akademische Verlagsgesellschaft, für [1965]).
- the layer structure of montmorillonite is also known (See, R ⁇ mpps Chemie-Lexikon, Franckh'sche Verlags Stuttgart, W. Keller & Co., Stuttgart, 8" 1 Ed., [1985], p. 2668 f).
- Examples of phyllosilicates include the following (montmorillonite is the main mineral comprising the naturally-occurring bentonites);
- Montmorillonite Nao.3 3 ((Ali. 6 7Mgo.33)(OH) 2 (Si 4 Oio)) often simplified: Al 2 ⁇ 3 *4Si ⁇ 2 *H 2 O*nH 2 ⁇ or
- inorganic gel formers including but not limited to aluminum silicates, such as the montmorillonites (bentonites, hectorites and derivatives thereof, such as quaternium-18 bentonite, quaternium-18 hectorites, stearalkonium bentonites and stearalkonium hectorites), and also magnesium-aluminum silicates (VEEGUM ® grades), and sodium-magnesium silicates (LAPONITE ® grades) find use in the present invention.
- aluminum silicates such as the montmorillonites (bentonites, hectorites and derivatives thereof, such as quaternium-18 bentonite, quaternium-18 hectorites, stearalkonium bentonites and stearalkonium hectorites
- VEEGUM ® grades magnesium-aluminum silicates
- LAPONITE ® grades sodium-magnesium silicates
- Al can be replaced by Mg, Fe 2+ , Fe 3+ , Zn, Pb (e.g., from harmful substances in waste waters), Cr, Cu and other elements.
- the resulting negative charge of the octahedral layers is compensated for by the presence of cations, in particular Na + (i.e., sodium montmorillonite) and Ca 2+ (Le., calcium montmorillonite, a compound that is only swellable to a very small extent) in interlayer positions.
- synthetic magnesium silicates and/or bentonites find use in the present invention, including but not limited to such commercially available compounds as OPTIGEL® (S ⁇ d- Chemie).
- aluminum silicates such as the commercially available VEEGUM® (R.T. Vanderbilt Comp., Inc), find use in the present invention.
- VEEGUM® grades which find use in various embodiments of the present invention are provided below.
- the above products swell in water to form viscous gels, which have an alkaline reaction.
- the organophilization of montmorillonite or bentonites (exchange of the interlayer cations for quaternary alkylammonium ions) produces products (bentones) which are preferably used for dispersion in organic solvents and oils, fats, ointments, inks, surface coatings and in detergents.
- BENTONE® is a trade name for various neutral and chemically inert gelling agents which are constructed from long-chain, organic ammonium salts and specific types of montmorillonite. BENTONE® gelling agents swell in organic media, which cause the media to also swell. The gels are resistant to diluted acids and alkalis, although they partially lose their gelling properties upon prolonged contact with strong acids and alkalis. Because of their organophilic character, BENTONE® gelling agents are only wettable by water with difficulty.
- BENTONE® 38 an organically modified montmorillonite, available as a cream-colored to white powder
- BENTONE® LT a purified clay mineral
- BENTONE® Gel MIO an organically modified montmorillonite which is supplied as a very fine suspension in mineral oil (SUS -71) (10% bentonite, 86.7% mineral oil and 3.3% wetting agent)
- BENTONE® Gel IPM an organically modified bentonite which is suspended in isopropyl myristate (10% bentonite, 86.7% isopropylmyristate, 3.3% wetting agent)
- BENTONE® Gel CAO an organically modified montmorillonite which is taken up in castor oil (10% bentonite, 86.7% castor oil and 3.3% wetting agent)
- Hydrocolloid is the technological abbreviation for the more correct name “hydrophilic colloid.” Hydrocolloids are macromolecules which have a largely linear structure and intermolecular forces of interaction which permit secondary and primary valence bonds between the individual molecules to form a recticular structure. Some hydrocolloids are water-soluble natural or synthetic polymers which, in aqueous systems, form gels or viscous solutions. These compounds increase the viscosity of water by either binding water molecules (hydration), or by absorbing and encapsulating the water into their interwoven macromolecules, while restricting the mobility of water.
- water-soluble polymers represent a large group of natural and synthetic polymers that are chemically very different, but which share a common feature in their solubility in water or aqueous media.
- hydrophilic groups can be nonionic, anionic or cationic in nature, for example as follows:
- the group of the cosmetically and dermatologically relevant hydrocolloids are divided into the following groups: organic, natural compounds (e.g., agar agar, carrageen, tragacanth, gum arabic, alginates, pectins, polyoses, guar flour, carob bean flour, starch, dextrins, gelatins, and casein); organic, modified natural substances (e.g., carboxymethylcellulose and other cellulose ethers, hydroxyethylcellulose and hydroxypropylcellulose and microcristalline cellulose); organic, completely synthetic compounds (e.g., polyacrylic and polymethacrylic compounds, vinyl polymers, polycarboxylic acids, polyethers, polyimines, polyamides, and polyurethanes); and inorganic compounds (e.g., polysilicic acids, clay minerals, such as montmorillonites, zeolites, and silicas).
- organic, natural compounds e.g., agar agar, carrageen, tragacanth
- ethylcelluloses find use in compositions of the present invention as stabilizers.
- Ethylcelluloses are characterized by the following structure. In this structure, the Rs are either ethyl groups or hydrogen atoms.
- the degree of ethylation in the ethylcellulose is from about 2.0 to about 3.0, corresponding to about 40 to about 55%, and more preferably about 48.0 to about 49.5% ethylation.
- the average molecular mass is preferably chosen such that the viscosity of an approximately 5% strength solution in a mixture of 80 parts of toluene and 20 parts of ethanol at 25°C is 3 to 110 mPas, and more preferably 9 to 11 mPas.
- the average molar mass is from about 100,000 to about 400,000 g/mol.
- the ethylcellulose concentration in compositions of the present invention ranges from about 0.1 to about 10% by weight, based on the total weight of the preparations.
- Various ethylcelluloses find use in the present invention, including but not limited to those that are commercially available (e.g., ETHOCEL ® Standard 10 Premium; Dow Chemicals).
- microcristalline cellulose finds use as hydrocolloid in compositions of the present invention.
- microcrystalline cellulose preparations find use in the present invention, including but not limited to those that are commercially available (e.g., AVICEL®, such as AVICEL® RC- 591, as well as AVICEL® RC/CL; AVICEL® CE-15; and AVICEL® 500; FMC Corporation Food and Pharmaceutical Products).
- AVICEL® RC-591 a modified microcristalline cellulose which is made up of 89% microcrystalline cellulose and 11% sodium carboxymethylcellulose finds use in the present invention.
- methylcelluloses (Le., methylesters of cellulose). These compounds are characterized by the following structural formula in which R can be a hydrogen or a methyl group.
- Cellulose mixed ethers (generally referred to as methylcelluloses, which contain, in addition to a predominating content of methyl groups, also 2-hydroxyethyl, 2-hydroxypropyl or 2-hydroxybutyl groups) also find use in some embodiments of the present invention.
- hydroxypropyl)methyl- celluloses e.g., METHOCEL® E4M; Dow Chemical Co. find use in the present invention.
- sodium carboxymethylcellulose (Le., the sodium salt of the glycolic ether of cellulose, for which R in the above structural formula may be hydrogen and/or CH 2 -COONa) finds use in the present invention.
- sodium carboxymethylcellulose also sometimes referred to as "cellulose gum” (e.g., NATROSOL® Plus 330 CS; Aqualon) finds use in the present invention.
- xanthan (CAS No. 11138-66-2), (Le., xanthan gum), an anionic heteropoly saccharide generally formed by fermentation from maize sugar and isolated as potassium salt finds use in the present invention. It is produced by Xanthomonas campestris and some other species under aerobic conditions and has a molecular weight of from 2xlO 6 to 24xlO 6 . Xanthan is formed from a chain having cellulose with side chains. The structure of the subgroups consists of glucose, mannose, glucuronic acid, acetate and pyruvate. The number of pyruvate units determines the viscosity of the xanthan.
- carrageen is used as a gel former in compositions of the present invention.
- This compound is an extract from North Atlantic red algae (Florideae; Chondrus crispus and Gigartina stellat ⁇ ) that has a structure similar to that of agar.
- the term "carrageen” is frequently used in reference to a dried algae product and “carrageenan” is used in reference to the extract thereof.
- the carrageen precipitated from the hot-water extract of the algae is a colorless to sand-colored powder with a molecular weight range from about 100,000 to about 800,000 and a sulfate content of about 25%.
- chitosan i.e., partially deacylated chitin finds use in various compositions of the present invention.
- Chitosan has film-forming properties and is characterized as having a silky feel on the skin.
- chitosan finds use in some preparations, including hair care compositions, as it is better than chitin in thickening and/or stabilizing, as well as improving the adhesion and water resistance of polymeric films.
- n assumes values up to about 10000
- X is either the acetyl radical or hydrogen.
- Chitosan forms by deacetylation and partial depolymerization (hydrolysis) of chitin, which is characterized by the structural formula
- chitosan is positively charged and in that range is also soluble in aqueous systems. It is incompatible with anionic raw materials. For this reason, in order to prepare chitosan-containing oil-in-water emulsions, the use of nonionic emulsifiers is appropriate (See e.g., EP 776 657).
- compositions of the present invention contain at least one chitosans with a degree of deacetylation of at least about > 25% , and more preferably, a range of more than about 55 to about 99% (as determined by means of 1 H-NMR).
- chitosans of molecular weights between about 10,000 and about 1,000,000, in particular those with molecular weights between 100,000 and 1,000,000 (determined by means of gel permeation chromatography) find use in the present invention.
- polyacrylates find use as gelling agents in some compositions of the present invention.
- Suitable polyacrylates include but are not limited to acrylate-alkyl acrylate copolymers, in particular those chosen from the group of carbomers or CARBOPOL® copolymers (B. F. Goodrich Co.).
- the acrylate-alkyl acrylate copolymers that find use in some embodiments of the present invention have the following structure:
- R' is a long-chain alkyl radical
- x and y represent numbers which symbolize the respective stoichiometric proportion of each of the comonomers.
- acrylate copolymers and/or acrylate-alkyl acrylate copolymers include but are not limited to those that are commercially available (e.g., CARBOPOL® 1382, CARBOPOL® 981, and CARBOPOL® 5984; B. F. Goodrich Co., and in particular, polyacrylates from the group of CARBOPOL grades 980, 981, 1382, 2984, 5984 and Carbomer 2001).
- copolymers of Ci O - 30 - alkyl acrylates and one or more monomers of acrylic acid, of methacrylic acid or esters thereof which are crosslinked with an allyl ether of sucrose or an allyl ether of pentaerythrito find use in some embodiments of the present invention.
- ammonium acryloyldimethyltaurates/vinylpyrrolidone copolymers find use in the present invention.
- These ammonium acryloyldimethyl taurate/vinylpyrrolidone copolymers have the empirical formula [C 7 Hi 6 N 2 SO 4 J n [C 6 H 9 NO] n , which corresponds to the following structure:
- copolymers/crosspolymers comprising acryloyldimethyl taurate (e.g., SIMUGEL® EG and SIMUGEL ® EG; Seppic S.A.) find use in some compositions of the present invention.
- Additional completely synthetic hydrocolloids that find use in the present invention include, but are not limited to anionic polyurethanes which are soluble or dispersible in water and which are advantageously obtainable from:
- Suitable aminoalcohols that find use in some embodiments of the present invention include but are not limited to 2-aminoethanol, 2-(N-methylamino)ethanol, 3-aminopropanol, and 4-aminobutanol.
- diamines such as ethylenediamine, propylenediamine, 1,4-diaminobutan, 1,6- diaminohexane, and ⁇ , ⁇ -diamines which can be prepared by amination of polyalkylene oxides with ammonia find use in some compositions of the present invention.
- Component Ab) is, in particular, dimethylolpropanoic acid or a compound with the formula:
- RR is in each case a C 2 -Ci 8 -alkylene group and Me is Na or K.
- Component Ac is, in particular, hexamethylene diisocyanate, isophorone diisocyanate, methyldiphenyl isocyanate (MDI), and/or tolylene diisocyanate.
- the polyurethanes are obtained by reacting the compounds of groups Aa) and 2006/015711
- the polyurethanes have K values according to H. Fikentscher (determined in 0.1% strength by weight solutions in N-methylpyrrolidone at 25°C and pH 7) of from about 15 to about 100, and preferably about 25 to about 50.
- the K value i.e., "intrinsic viscosity"
- Polyurethanes containing acid groups that find use in some embodiments of the present invention include, but are not limited to polyurethanes that are water-soluble or dispersible without the aid of emulsifiers after partial or complete neutralization.
- the salts of the polyurethanes generally have better solubility or dispersibility in water than the unneutralized polyurethanes.
- Bases which find use for the neutralization of the polyurethanes include alkali metal bases (e.g., sodium hydroxide solution, potassium hydroxide solution, soda, sodium hydrogencarbonate, potassium carbonate or potassium hydrogen carbonate) and alkaline earth metal bases (e.g., calcium hydroxide, calcium oxide, magnesium hydroxide or magnesium carbonate, and ammonia and amines).
- alkali metal bases e.g., sodium hydroxide solution, potassium hydroxide solution, soda, sodium hydrogencarbonate, potassium carbonate or potassium hydrogen carbonate
- alkaline earth metal bases e.g., calcium hydroxide, calcium oxide, magnesium hydroxide or magnesium carbonate, and ammonia and amines.
- 2-amino- 2-methylpropanol, diethylaminopropylamine and triisoproanolamine find particular use in the neutralization of the poly
- the neutralization of the polyurethanes containing acid groups is carried out using mixtures of two or more bases (e.g. mixtures of sodium hydroxide solution and triisopropanolamine). Depending on the intended use, neutralization is partial (e.g. about 20 to about 40%) or complete (i.e., 100%). These polymers and their preparation are described in more detail in DE-A-4225 045, incorporated herein by reference.
- Ba at least one diisocyanate, which may have already been reacted beforehand with one or more compounds which contain two or more active hydrogen atoms per molecule, and
- Bb at least one diol, primary or secondary amino alcohol, primary or secondary diamine or primary or secondary triamine with one or more tertiary, quaternary or protonated tertiary amino nitrogen atoms.
- Preferred diisocyanates are as given above under A).
- Compounds with two or more active hydrogen atoms are diols, aminoalcohols, diamines, polyesterols, polyamidediamines and polyetherols. Suitable compounds of this type are as given above under A).
- the polyurethanes are prepared as described above under A).
- Charged cationic groups can be produced in the polyureas from the tertiary amino nitrogen atoms present either by protonation, (e.g., with carboxylic acids, such as lactic acid), or by quaternization (e.g. with alkylating agents, such as C 1 to C 4 -alkyl halides) or sulfates.
- alkylating agents include, but are not limited to ethyl chloride, ethyl bromide, methyl chloride, methyl bromide, dimethyl sulfate and diethyl sulfate.
- RR' is a hydrogen atom or a Ci-C 2 o-alkyl group, which is used in an amount which suffices for about 0.35 to about 2.25 milliequivalents of carboxyl groups to be present in the polyurethane per g of polyurethane,
- Cb about 10 to about 90% by weight, based on the weight of the polyurethane, of one or more organic compounds with not more than two active hydrogen atoms and
- the carboxyl groups present in the polyurethane are, finally, at least partially neutralized with a suitable base.
- the polymers used in some embodiments of the present invention have a K value of from about 15 to about 100, and more preferably from about 25 to about 50.
- the polymers are generally present in the composition in an amount in the range from about 0.2 to about 20% by weight, based on the total weight of the compositions.
- the salt is used in an amount effective for improving the exchangeability of the polymers.
- the salt is generally used in an amount of from about 0.02 to about 10% by weight, and more preferably from about 0.05 to about 5% by weight, and in particular, from about 0.1 to about 3% by weight, based on the total weight of the composition.
- the total amount of one or more hydrocolloids in some embodiments of the personal care compositions of the present invention is less than about 5% by weight, preferably between about 0.05 and about 3.0% by weight, and more preferably between about 0.1 and about 1.0% by weight, based on the total weight of the preparations.
- Glyi, GIy 2 and GIy 3 are monoglycoside radicals. GIy 2 and GIy 3 may also, individually or together, represent saturations by hydrogen atoms.
- Glyi, GIy 2 and GIy 3 are selected from the group of hexosyl radicals, in particular the rhamnosyl radicals and glucosyl radicals.
- hexosyl radicals for example allosyl, altrosyl, galactosyl, gulosyl, idosyl, mannosyl and talosyl, also find use in some embodiments of the present invention.
- the flavone glycosides provided in some of the personalcare compositions of the present invention have the following structure:
- the personal care compositions of the present invention comprise one or more flavone glucoside selected from the group consisting of a-glucosylrutin, a-glucosylmyricetin, a- glucosylisoquercitrin, a-glucosylisoquercetin and a-glucosylquercitrin.
- the flavone glucoside is a-glucosylrutin.
- other plastoquinones with varying substituents on the quinone ring exist in some embodiments.
- the present invention comprises at least one creatine and/or creatine derivative.
- Creatine has the following structure:
- compositions of the present invention creatine phosphate, creatine sulfate, creatine acetate, creatine ascorbate, and/or derivatives esterified at the carboxyl group with mono- or polyfunctional alcohols find use.
- the personal care compositions of the present invention contain L- carnitine [3-hydroxy-4-(trimethylammonio)butyrobetaine].
- Acylcarnitines have the following general structure:
- binding regions each contain a "canonical loop" structure, which is a motif found in a variety of serine proteinase inhibitors (Bode and Huber, Eur. J. Biochem., 204:433-451 [1992]).
- the STI and BBI protease inhibitors have binding loops that inhibit proteases.
- the present invention provides protease inhibitor variants with alterations in one or more reactive sites (e.g., Loop I and/or Loop II of BBI).
- the loops are replaced with sequences that interact with a target protein.
- variant sequences are selected by various methods known in the art, including but not limited to phage display and other suitable screening methods. For example, a random peptide gene library is fused with phage PIII gene so the peptide library will be displayed on the surface of the phage. Subsequently, the phage display library is exposed to the target protein and washed with buffer to remove non-specific binding (this process is sometimes referred to as panning). Finally, the binding phage and PCR the DNA sequence for the peptide encoded are isolated.
- phage display and other suitable screening methods for example, a random peptide gene library is fused with phage PIII gene so the peptide library will be displayed on the surface of the phage. Subsequently, the phage display library is exposed to the target protein and washed with buffer to remove non-specific binding (this process is sometimes referred to as panning). Finally, the binding phage and PCR the DNA sequence for the peptide encoded are isolated.
- each protease inhibitor or variant thereof is expressed as a fusion protein by the host bacterial cell.
- cleavage of the fusion polypeptide to release the desired protein will often be useful, it is not necessary.
- Protease inhibitors and variants thereof expressed and secreted as fusion proteins surprisingly retain their function.
- the present invention provides bacterial host cells which have been transduced, transformed or transfected with an expression vector comprising a protease inhibitor-encoding nucleic acid sequence.
- the culture conditions such as temperature, pH and the like, are those previously used for the parental host cell prior to transduction, transformation or transfection are apparent to those skilled in the art.
- a nucleotide sequence encoding a fusion protein is operably linked to a promoter sequence functional in the host cell.
- This promoter-gene unit is then typically cloned into intermediate vectors before transformation into the host cells for replication and/or expression.
- These intermediate vectors are typically prokaryotic vectors (e.g., plasmids, or shuttle vectors).
- vectors Appropriate cloning and expression vectors are also described in various references known to those in the art (See e.g., Sambrook et al, supra and Ausubel et ah, supra, expressly incorporated by reference herein).
- the appropriate DNA sequence is inserted into a plasmid or vector (collectively referred to herein as "vectors") by any suitable method.
- vectors plasmid or vector
- the DNA sequence is inserted into an appropriate restriction endonuclease site(s) by standard procedures known to those in the art.
- Appropriate vectors are typically equipped with a selectable marker-encoding nucleic acid sequence, insertion sites, and suitable control elements, such as termination sequences.
- the vectors comprise regulatory sequences, including, for example, control elements (Ie., promoter and terminator elements or 5' and/or 3' untranslated regions), effective for expression of the coding sequence in host cells (and/or in a vector or host cell environment in which a modified soluble protein coding sequence is not normally expressed), operably linked to the coding sequence.
- control elements Ie., promoter and terminator elements or 5' and/or 3' untranslated regions
- Exemplary promoters include both constitutive promoters and inducible promoters. Such promoters are well known to those of skill in the art. Those skilled in the art are also aware that a natural promoter can be modified by replacement, substitution, addition or elimination of one or more nucleotides without changing its function. The practice of the present invention encompasses and is not constrained by such alterations to the promoter. The choice of promoter used in the genetic construct is within the knowledge of one skilled in the art.
- selectable marker will depend on the host cell. Appropriate markers for different bacterial hosts are well known in the art. Typical selectable marker genes encode proteins that (a) confer resistance to antibiotics or other toxins (e.g., ampicillin, methotrexate, tetracycline, neomycin mycophenolic acid, puromycin, zeomycin, or hygromycin; or (b) complement an auxotrophic mutation or a naturally occurring nutritional deficiency in the host strain.
- antibiotics or other toxins e.g., ampicillin, methotrexate, tetracycline, neomycin mycophenolic acid, puromycin, zeomycin, or hygromycin.
- a selected PI coding sequence is inserted into a suitable vector according to well-known recombinant techniques and used to transform a cell line capable of PI expression. Due to the inherent degeneracy of the genetic code, other nucleic acid sequences which encode substantially the same or a functionally equivalent amino acid sequence may be used to clone and express a specific protease inhibitor, as further detailed above. Therefore it is appreciated that such substitutions in the coding region fall within the sequence variants covered by the present invention. Any and all of these sequence variants can be utilized in the same way as described herein for a parent Pi-encoding nucleic acid sequence. Those skilled in the art recognize that differing PIs will be encoded by differing nucleic acid sequences.
- a protease inhibitor nucleic acid sequence, homologue, variant or fragment thereof is obtained, it is modified by any number of ways. Where the sequence involves non-coding flanking regions, the flanking regions may be subjected to resection, mutagenesis, etc. Thus, transitions, transversions, deletions, and insertions may be performed on the naturally occurring sequence.
- heterologous nucleic acid constructs include the coding sequence for at least one protease inhibitor, or variant(s), fragment(s) or splice variant(s) thereof: (i) in isolation; (ii) in combination with additional coding sequences; such as fusion protein or signal peptide coding sequences, where the PI coding sequence is the dominant coding sequence; (iii) in combination with non-coding sequences, such as control elements, such as promoter and terminator elements or 5' and/or 3' untranslated regions, effective for expression of the coding sequence in a suitable host; and/or (iv) in a vector or host ' environment in which the PI coding sequence is a heterologous gene.
- heterologous nucleic acid containing the appropriate nucleic acid coding sequence, together with appropriate promoter and control sequences, is employed to introduced into bacterial host cells to permit the cells to express at least one protease inhibitor or variant thereof.
- a heterologous nucleic acid construct is employed to transfer a Pi-encoding nucleic acid sequence into a cell in vitro.
- the host cells stably integrate the nucleic acid sequences of the present invention.
- the first and second expression cassettes are present on a single vector, while in other embodiments these cassettes are present on separate vectors.
- the expression cassette in addition to a promoter sequence, also contains a transcription termination region downstream of the structural gene to provide for efficient termination. In some embodiments, the termination region is obtained from the same gene as the promoter sequence, while in other embodiments it is obtained from another gene. The selection of suitable transcription termination signals is well-known to those of skill in the art.
- any suitable expression vector will find use in the present invention. Indeed, it is contemplated that various conventional vectors used for expression in eukaryotic or prokaryotic cells will be suitable and find use with the present invention.
- Standard bacterial expression vectors include bacteriophages ⁇ and M13, as well as plasmids such as pBR322 based plasmids, pSKF, pET23D, and fusion expression systems such as MBP, GST, and LacZ.
- epitope tags are added to recombinant proteins, in order to provide convenient methods of isolation ⁇ e.g., c-myc).
- Additional elements typically included in expression vectors are replicons, a gene encoding antibiotic resistance to permit selection of bacteria that harbor recombinant plasmids, and unique restriction sites in nonessential regions of the plasmid to allow insertion of heterologous sequences.
- the particular antibiotic resistance gene chosen is not critical, any of the many resistance genes known in the art are suitable.
- heterologous nucleic acid constructs comprising a Pi-encoding nucleic acid sequence are transcribed in vitro, and the resulting RNA introduced into the host cell by any of the suitable methods known in the art.
- Bacterial Hosts and Expression Appropriate host cells include any suitable bacterial species.
- the bacterial hosts serve both as the expression hosts and the source of the first and second nucleic acids.
- surprising levels of expression have been obtained.
- the system utilized herein has achieved levels of expression and secretion of greater than 0.5 g/1 of protease inhibitor. .
- the transfected host cells are cultured under conditions favoring expression of gene encoding the desired protein. Large batches of transformed cells can be cultured as described above. Finally, product is recovered from the culture using techniques known in the art.
- Accessory proteins such as thiol-disulfide oxidoreductases or chaperones find use in some embodiments, as they may be beneficial to help fold the secretory protein into its active conformation.
- Thiol-disulfide oxidoreductases and protein disulfide isomerases catalyze the formation of the correct disulfide bonds in the protein.
- Overexpression of the bdbDC operon in B. subtilis has been shown to be beneficial for the production of a protein with disulfide bonds (See e.g., Meima et al., J. Biol. Chem., 277:6994-7001, [2002]).
- the fraction of properly folded secretory protein is increased by the addition of chemicals to the growth medium that reduce/oxidize disulfide bonds, and/or alter the general redox potential, and/or chemicals that alter solvent properties thus affecting protein conformation and aggregation.
- a reagent that reduces disulfide bonds such as 2-mercaptoethanol, is preferred to increase the fraction of correctly folded protein.
- disulfide reducing or oxidizing agents e.g., DTT, TCEP, reduced and oxidized glutathione, cysteine, cystine, cysteamine, thioglycolate, S 2 O 3 " , S 2 O 4 " , S 2 O 5 “ , SO 3 " , S 2 O 7 “ , Cu+, etc.
- DTT disulfide reducing or oxidizing agent
- TCEP reduced and oxidized glutathione, cysteine, cystine, cysteamine, thioglycolate, S 2 O 3 " , S 2 O 4 " , S 2 O 5 “ , SO 3 “ , S 2 O 7 “ , Cu+, etc.
- ⁇ ME disulfide reducing/oxidizing agents
- the present invention relies on fermentation procedures for culturing bacterial species. Fermentation procedures for production of heterologous proteins by bacterial species are well known in the art. Culturing is accomplished in a growth medium comprising an aqueous mineral salts medium, organic growth factors, the carbon and energy source material, molecular oxygen (for aerobic and facultative bacteria), and, of course, a starting inoculum of one or more particular microorganism species to be employed.
- a growth medium comprising an aqueous mineral salts medium, organic growth factors, the carbon and energy source material, molecular oxygen (for aerobic and facultative bacteria), and, of course, a starting inoculum of one or more particular microorganism species to be employed.
- the media include, in addition to nitrogen, suitable amounts of phosphorus, magnesium, calcium, potassium, sulfur, and sodium, in suitable soluble assimilable ionic and combined forms, and also present preferably should be certain trace elements such as copper, manganese, molybdenum, zinc, iron, boron, and iodine, and others, again in suitable soluble assimilable form, all as known in the art.
- aeration generally is conducted at a rate which is in the range of about 0.5 to 10, preferably about 0.5 to 7, volumes (at the pressure employed and at 25 0 C.) of oxygen-containing gas per liquid volume in the fermentor per minute. This amount is based on air of normal oxygen content being supplied to the reactor, and in terms of pure oxygen the respective ranges would be about 0.1 to 1.7, or preferably about 0.1 to 1.3, volumes (at the pressure employed and at 25 0 C.) of oxygen per liquid volume in the fermentor per minute.
- the pressure employed for the microbial conversion process can range widely. Pressures generally are within the range of about 0 to 50 psig, presently preferably about 0 to 30 psig, more preferably at least slightly over atmospheric pressure, as a balance of equipment and operating cost versus oxygen solubility achieved. Greater than atmospheric pressures are advantageous in that such pressures do tend to increase a dissolved oxygen concentration in the aqueous ferment, which in turn can help increase cellular growth rates. At the same time, this is balanced by the fact that high atmospheric pressures do increase equipment and operating costs.
- the fermentation temperature can vary somewhat, but for most bacterial species used in the present invention, the temperature generally will be within the range of about 2O 0 C to 4O 0 C, generally preferably in the range of about 28 0 C to 37 0 C, depending on the strain of microorganism chosen, as known to those skilled in the art.
- the feed rates of the various materials can be varied so as to obtain as rapid a cell growth rate as possible, consistent with efficient utilization of the carbon and energy source, to obtain as high a yield of microorganism cells relative to substrate charge as possible, but more importantly to obtain the highest production of the desired protein per unit volume.
- the secreted protein is recovered.
- the present invention provides methods of separating a desired protein from its fusion analog. It is specifically contemplated that the methods described herein will find use in the separation of proteinase inhibitor and variants from the fusion analog.
- the collection and purification of the desired protein from the fermentation broth can also be achieved using procedures known to those of skill in the art.
- the fermentation broth will generally contain cellular debris, including cells, various suspended solids and other biomass contaminants, as well as the desired protein product, which are preferably removed from the fermentation broth by means known in the art.
- Suitable processes for such removal include conventional solid-liquid separation techniques (e.g., centrifugation, filtration, dialysis, microfiltration, rotary vacuum filtration, or other known processes), to produce a cell-free filtrate.
- solid-liquid separation techniques e.g., centrifugation, filtration, dialysis, microfiltration, rotary vacuum filtration, or other known processes
- Precipitating the proteinaceous components of the supernatant or filtrate may be accomplished by means of a salt (e.g., ammonium sulfate) or low pH (typically less than 3), followed by purification by a variety of chromatographic procedures (e.g., ion exchange chromatography, affinity chromatography, hydrophobic interaction chromatography, hydrophobic charge induction chromatography etc.) or similar art recognized procedures. It is not intended that the present invention be limited to any particular separation method, as it is contemplated that any method will find use in the present invention.
- the polypeptide when the expressed desired polypeptide is secreted from the bacterial cells, the polypeptide is purified from the growth media.
- the expression host cells are removed from the media before purification of the polypeptide (e.g. by centrifugation).
- the host cell When the expressed recombinant desired polypeptide is not secreted from the host cell, the host cell is preferably disrupted and the polypeptide released into an aqueous "extract" which is the first stage of purification.
- the expression host cells are collected from the media before the cell disruption
- the cell disruption may be performed by using any suitable means known in the art, such as by lysozyme or beta-glucanase digestion or by forcing the cells through high pressure (See e.g., Scobes, Protein Purification, Second edition, Springer-Verlag)
- the addition of six histidine residues i.e., a "His Tag" to the C- terminus is used as an aid in the purification of the desired protein and its fusion analog.
- His tags as a purification aid is well known in the art (See e.g., Hengen, TEBS 20:285-286 [1995]).
- the 6x his-tagged proteins are easily purified using Immobilized Metal ion Affinity Chromatography (IMAC), as known to those skilled in the art.
- IMAC Immobilized Metal ion Affinity Chromatography
- the protease inhibitors produced using the present invention be very highly pure (e.g., having a purity of more than 99%). This is particularly true whenever the desired protein is to be used as a therapeutic, but is also necessary for other applications.
- the methods described herein provide a way of producing substantially pure desired proteins.
- the desired proteins described herein are useful in pharmaceutical and personal care compositions. However, it is contemplated that proteins of varying purity levels will be produced using the methods of the present invention and it is not intended that the proteins produced using the present invention be limited to any particular level of purity.
- the activity of the protein is increased by the addition of chemicals that reduce/oxidize disulfide bonds and/or alter the general redox potential, and/or chemicals that alter solvent properties thus affecting protein conformation and aggregation.
- addition of a reagent that reduces disulfide bonds, such as 2-mercaptoethanol, is used to increase activity of the protein.
- disulfide reducing or oxidizing agents e.g., DTT, TCEP, reduced and oxidized glutathione, cysteine, cystine, cysteamine, thioglycolate, S 2 O 3 2" , S 2 O 4 2" , S 2 O 5 2" , SO 3 2" , S 2 O 7 2" , Cu+, protein disulfide isomerases, protein thiol-disulfide oxidoreductases, etc.), either used alone or in combination, find use in the present invention.
- Other adjuvants that alter solvent properties e.g.
- partially purified protein is diluted in buffer (in some particularly preferred embodiments, a zwitterionic buffer with TWEEN®-80 at basic pH) and activated with bME and a disulfide oxidizing agent (in alternative preferred embodiments, oxidized glutathione or sodium sulfite).
- buffer in some particularly preferred embodiments, a zwitterionic buffer with TWEEN®-80 at basic pH
- a disulfide oxidizing agent in alternative preferred embodiments, oxidized glutathione or sodium sulfite.
- conditions will be screened in order to determine the optimal activation of the protein, if desired.
- ⁇ ME concentrations 0.1 - 10 mM
- oxidizing agent concentrations (0 to 1/20 to 20 times the ⁇ ME concentration) pH (7.5 - 9.5), temperatures (15 - 4O 0 C), dilutions (1 - 20 fold), incubation times (12 - 72 h), aeration (incubations under inert gas to vigorous mixing under oxygen containing gases), buffer types (Tris, CUES, CAPS, Tricine, TAPS, other zwitterionic buffers, etc.), buffer concentrations (0.1 - 1 M), and the addition of various adjuvants known to alter solvent properties thereby affecting protein conformation and aggregation (e.g., ethanolamine, DMSO, TWEEN®- 80, arginine, urea, etc.) are tested in order to determine the optimum conditions for the expression system used.
- adjuvants known to alter solvent properties thereby affecting protein conformation and aggregation
- the present invention provides cosmetic and/or pharmaceutical compounds for improving the appearance of skin comprising at least one polypeptide or a peptide.
- the polypeptide or peptide binds to VEGF.
- the binding of the polypeptide or peptide to VEGF blocks the downstream activity of VEGF.
- the compounds comprise at least one peptide, while in other embodiments, the compounds comprise at least one polypeptide.
- the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-7, 16, and 17.
- the peptide has a conserved binding sequence, the sequence being XXLWPXWC (SEQ ID NO: 15).
- the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOS:22-24.
- the compounds have a sequence, the sequence being at least 70%, preferably 80%, more preferably 90%, and most preferably 95% homologous to the sequences set forth herein.
- the polypeptide has a molecular weight that is preferably between 500 Daltons and 30,000 Daltons, more preferably between 1000 Daltons and 10,000 Daltons, and most preferably from 1500 Daltons to 8,000 Daltons.
- the compounds find use in the improvement of skin in an organism (i.e., subject) having a skin disorder.
- the skin disorder is an angiogenic skin disorder.
- the skin disorder is at least one selected from the group consisting of psoriasis, venous ulcers, acne, rosacea, warts, eczema, hemangiomas and lymphangiogenesis, etc.
- the skin disorder is rosacea.
- the present invention be limited to any particular skin treatment or condition.
- skin coloring has been of concern to human beings for many years.
- a uniformly colored complexion (Le., without areas of redness, darkness or white) is preferred by many individuals.
- whitening of the skin is a desired effect, while in others tanned skin is preferred.
- Various compounds have been used to achieve depigmentation, including kojic acid, hydroxyquinone, and retinoids. Much research has been devoted to the production of tanned skin without the use of radiation in order to avoid photodamage.
- TRP-I The chemical and enzymatic basis of melanogenesis is well known.
- Melanocytes migrate from the embryonal neural crest into the skin to produce the secretory granules known as melanosomes, which produce melanin via melanogenesis.
- the melanin produced by these cells is then distributed to keratinocytes via melanocyte dendrites.
- the key enzyme in melanogenesis is tyrosinase, which initiates a cascade of reactions which convert tyrosine to melanin, which is a polymer.
- Two tyrosinase-related proteins (TRPs) are known, which share about 40% homology with tyrosinase. These proteins (TRP-I and TRP-2) have catalytic activities as well as regulatory roles in melanogenesis. TRP-I is reported to be the most abundant glycoprotein in melanocytes.
- Tyrosinase and the TRP's share structural and biological properties with the lysosomal-associated membrane protein (LAMP) gene family. Thus, it has been contemplated that their targeting to the melanosomal membrane might induce their activation. It is also contemplated that phosphorylation/dephosphorylation reaction occurring at the cytoplasmic tails of these proteins could be involved in the regulation of melanogenesis.
- the beta isoform of the Protein Kinase C (PKC) family has been shown to regulate human melanogenesis through tyrosinase activation. Gene expression of tyrosinase, TRP-I and TRP-2 is coordinated. In addition, all three enzymes are expressed in human epidermis.
- the Protease-activated receptor-2 (PAR-2) is a seven transmembrane G-protein-coupled receptor, that is related to, but distinct from the thrombin receptors (TR also named PAR-I, and PAR-3) in its sequence. Both receptors are activated proteolytically by an arginine-serine cleavage at the extracellular domain. The newly created N-termini then activate these receptors as tethered lig ' ands. Both receptors may be activated by trypsin, but only the TRs are activated by thrombin. In addition, only PAR-2 is activated by mast cell tryptase.
- Both receptors may also be activated by the peptides that correspond to their new N- termini, independent of receptor cleavage.
- a peptide with the sequence SLIGRL (SEQ ID NO:32), known to be a mouse PAR-2 activating peptide, is equipotent in the activation of the human receptor.
- the TR functions are well documented, the biology of the PAR-2 system has not yet been fully identified.
- a role for PAR-2 activation in the inhibition of keratinocyte growth and differentiation has been recently described (Derian et al., Cell Growth Different., 8:743-749 [1997]).
- the present invention provides cosmetic and/or pharmaceutical compounds for improving the appearance of skin.
- the compounds comprise at least one peptide or polypeptide within at least one scaffold, the peptide or polypeptide being expressed in the scaffold.
- the at least one peptide or polypeptide is a loop. In other particularly preferred embodiments, the loop is closed by a disulfide bond.
- the polypeptide or peptide binds to VEGF. In alternative embodiments, the binding of the polypeptide or peptide to VEGF blocks the downstream activity of VEGF.
- the peptide is expressed in a protease-resistant scaffold.
- the scaffold comprises a protease inhibitor (e.g., BBI, STI, or EgHn chymotrypsin inhibitor). In some most preferred embodiments, the protease inhibitor is BBI.
- the compounds further comprise at least one peptide.
- the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 1-7, 16, and 17.
- the peptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 14).
- the compounds comprise an amino acid sequence selected from the group consisting of SEQ ID NOS:22-24.
- the compounds comprise SEQ ID NO:22.
- the peptide has a conserved binding sequence, the sequence being XXLWPXWC (SEQ ID NO: 15).
- the compounds have a sequence, the sequence being at least 70%, preferably 80%, more preferably 90%, and most preferably 95% identical to the sequences set forth herein.
- the peptide molecular weight is preferably between 500 Daltons and 45,000 Daltons, more preferably between 1000 Daltons and 12,000 Daltons, and most preferably from 1500 Daltons to 10,000 Daltons.
- the compounds comprise at least one polypeptide.
- the composition may be in the form of an emulsified vehicle, such as a nutrient cream or lotion, a stabilized gel or dispersion system, a treatment serum, a liposomal delivery system, a topical pack or mask, a surfactant- based cleansing system such as a shampoo or body wash, an aerosolized or sprayed dispersion or emulsion, a hair or skin conditioner, styling aid, or a pigmented product such as makeup, as well as other suitable make-up and cosmetic preparations.
- the carrier is preferably at least one selected from the group consisting of water, propylene glycol, ethanol, propanol, glycerol, butylene glycol and polyethylene glycol.
- the present invention provides cosmetic and/or pharmaceutical compounds comprising at least one polypeptide or a peptide suitable for modulating hair growth.
- the compounds comprise at least one polypeptide.
- modulation comprises treatment of at least one disease or condition that involves loss of hair.
- the disease or condition is at least one selected from the group consisting of inflammatory alopecias, pseudopelade, scleroderma, tick bites, lichen planus, psoriasis, lupus, seborrheic dermatitis, loose hair syndrome, hemochromatosis, androgenic alopecia, alopecia areata, cancer, conditions that affect defective hair fiber production, and environmental factors that affect hair production.
- the disease is androgenic alopecia or alopecia areata.
- the present invention provides means for decreasing VEGF activity and/or levels.
- the VEGF activity and/or levels are decreased in the epidermis.
- the method comprising applying an effective amount of at least one of the compounds described herein to an organism in need thereof.
- BBI represents a class of protein scaffolds whose binding to proteases is mediated by an exposed native loop that is fixed in a characteristic canonical conformation and which fits into the active site in a manner thought to be similar to that of a substrate (Laskowski and Kato, Ann. Rev. Biochem., 49:593-626 [1980]; and Bode & Huber, supra).
- the native loop is frequently constrained by the presence of disulfide bridges and/or extensive hydrogen-bonding networks that act to lock the structure into the correct canonical structure.
- the sequence of this loop determines the specificity of the inhibition, which mirrors the specificity of proteases for their substrates. For example, most trypsin inhibitors have Arg or Lys as their Pl residue.
- Inhibitors of the BBI family have a network of conserved disulfide bridges that help form a symmetrical structure of two tricyclic domains (Chen et al., supra; Werner and Wemmer, supra; and Liu et ah, supra), each containing an independent serine protease binding site.
- the native binding loop is contained within a region joined by disulfide bridges formed between cysteine residues.
- the identity of the amino acid residue at the Pl site on each domain is the main determinant of the serine protease inhibited.
- Native domains possess lysine or arginine for trypsin, leucine or tyrosine for chymotrypsin and alanine for elastase (Tsunogae et al., J. Biochem. (Tokyo) 100:243-246 [1986]).
- serine is highly conserved at the P'l position and proline at the P'3 position.
- the individual native loop regions of BBI are well suited for protein loop grafting of previously identified cysteine constrained peptides that bind to targets selectively, as described herein.
- isoforms of BBI have been characterized.
- sequence DDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVDITDFCYE PCKPSEDDKEN (SEQ ID NO:25) provides the amino acid sequence of a BBI backbone described herein.
- BBI is truncated with as many as 10 amino acid residues being removed from either the N- or C- terminal. Any of the isoforms described herein, as well as those additional ones known in the art, find use as scaffolds in the present invention.
- the present invention provides several advantages over creation of, for example, chimeric proteins. Transfer of an entire protein can be difficult when, for example, a protein domain of interest carries more than one important biological activity. Maintaining one activity ⁇ e.g. functionally significant domain- domain interactions) while altering another (e.g. high affinity binding to a co-factor or receptor) can be problematic.
- the present invention overcomes that limitation, as in preferred embodiments the loops are transferred, instead of entire domains.
- the compounds of the present invention comprise at least one mutation in addition to those set out above.
- Other mutations such as deletions, insertions, substitutions, transversions, transitions and inversions, at one or more other locations, also find use in the present invention.
- the compounds of the present invention also comprise a conservative substitution that may occur as a like-for-like substitution ⁇ e.g., basic for basic, acidic for acidic, polar for polar etc.).
- non-conservative substitutions are provided ⁇ i.e., from one class of residue to another or alternatively involving the inclusion of unnatural amino acids such as ornithine, diaminobutyric acid ornithine, norleucine ornithine, pyriylalanine, thienylalanine, naphthylalanine and phenylglycine).
- the sequences also have deletions, insertions and/ ⁇ r substitutions of amino acid residues that produce a silent change and result in a functionally equivalent substance.
- deliberate amino acid substitutions are made on the basis of similarity in amino acid properties (e.g., polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues) and it is therefore useful to group amino acids together in functional groups.
- Amino acids can be grouped together based on the properties of their side chain alone. However it is more useful to include mutation data as well. The sets of amino acids thus derived are likely to be conserved for structural reasons.
- variant amino acid sequences of the present invention also include suitable spacer groups inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or ⁇ -alanine residues.
- suitable spacer groups inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or ⁇ -alanine residues.
- homology comparisons find use in identifying homologous sequences that find use in the present invention.
- Homology comparisons can be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. Available computer programs can calculate the percent homology between two or more sequences. Additionally, percent homology may be calculated over contiguous sequences (Le., one sequence is aligned with the other sequence and each amino acid in one sequence is directly compared with the corresponding amino acid in the other sequence one residue at a time). This is called an "ungapped" alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
- GCG Wisconsin Bestfit package the default gap penalty for amino acid sequences is -12 for a gap and -4 for each extension.
- Examples of other software packages than can perform sequence comparisons include, but are not limited to, the BLAST package FASTA, and the GENEWORKS suite of comparison tools, all of which are well-known to those in the art. Both BLAST and FASTA are available for offline and online searching. However, for some applications, it is preferred to use the GCG Bestfit program.
- the BLAST 2 Sequence package is also available for comparing protein and nucleotide sequences.
- the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pair-wise comparison based on chemical similarity or evolutionary distance.
- a scaled similarity score matrix is generally used that assigns scores to each pair-wise comparison based on chemical similarity or evolutionary distance.
- An example of such a matrix commonly used is the BLOSUM62 matrix - the default matrix for the BLAST suite of programs.
- GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table if supplied. For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
- the software Once the software has produced an optimal alignment, it is possible to calculate the percent of homology, and more preferably, the percent of sequence identity.
- the software typically does this as part of the sequence comparison and generates a numerical result.
- the present invention provides nucleotide sequences and methods for using nucleotide sequences that are complementary to the sequences presented herein, as well as derivatives and/or fragments of these sequences.
- sequences that are provided that are complementary to the compound or sequences that are capable of hybridizing to the nucleotide sequences of the compounds include complementary sequences of those presented herein, as well as nucleotide sequences that are complementary to sequences that can hybridize to the nucleotide sequences of the compounds (including complementary sequences of those presented herein).
- the present invention provides vectors comprising the compound, cells comprising the compound, and methods of expressing the compound.
- the nucleotide sequences used in the methods and compositions described herein are incorporated into a recombinant replicable vector.
- the vector is used to replicate and express the nucleotide sequence, in enzyme form, in and/or from a compatible host cell.
- expression is controlled using control sequences (e.g., regulatory sequences).
- proteins produced by a host cell by expression of the nucleotide sequence are secreted (i.e., into the growth medium), while in other embodiments, the proteins are contained intracellularly within the host cell.
- compounds and their polynucleotides are expressed by introducing a polynucleotide into a replicable vector, introducing the vector into a compatible host cell, and growing the host cell under conditions which bring about replication of the vector.
- the vector is recovered from the host cell.
- the compound is expressed at the desired levels in a host organism using an expression vector.
- an expression vector comprising a compound nucleic acid that is capable of expressing the gene encoding the compound nucleic acid in the selected host organism will find use in the present invention.
- the choice of vector depends upon the host cell into which it is to be introduced.
- the vector is an autonomously replicating vector (i.e., a vector that exists as an episomal entity, the replication of which is independent of chromosomal replication, such as, for example, a plasmid, a bacteriophage or an episomal element, a minichromosome or an artificial chromosome).
- the vector integrates into the host cell genome and replicates together with the chromosome.
- the expression vector includes the components of a cloning vector, including but not limited to such components as an element that permits autonomous replication of the vector in the selected host organism and one or more phenotypically detectable markers for selection purposes.
- the expression vector further comprises control nucleotide sequences encoding a promoter, operator, ribosome binding site, translation initiation signal, and optionally, a repressor gene or one or more activator genes.
- the expression vector comprises a sequence coding for an amino acid sequence capable of targeting the compound to a host cell organelle such as a peroxisome or to a particular host cell compartment.
- a targeting sequence includes but is not limited to the sequence SKL.
- the nucleic acid sequence encoding the compound is operably linked to the control sequences in proper manner with respect to expression.
- the polynucleotide in a vector is operably linked to a control sequence that is capable of providing for the expression of the coding sequence by the host cell (Le., the vector is an expression vector).
- the control sequences are modified (e.g., by the addition of further transcriptional regulatory elements) in order to make the level of transcription directed by the control sequences more responsive to transcriptional modulators.
- the control sequences comprise promoters.
- the nucleic acid sequence encoding for the compound is operably combined with a suitable promoter sequence.
- the promoter can be any DNA sequence having transcription activity in the host organism of choice and can be derived from genes that are homologous or heterologous to the host organism.
- tubigensis A. awamori and Aspergillus nidulans.
- strains of Fusarium species ⁇ e.g. F. oxysporum) and Rhizomucor ⁇ e.g., Rhizomucor miehei) find used as the host organism. Additional suitable strains include, but are not limited to Thermomyces and Mucor species.
- host cells comprising polynucleotides are used to express polypeptides, such as the compounds disclosed herein, fragments, homologues, variants or derivatives thereof. Host cells are cultured under suitable conditions which allow expression of the proteins.
- polypeptides are constitutive (i.e., the peptides are continually produced), while in other embodiments, expression is inducible.
- inducible expression protein production' is initiated when required by addition of an inducer substance to the culture medium ⁇ e.g., dexamethasone or EPTG).
- Polypeptides can be extracted from host cells by a variety of techniques known in the art, including enzymatic, chemical, and/or osmotic lysis and physical disruption. Indeed, it is not intended that the present • invention be limited to any particular means of harvesting expressed polypeptides.
- polypeptides are produced recombinantly in any suitable (including commercially available) in vitro cell-free system, such as the TnTTM (Promega) rabbit reticulocyte system.
- the present invention provides cosmetic and/or pharmaceutical compositions comprising at least one polypeptide or peptide, as set forth herein, and a physiologically acceptable carrier or excipient.
- the compound is present in an amount of about 0.0001% to about 5% by weight, based on the total weight of the composition.
- the compound is present in an amount of about 0.001% to about 0.5% by weight based on the total weight of the composition.
- the composition may be in the form of an emulsified vehicle, such as a nutrient cream or lotion, a stabilized gel or dispersion system, a treatment serum, a liposomal delivery system, a topical pack or mask, a surfactant- based cleansing system such as a shampoo or body wash, an aerosolized or sprayed dispersion or emulsion, a hair or skin conditioner, styling aid, or a pigmented product such as makeup.
- the carrier is at least compound selected from the group consisting of water, propylene glycol, ethanol, propanol, glycerol, butylene glycol and polyethylene glycol.
- Preferred liposomes include, without limitation: a) lipoid liposome 0003 (composed of water and lecithin and glycerin); b) lipoid liposome 0300 (composed of water and phosphatidylcholine); c) lipoid liposome 0111 (composed of water, Ginkgo biloba leaf extract, denatured alcohol, hydrogenated lecithin and cholesterol); d) anti-irritant liposomes (composed of water, cola acuminata seed extract, bisabolol and phospholipids); e) vitamin C and E liposomes (composed of water, phospholipids, tocopheryl acetate and ascorbyl palmitate); f) firming liposomes (composed of water, butylene glycol, pyrus malus (Apple) fruit extract, phospholipids, tocopheryl acetate and carbomer); and g) moisturizing liposomes (composed of water, sodium PCA, to
- the personal care compositions herein comprise a skin care active ingredient at a level from about 0.0001% to about 20%, by weight of the composition.
- the personal care compositions comprise a skin care active ingredient from about 0.001% to about 5%, by weight of the composition.
- the personal care compositions comprise a skin care active ingredient from about 0.01% to about 2%, by weight of the composition.
- Non-limiting examples of functional or active ingredients that can be delivered via liposomes include: vitamins and their derivatives, antioxidants, proteins and peptides, keratolytic agents, bioflavinoids, terpenoids, phytochemicals, and extracts of plant, marine or fermented origin.
- the composition further comprises a skin care or hair care active.
- Active ingredients can include any of a wide variety of ingredients such as are known in the art. (See e.g., McCutcheon's Functional Materials, North American and International Editions, (2003), published by MC Publishing Co.).
- such actives include but are not limited to antioxidants, such as tocopheryl and ascorbyl derivatives, bioflavinoids, terpenoids, synthetics and the like, vitamins and vitamin derivatives, hydroxyl- and polyhydroxy acids and their derivatives, such as AHAs and BHAs and their reaction products, peptides and polypeptides and their derivatives, such as glycopeptides and lipophilized peptides, heat shock proteins and cytokines, enzymes and enzymes inhibitors and their derivatives, such as proteases, MMP inhibitors, catalases, glucose oxydase and superoxide dismutase, amino acids and their derivatives, bacterial, fungal and yeast fermentation products and their derivatives, including mushrooms, algae and seaweed and their derivatives, phytosterols and plant and plant part extracts and their derivatives and phospholipids and their derivatives, anti-dandruff agents such as zinc pyrithione and delivery systems containing them, as provided herein and/or known in the art.
- antioxidants such
- the skin care active is selected from the group consisting of a Vitamin B3 component, panthenol, Vitamin E, Vitamin E acetate, retinol, retinyl propionate, retinyl palmitate, retinoic acid, Vitamin C, theobromine, alpha-hydroxyacid, farnesol, phytrantriol, salicylic acid, palmityl peptapeptide-3 and mixtures thereof.
- the Vitamin B3 component is niacinamide.
- the compositions provided herein comprise a skin care active at a level from about 0.0001% to about 20%, preferably from about 0.001% to about 5%, more preferably from about 0.01% to about 2%, by.weight.
- Exemplary derivatives of the foregoing vitamin B 3 compounds include nicotinic acid esters, including non-vasodilating esters of nicotinic acid, nicotinyl amino acids, nicotinyl alcohol esters of carboxylic acids, nicotinic acid N-oxide and niacinamide N-oxide.
- Suitable esters of nicotinic acid include nicotinic acid esters of CJ-C22, preferably C ⁇ -C j g, more preferably C ⁇ -Cg alcohols.
- the alcohols are suitably straight-chain or branched chain, cyclic or acyclic, saturated or unsaturated (including aromatic), and substituted or unsubstituted.
- the esters are preferably non-vasodilating.
- Non-vasodilating esters of nicotinic acid include tocopherol nicotinate and inositol hexanicotinate; tocopherol nicotinate are preferred.
- vitamin B3 compounds include niacinamide and tocopherol nicotinate.
- the skin care active comprises at least one retinoid.
- the retinoid is preferably retinol, retinol esters (e.g., C2 - C22 alkyl esters of retinol, including retinyl palmitate, retinyl acetate, retinyl proprionate), retinal, and/or retinoic acid (including all-trans retinoic acid and/or 13-cis- retinoic acid), more preferably retinoids other than retinoic acid.
- retinoid is preferably retinol, retinol esters (e.g., C2 - C22 alkyl esters of retinol, including retinyl palmitate, retinyl acetate, retinyl proprionate), retinal, and/or retinoic acid (including all-trans retinoic acid and/or 13-cis- retinoic acid), more preferably retinoids other than
- the emulsion may be or comprise (e.g., in a triple or other multi-phase emulsion) an oil-in-water emulsion or a water-in-oil emulsion such as a water-in-silicone emulsion.
- polyhydric alcohols of the present invention are selected from glycerine, butylene glycol, propylene glycol, pentylene glycol, hexylene glycol, dipropylene glycol, polyethylene glycol, hexane triol, ethoxylated glycerine and propoxylated glycerine and mixtures thereof.
- the hydrophilic surfactants useful herein alternatively or additionally include any of a wide variety of cationic, anionic, zwitterionic, and amphoteric surfactants such as are known in the art (See, e.g., McCutcheon's. Emulsifiers and Detergents, North American and International Editions, MC Publishing Co. [2003]; U.S. Patent No. 5,011,681 U.S. Patent No. 4,421,769; and U.S. Patent No. 3,755,560).
- anionic surfactants are also useful herein (See e.g., U.S. Patent No. 3,929,678).
- Preferred polymer thickening agents for use herein include, but are not limited to non-ionic thickening agents and anionic thickening agents or mixtures thereof.
- Suitable non-ionic thickening agents include, but are not limited to polyacrylamide polymers, crosslinked poly(N-vinylpyrrolidones), polysaccharides, natural or synthetic gums, polyvinylpyrrolidone and polyvinylalcohol.
- Suitable anionic thickening agents include, but are not limited to acrylic acid/ethyl acrylate copolymers, carboxyvinyl polymers and crosslinked copolymers of alkyl vinyl ethers and maleic anhydride.
- a carrier which is a silicone fluid, the carrier having a viscosity from about 0.65 mm ⁇ s " ! to about 100 mm ⁇ s'l, wherein the ratio of i) to ii) is from about 10:90 to about 20:80 and wherein said silicone gum-based component has a final viscosity of from about 100 mm ⁇ s " ! to about 100,000 mm ⁇ s'l, preferably from 500 mmV 1 to about 10,000 mmV 1 .
- silicone components suitable for use in a silicone oil phase herein include crossli ⁇ ked polyorganosiloxane polymers, optionally dispersed in a fluid carrier.
- crosslmked polyorganosiloxane polymers together with its carrier (if present) comprises from about 0.1% to about 20%, preferably from about 0.5% to about 10%, and more preferably from about 0.5% to about 5% of the composition.
- Such polymers comprise polyorganosiloxane polymers crosslinked by a crosslinking agent (See e.g., WO98/22085).
- compositions of the present invention comprise an organic sunscreen.
- suitable sunscreens have UVA absorbing properties, while others have UVB absorbing properties, and still others comprise a mixture thereof.
- the exact amount of the sunscreen active varies, depending upon the desired Sun Protection Factor (i.e., the "SPF") of the composition, as well as the desired level of UV protection.
- SPF is a commonly used measure of photoprotection of a sunscreen against erythema.
- the SPF is defined as a ratio of the ultraviolet energy required to produce minimal erythema on protected skin to that required to produce the same minimal erythema on unprotected skin in the same individual.
- Amounts of the sunscreen used are preferably from about 2% to about 20%, and more preferably from about 4% to about 14%.
- Suitable sunscreens include, but are not limited to those approved for use in the United States, Japan, Europe and Australia.
- the compositions of the present invention preferably comprise an SPF of about 2 to about 30, preferably about 4 about 30, and more preferably about 4 to about 15.
- compositions of the present invention comprise one or more UVA absorbing sunscreen actives that absorb UV radiation having a wavelength of from about 320nm to about 400nm.
- Suitable UVA absorbing sunscreen actives include, but are not limited to dibenzoylmethane ⁇ See e.g., Lowe and Shaath (eds.), Sunscreens: Development, Evaluation, and Regulatory Aspects, Marcel Dekker, Inc.) derivatives, anthranilate derivatives such as methylanthranilate and homomethyl, 1-N- acetylanthranilate, and mixtures thereof.
- Preferred dibenzoyl sunscreen actives include those selected from 4-(l, l-dimethylethyl)-4' -methoxydibenzoylmethane, 4- isopropyldibenzoylmethane, and mixtures thereof.
- a preferred sunscreen active is 4-(l, l-dimethylethyl)-4'- methoxy dibenzoylmethane.
- the sunscreen active 4-(l, l-dimethylethyl)-4'-methoxydibenzoylmethane,.which is also known as butyl methoxydibenzoylmethane or "avobenzone," is commercially available under the names of Parsol® 1789 from Givaudan Roure (International) S.
- compositions of the present invention further include one or more UVB sunscreen actives that absorb(s) UV radiation having a wavelength of about 290nm to about 320nm.
- the compositions comprise an amount of the UVB sunscreen active that is safe and effective in providing UVB protection either independently, or in combination with, other UV protective actives which may be present in the compositions.
- the compositions comprise from about 0.1% to about 20%, preferably from about 0.1% to about 12%, and more preferably from about 0.5% to about 8% by weight, of each UVB absorbing organic sunscreen, or as mandated by the relevant regulatory authority(s).
- Preferred organic sunscreen actives include 2-ethylhexyl-2- cyano-3, 3-diphenylacrylate, 2-phenyl-benzimidazole-5-sulphonic acid (PBSA), octyl-p-methoxycinnamate, and mixtures thereof. Salt and acid neutralized forms of the acidic sunscreens are also useful herein.
- At least one agent is added to any of the compositions useful in the present invention to stabilize the UVA sunscreen to prevent it from photo-degrading on exposure to UV radiation and thereby maintaining its UVA protection efficacy.
- a wide range of compounds are reported to have these stabilizing properties and should be chosen to complement both the UVA sunscreen and the composition as a whole ⁇ See e.g., U.S. Pat. Nos 5,972,316; 5,968,485; 5,935,556; 5,827,508; and WO 00/06110).
- compositions of the present invention additionally comprise inorganic physical sunblocks ⁇ See e.g., TFA International Cosmetic Ingredient Dictionary, 6 th Edition, pp. 1026-28 and 1103 [1995]; Sayre et al, J. Soc. Cosmet. Chem., 41:103-109 [1990]; and Lowe et al., supra).
- Preferred inorganic physical sunblocks include zinc oxide and titanium dioxide and mixtures thereof.
- the physical sunblocks are present in an amount such that the present compositions are transparent on the skin ⁇ i.e., non-whitening), preferably from about 0.5% to about 20%, preferably from about 0.5% to about 10%, and more preferably from about 0.5% to 5% by weight.
- titanium dioxide When used in preferred embodiments, titanium dioxide is used, it can have an anatase, rutile or amorphous structure.
- Manufacturers of micronized grade titanium dioxide and zinc oxide for sunscreen use include, but are not limited to Tayca Corporation, Uniqema, Shinetsu Chemical Corporation, Kerr-McGee, Nanophase, Nanosource, Sachtleben, Elementis, and BASF Corporation, as well as their distribution agents and those companies that further process the material for sunscreen use.
- the composition of the present invention also includes preservatives.
- preservatives include, but are not limited to pentylene glycol, ethylene diamine tetra acetate (EDTA) and their salts, chlorhexidine (and its diacetate, dihydrochloride, digluconate derivatives), 1,1,1 -trichloro-2-methyl-2-propanol, parachloro metaxylenol, polyhexamethylenebiguanide hydrochloride, dehydroacetic.acid, diazolidinyl urea, 2,4-dichlorobenzyl alcohol, 4,4-dimethyl-l,3-oxazolidine, formaldehyde (e.g., 37% aqueous solution, with 10-15% methanol to avoid polymerization), glutaraldehyde, dimethylidantoin, imidazolidinyl urea, 5-Chloro-2 ⁇ methyl-4-isothiazolin-3-one, ortho-pheny
- a variety of optional ingredients such as neutralizing agents, perfumes and perfume solubilizing agents, and coloring agents, also find use in some of the compositions herein. It is preferred that any additional ingredients enhance the skin softness/smoothness benefits of the product. In addition it is preferred that any such ingredients do not negatively impact the aesthetic properties of the product.
- TCC/TCS also known as triclosan and trichlorocarbon; perfumes and perfume solubilizers.
- alpha hydroxy acids include glycolic acid, lactic acid, malic acid, citric acid, glycolic acid in conjunction with ammonium glycolate, alpha-hydroxy ethanoic acid, alpha-hydroxyoctanoic acid, alpha-hydroxycaprylic acid, hydroxycaprylic acid, mixed fruit acid, tri-alpha hydroxy fruit acids, triple fruit acid, sugar cane extract, alpha hydroxy and botanicals, 1-alpha hydroxy acid and gly comer in crosslinked fatty acids (e.g., alpha nutrium).
- Preferred examples of alpha hydroxy acids are glycolic acid and lactic acid.
- alpha hydroxy acids are used in levels of up to about 10%. It is not intended that the present invention be limited to any particular compound derived from any particular source, as any suitable additive compound, whether obtained from natural sources or through synthesis in the laboratory find use in the present invention.
- optional materials include water-soluble or solubilizable preservatives preferably at a level of from about 0.1% to about 5% each, such as Germall 115, methyl, ethyl, propyl and butyl esters of hydroxybenzoic acid, benzyl alcohol, DMDM hydantoin iodopropanyl butylcarbanate available under the trade name Glydant Plus from Lonza, EDTA, Euxyl (RTM) K400, Bromopol (2-bromo-2-nitropropane-l,3- diol), pentylene glycol and phenoxypropanol; anti-bacterials such as Irgasan (RTM) and phenoxyethanol (preferably at levels of from 0.1% to about 5%).
- Antibacterial agents such as TCC/TCS, also known as triclosan and trichlorocarbon are also useful in compositions of the present invention.
- Neutralizing agents suitable for use in neutralizing acidic group containing hydrophilic gelling agents herein include sodium hydroxide, potassium hydroxide, ammonium hydroxide, monoethanolarnine, diethanolamine, amino methyl propanol, tris-buffer and triethanolamine.
- non-limiting examples include keratolytic agents; soluble or colloidally-soluble moisturizing agents such as hyaluronic acid and chondroitin sulfate; vitamins such as vitamin A, vitamin C, vitamin E, vitamin K and derivatives thereof and building blocks thereof; phytantriol; fatty alcohols such as dodecatrienol; alpha and beta hydroxyacids; aloe vera; sphingosines and phytosphingosines, cholesterol; skin whitening agents; N- acetyl cysteine; coloring agents;
- alpha hydroxy acids include glycolic acid, lactic acid, malic acid, and citric acid (whether derived synthetically or from natural sources and whether used alone or in combination) and their esters or relevant buffered combinations
- alpha-hydroxy acids include: alpha-hydroxy ethanoic acid, alpha-hydroxyoctanoic acid, alpha-hydroxycaprylic acid, and hydroxycaprylic acid.
- Preferred examples of alpha hydroxy acids include glycolic acid and lactic acid. It is preferred that alpha hydroxy acids are used in levels of up to about 10%.
- Optional materials include pigments that, where water-insoluble, contribute to and are included in the total level of oil phase ingredients.
- Pigments suitable for use in the compositions of the present invention can be organic and/or inorganic. Also included within the term “pigment” are materials having a low color or luster, such as matte finishing agents, light scattering agents, and formulation aids such as micas, seracites, and carbonate salts.
- Further examples of suitable pigments include titanium dioxide, iron oxides, glutamate iron oxides, zinc oxide, bismuth oxychloride, ultramarine blue(all of which may be either pre-dispersed and/or pre-coated or not) D&C dyes and lakes, FD&C colors, natural color additives such as carmine, and mixtures thereof.
- pigments are usually used in preferred embodiments of the present invention.
- Preferred pigments for use herein from the viewpoint of moisturization, skin feel, skin appearance and emulsion compatibility are treated pigments.
- the pigments are treated with compounds, including but not limited to amino acids, silicones, lecithin and ester oils.
- the pH of the compositions herein is in the range from about 3.5 to about
- pH of the final composition is adjusted by addition of acidic, basic or buffer salts as necessary, depending upon the composition of the forms and the pH-requirements of the compounds.
- compositions of the present invention are prepared by standard techniques well known to those skilled in the art.
- the aqueous phase and/or the oil phase are prepared separately, with materials of similar phase partitioning being added in any order. If the final product is an emulsion, the two phases are then combined with vigorous stirring and/or homogenization as necessary, to reduce the size of the internal phase droplets. Any ingredients in the formulation with high volatility, or which are susceptible to hydrolysis or decomposition at high temperatures, are added with gentle stirring towards the end of the process, post emulsification if applicable. Dosage frequency and amount will depend upon the desired performance criteria.
- method of decreasing VEGF activity comprise applying to an organism in need thereof an effective amount of any one of the compounds set forth herein.
- the present invention provides compounds for treatment of an organism in need thereof, including humans and other animals.
- DPBS Dulbecco's phosphate buffered solution
- SOC 2% Bacto-Tryptone, 0.5% Bacto Yeast Extract, 10 mM NaCl, 2.5 mM KCl); Terrific Broth (TB; 12 g/1 Bacto Tryptone, 24 g/1 glycerol, 2.31 g/1 KH 2 PO 4 , and 12.54 g/1 K 2 HPO 4 ); OD 28O (optical density at 280 nm); OD 6 oo (optical density at 600 nm); PAGE (polyacrylamide gel electrophoresis); PBS (phosphate buffered saline [150 mM NaCl, 10 mM sodium phosphate buffer, pH 7.2]); PBST
- compositions comprising any of the compounds of the present invention are provided as follows.
- the amounts are given as percentages of the total composition, unless otherwise indicated.
- the concentration of BBI-AV (referred to as "Compound” below) ranges from about 0.01% to about 1.0%.
- the preferred concentration is in the range of about 0.1% to about 0.2%, while in other formulations, the preferred concentration is in the range of about 0.05% to about 0.1% (e.g., for some hair growth inhibition embodiments); from about 0.02 to 0.1% (e.g., for some skin lightening embodiments); from about 0.5% to about 1.0% (e.g., for some skin lightening embodiments); or at concentrations greater than about 0.1% (e.g., for some rosacea treating embodiments).
- Those of skill in the art know how to determine the suitable (i.e., optimum) concentration of BBI-AV for each product.
- MOISTURIZING BODYWASH pH 7
- Triethanolamine Care Triethanolamine Production Mix the components of Phase A. Dissolve Phase B and stir it into Phase A whilst homogenizing. Neutralize with Phase C and homogenize again.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Dermatology (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Birds (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Cosmetics (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2006246425A AU2006246425B2 (en) | 2003-11-06 | 2006-04-25 | Personal care compositions and methods for their use |
| CA2607142A CA2607142C (en) | 2005-05-05 | 2006-04-25 | Personal care compositions and methods for their use |
| US11/919,717 US9084734B2 (en) | 2005-05-05 | 2006-04-25 | Peptide personal care compositions and methods for their use |
| BRPI0613548-0A BRPI0613548A2 (pt) | 2005-05-05 | 2006-04-25 | composições de cuidado pessoal e métodos para seu uso |
| JP2008510044A JP5348749B2 (ja) | 2005-05-05 | 2006-04-25 | パーソナルケア組成物及びそれらの使用方法 |
| EP06751417A EP1880007A2 (en) | 2005-05-05 | 2006-04-25 | Personal care compositions and methods for their use |
| CN2006800151170A CN101278051B (zh) | 2005-05-05 | 2006-04-25 | 个人护理组合物及其使用方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US67860105P | 2005-05-05 | 2005-05-05 | |
| US60/678,601 | 2005-05-05 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2006121610A2 true WO2006121610A2 (en) | 2006-11-16 |
| WO2006121610A3 WO2006121610A3 (en) | 2007-01-25 |
Family
ID=37397053
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2006/015711 Ceased WO2006121610A2 (en) | 2003-11-06 | 2006-04-25 | Personal care compositions and methods for their use |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US9084734B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP1880007A2 (cg-RX-API-DMAC7.html) |
| JP (1) | JP5348749B2 (cg-RX-API-DMAC7.html) |
| CN (1) | CN101278051B (cg-RX-API-DMAC7.html) |
| AU (1) | AU2006246425B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BRPI0613548A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2607142C (cg-RX-API-DMAC7.html) |
| WO (1) | WO2006121610A2 (cg-RX-API-DMAC7.html) |
Cited By (38)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2007085846A1 (en) * | 2006-01-27 | 2007-08-02 | Reckitt Benckiser (Uk) Limited | Use of a vegf binding peptide to retard hair growth |
| NL1033954C2 (nl) * | 2007-06-08 | 2008-12-09 | Otc Pharma Internat B V | Samenstelling voor scheren. |
| DE102007041735A1 (de) | 2007-09-04 | 2009-03-05 | Egon Tech | Aminosäure-Mineral-Peptid-Komplex, insbesondere quanten-mechanisch modifiziert, als Rezeptur zur Regulierung der Haut |
| WO2010044786A1 (en) | 2008-10-15 | 2010-04-22 | Danisco Us Inc., Genencor Division | Modified variant bowman birk protease inhibitors |
| WO2009063158A3 (en) * | 2007-11-14 | 2010-07-15 | Reckitt & Colman (Overseas) Limited | Personal care article |
| US7772181B2 (en) | 2008-10-15 | 2010-08-10 | Danisco Us Inc. | Personal care compositions comprising modified variant Bowman Birk Protease Inhibitors |
| US7803902B2 (en) | 2008-10-15 | 2010-09-28 | Danisco Us Inc. | Modified variant bowman birk protease inhibitors |
| JP2010540921A (ja) * | 2007-09-27 | 2010-12-24 | フンダシオン レイナ メルセデス パラ ラ インベスティガシオン サニタリア | ヒトgstt1に対する抗体(抗−hgstt1)の検出のための免疫学的分析方法 |
| US8114385B2 (en) | 2003-08-04 | 2012-02-14 | Foamix Ltd. | Oleaginous pharmaceutical and cosmetic foam |
| US8119109B2 (en) | 2002-10-25 | 2012-02-21 | Foamix Ltd. | Foamable compositions, kits and methods for hyperhidrosis |
| US8119106B2 (en) | 2003-04-28 | 2012-02-21 | Foamix Ltd | Foamable iodine compositions |
| US8119150B2 (en) | 2002-10-25 | 2012-02-21 | Foamix Ltd. | Non-flammable insecticide composition and uses thereof |
| US8343945B2 (en) | 2007-12-07 | 2013-01-01 | Foamix Ltd. | Carriers, formulations, methods for formulating unstable active agents for external application and uses thereof |
| US20130023480A1 (en) * | 2009-12-30 | 2013-01-24 | Solae, Llc | Purified Bowman-Birk Protease Inhibitor Proteins Isolated from a Soy Processing Sttream |
| US8486376B2 (en) | 2002-10-25 | 2013-07-16 | Foamix Ltd. | Moisturizing foam containing lanolin |
| US8795693B2 (en) | 2003-08-04 | 2014-08-05 | Foamix Ltd. | Compositions with modulating agents |
| US20150190318A1 (en) * | 2012-07-26 | 2015-07-09 | Solae, Llc | Emulsifying agent for use in personal care products and industrial products |
| US20150238403A1 (en) * | 2014-02-21 | 2015-08-27 | Amorepacific Corporation | Low viscous cosmetic composition using a natural emulsifying agent |
| US9211259B2 (en) | 2002-11-29 | 2015-12-15 | Foamix Pharmaceuticals Ltd. | Antibiotic kit and composition and uses thereof |
| US9320705B2 (en) | 2002-10-25 | 2016-04-26 | Foamix Pharmaceuticals Ltd. | Sensation modifying topical composition foam |
| US9622947B2 (en) | 2002-10-25 | 2017-04-18 | Foamix Pharmaceuticals Ltd. | Foamable composition combining a polar solvent and a hydrophobic carrier |
| US9636405B2 (en) | 2003-08-04 | 2017-05-02 | Foamix Pharmaceuticals Ltd. | Foamable vehicle and pharmaceutical compositions thereof |
| US9662298B2 (en) | 2007-08-07 | 2017-05-30 | Foamix Pharmaceuticals Ltd. | Wax foamable vehicle and pharmaceutical compositions thereof |
| US9668972B2 (en) | 2002-10-25 | 2017-06-06 | Foamix Pharmaceuticals Ltd. | Nonsteroidal immunomodulating kit and composition and uses thereof |
| US9675700B2 (en) | 2009-10-02 | 2017-06-13 | Foamix Pharmaceuticals Ltd. | Topical tetracycline compositions |
| US9682021B2 (en) | 2006-11-14 | 2017-06-20 | Foamix Pharmaceuticals Ltd. | Substantially non-aqueous foamable petrolatum based pharmaceutical and cosmetic compositions and their uses |
| US9713643B2 (en) | 2002-10-25 | 2017-07-25 | Foamix Pharmaceuticals Ltd. | Foamable carriers |
| WO2017172955A1 (en) * | 2016-03-29 | 2017-10-05 | Safewhite, Inc. | Polyelectrolyte dental adhesives for whitening teeth and teeth components |
| US9849142B2 (en) | 2009-10-02 | 2017-12-26 | Foamix Pharmaceuticals Ltd. | Methods for accelerated return of skin integrity and for the treatment of impetigo |
| TWI610687B (zh) * | 2013-11-13 | 2018-01-11 | 愛茉莉太平洋股份有限公司 | 使用天然乳化劑的低黏度化妝品組成物 |
| US9884017B2 (en) | 2009-04-28 | 2018-02-06 | Foamix Pharmaceuticals Ltd. | Foamable vehicles and pharmaceutical compositions comprising aprotic polar solvents and uses thereof |
| US10092588B2 (en) | 2009-07-29 | 2018-10-09 | Foamix Pharmaceuticals Ltd. | Foamable compositions, breakable foams and their uses |
| US10322085B2 (en) | 2002-10-25 | 2019-06-18 | Foamix Pharmaceuticals Ltd. | Dicarboxylic acid foamable vehicle and pharmaceutical compositions thereof |
| US10350166B2 (en) | 2009-07-29 | 2019-07-16 | Foamix Pharmaceuticals Ltd. | Non surface active agent non polymeric agent hydro-alcoholic foamable compositions, breakable foams and their uses |
| US10398641B2 (en) | 2016-09-08 | 2019-09-03 | Foamix Pharmaceuticals Ltd. | Compositions and methods for treating rosacea and acne |
| EP3308836B1 (de) | 2013-07-04 | 2020-09-09 | Beiersdorf AG | Octocrylenfreies, geruchsstabiles sonnenschutzmittel |
| US10786007B2 (en) | 2015-03-27 | 2020-09-29 | Philip Morris Products S.A. | Resealable aerosol-generating article |
| CN116694606A (zh) * | 2023-06-21 | 2023-09-05 | 江南大学 | 一种利用角蛋白酶水解玉米黄粉醇溶蛋白的方法 |
Families Citing this family (48)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8512718B2 (en) | 2000-07-03 | 2013-08-20 | Foamix Ltd. | Pharmaceutical composition for topical application |
| US7700076B2 (en) | 2002-10-25 | 2010-04-20 | Foamix, Ltd. | Penetrating pharmaceutical foam |
| US8900554B2 (en) | 2002-10-25 | 2014-12-02 | Foamix Pharmaceuticals Ltd. | Foamable composition and uses thereof |
| US20080138296A1 (en) | 2002-10-25 | 2008-06-12 | Foamix Ltd. | Foam prepared from nanoemulsions and uses |
| US8486374B2 (en) | 2003-08-04 | 2013-07-16 | Foamix Ltd. | Hydrophilic, non-aqueous pharmaceutical carriers and compositions and uses |
| US9439857B2 (en) | 2007-11-30 | 2016-09-13 | Foamix Pharmaceuticals Ltd. | Foam containing benzoyl peroxide |
| US8518376B2 (en) | 2007-12-07 | 2013-08-27 | Foamix Ltd. | Oil-based foamable carriers and formulations |
| EP2242476A2 (en) | 2008-01-14 | 2010-10-27 | Foamix Ltd. | Poloxamer foamable pharmaceutical compositions with active agents and/or therapeutic cells and uses |
| FR2942133B1 (fr) * | 2009-02-13 | 2012-12-14 | Georgia Pacific France | Article pour le nettoyage de la peau |
| CN102204873B (zh) * | 2011-03-15 | 2014-02-12 | 苏州元素集化学工业有限公司 | 一种稠厚的清洁组合物 |
| US20130172415A1 (en) * | 2011-12-29 | 2013-07-04 | Rubbermaid Commercial Products/Us | Triclosan-free antibacterial soap |
| US20190231657A1 (en) * | 2018-01-26 | 2019-08-01 | Chris Gerlach | Salicylic acid gel |
| US9745543B2 (en) | 2012-09-10 | 2017-08-29 | Ecolab Usa Inc. | Stable liquid manual dishwashing compositions containing enzymes |
| CN104768523B (zh) | 2012-10-29 | 2017-08-15 | 宝洁公司 | 10℃下具有0.30或更大损耗角正切值的个人护理组合物 |
| US9072682B2 (en) | 2012-12-31 | 2015-07-07 | Mylan Inc. | Transdermal dosage form for low-melting point active agent |
| KR101272792B1 (ko) | 2013-03-04 | 2013-06-10 | 주식회사 뉴앤뉴 | 보습성이 우수한 수분크림 |
| KR101481775B1 (ko) | 2013-03-25 | 2015-01-13 | 주식회사 불스원 | 이중층 타입의 샴푸 조성물 |
| US9672952B2 (en) | 2013-08-14 | 2017-06-06 | Industrial Technology Research Institute | Polymer and conductive composition |
| US9265714B2 (en) | 2013-09-26 | 2016-02-23 | Colgate-Palmolive Company | Cleansing composition comprising a cationic and nonionic surfactant mixture |
| WO2015066777A1 (en) * | 2013-11-08 | 2015-05-14 | L'oreal | Cosmetic compositions in the form of oil-in-water nanoemulsions, comprising solid fatty alcohol(s), liquid fatty ester(s), other oil(s) and non-ionic surfactant(s) |
| FR3014886A1 (fr) * | 2013-12-17 | 2015-06-19 | Ifremer | Procede d’extraction de purine |
| NZ720708A (en) * | 2013-12-20 | 2019-01-25 | Pfizer | Pre-moistened wipes for use in treating anal-rectal irritations and disorders |
| CN104237503A (zh) * | 2014-09-01 | 2014-12-24 | 上海师范大学 | 一种线粒体靶向荧光标记磁性纳米材料及其制备方法和应用 |
| WO2016121087A1 (ja) * | 2015-01-30 | 2016-08-04 | 東洋エアゾール工業株式会社 | 温感クリーム組成物形成用エアゾール製品 |
| JP2018513210A (ja) * | 2015-03-25 | 2018-05-24 | ゲーツェーテー ゲーエムベーハー | 化粧品及び化粧品を製造するためのコンセントレート |
| US10130578B2 (en) * | 2015-07-23 | 2018-11-20 | Johnson & Johnson Consumer Inc. | Topical delivery of skin compositions having low pH |
| DE102015225560A1 (de) * | 2015-12-17 | 2017-06-22 | Henkel Ag & Co. Kgaa | Mittel zur temporären Verformung keratinhaltiger Fasern mit Konservierungsmittel IV |
| CN106821786A (zh) * | 2016-02-13 | 2017-06-13 | 顾银凤 | 一种具有防衰老、美白、保湿功效的化妆品 |
| US11246821B2 (en) * | 2016-08-30 | 2022-02-15 | Rohm And Haas Company | Personal care composition |
| CN106910403B (zh) * | 2017-03-29 | 2019-09-13 | 广州迈普再生医学科技股份有限公司 | 血管模型及其制备方法和应用 |
| WO2018237218A1 (en) | 2017-06-23 | 2018-12-27 | The Procter & Gamble Company | COMPOSITION AND METHOD FOR ENHANCING SKIN APPEARANCE |
| EA202091213A1 (ru) * | 2017-11-14 | 2020-08-13 | Юнилевер Н.В. | Пептиды для повышения содержания меланина в меланоцитах |
| EA202091390A1 (ru) | 2017-12-06 | 2020-09-04 | Юнилевер Н.В. | Композиция для потемнения кожи |
| US20190240335A1 (en) * | 2018-02-07 | 2019-08-08 | Promedon S.A. | Biocompatible Hydrogel Compositions |
| KR20210011964A (ko) | 2018-07-03 | 2021-02-02 | 더 프록터 앤드 갬블 캄파니 | 피부 병태를 치료하는 방법 |
| FR3090377B1 (fr) * | 2018-12-20 | 2021-09-10 | Lvmh Rech | Procédé de coloration ou maquillage des sourcils |
| KR102763733B1 (ko) * | 2019-09-16 | 2025-02-07 | (주)아모레퍼시픽 | 가용화된 안료를 포함하는 화장료 조성물 및 이의 제조방법 |
| WO2021094429A1 (en) * | 2019-11-15 | 2021-05-20 | Unilever Ip Holdings B.V. | Deodorant compositions |
| US10959933B1 (en) | 2020-06-01 | 2021-03-30 | The Procter & Gamble Company | Low pH skin care composition and methods of using the same |
| CN115843238B (zh) | 2020-06-01 | 2025-06-10 | 宝洁公司 | 改善维生素b3化合物渗透到皮肤中的方法 |
| CN115996697A (zh) * | 2020-06-30 | 2023-04-21 | 莱雅公司 | 改善渗透的化妆品组合物 |
| US11464727B2 (en) * | 2020-09-29 | 2022-10-11 | Serendipity Technologies Llc | Reduced-cost cosmetic formulations that reduce visible signs of ageing |
| CN113171440A (zh) * | 2021-04-26 | 2021-07-27 | 石家庄喜得宝医疗器械有限公司 | 一种生物蛋白敷料组合物及其制备方法 |
| TWI806100B (zh) | 2021-07-16 | 2023-06-21 | 財團法人工業技術研究院 | 生物性毛髮形狀改變組成物與套組以及改變毛髮形狀之方法 |
| US20250082564A1 (en) * | 2021-09-03 | 2025-03-13 | Shiseido Company, Ltd. | Oil-in-water emulsion cosmetic |
| CN116850119B (zh) * | 2023-07-19 | 2024-10-22 | 上海联衡生物科技有限公司 | 端粒酶组合物的制备方法及在防脱发护发素中的应用 |
| CN117414313B (zh) * | 2023-10-12 | 2024-06-07 | 广东丸美生物技术股份有限公司 | 一种保湿组合物及其应用 |
| CN118001201A (zh) * | 2024-02-05 | 2024-05-10 | 上海臻臣化妆品有限公司 | 抗皱紧致组合物及美妆产品 |
Family Cites Families (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3755560A (en) | 1971-06-30 | 1973-08-28 | Dow Chemical Co | Nongreasy cosmetic lotions |
| DE2437090A1 (de) | 1974-08-01 | 1976-02-19 | Hoechst Ag | Reinigungsmittel |
| US4152416A (en) | 1976-09-17 | 1979-05-01 | Marra Dorothea C | Aerosol antiperspirant compositions delivering astringent salt with low mistiness and dustiness |
| DE3119383A1 (de) | 1981-05-15 | 1982-12-02 | Basf Ag, 6700 Ludwigshafen | Verfahren zur herstellung von feinverteilten, pulverfoermigen carotinodpraeparaten |
| US4421769A (en) | 1981-09-29 | 1983-12-20 | The Procter & Gamble Company | Skin conditioning composition |
| US5411873A (en) | 1984-05-29 | 1995-05-02 | Genencor, Inc. | Process for producing heterologous polypeptides |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4965188A (en) | 1986-08-22 | 1990-10-23 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme |
| US5679543A (en) | 1985-08-29 | 1997-10-21 | Genencor International, Inc. | DNA sequences, vectors and fusion polypeptides to increase secretion of desired polypeptides from filamentous fungi |
| US4999186A (en) | 1986-06-27 | 1991-03-12 | The Procter & Gamble Company | Novel sunscreen agents, sunscreen compositions and methods for preventing sunburn |
| US4937370A (en) | 1987-06-02 | 1990-06-26 | The Procter & Gamble Company | Novel chromophores, sunscreen compositions and methods for preventing sunburn |
| US5087372A (en) | 1989-03-24 | 1992-02-11 | Asahi Kasei Kogyo Kabushiki Kaisha | Method for removing heavy metal ions from contaminated water and a porous membrane usable therefor |
| US5011681A (en) | 1989-10-11 | 1991-04-30 | Richardson-Vicks, Inc. | Facial cleansing compositions |
| US5073371A (en) | 1990-11-30 | 1991-12-17 | Richardson-Vicks, Inc. | Leave-on facial emulsion compositions |
| US5073372A (en) | 1990-11-30 | 1991-12-17 | Richardson-Vicks, Inc. | Leave-on facial emulsion compositions |
| US5429950A (en) | 1992-03-30 | 1995-07-04 | Genencor International, Inc. | Heterologous gene expression in bacillus subtilis: fusion approach |
| GB9415421D0 (en) | 1994-07-30 | 1994-09-21 | Procter & Gamble | Cosmetic compositions and processes for manufacture thereof |
| DE19542139C2 (de) | 1995-11-11 | 1998-07-30 | Henkel Kgaa | Kosmetische und/oder pharmazeutische Emulsionen |
| ATE282703T1 (de) | 1996-03-12 | 2004-12-15 | Genencor Int | Alkalische cellulase und verfahren zu deren herstellung |
| US5827508A (en) | 1996-09-27 | 1998-10-27 | The Procter & Gamble Company | Stable photoprotective compositions |
| CA2272306A1 (en) | 1996-11-22 | 1998-05-28 | The Procter & Gamble Company | Cosmetic compositions |
| US8039026B1 (en) * | 1997-07-28 | 2011-10-18 | Johnson & Johnson Consumer Companies, Inc | Methods for treating skin pigmentation |
| JPH11193207A (ja) * | 1997-12-26 | 1999-07-21 | Shiseido Co Ltd | 皮膚外用剤 |
| CN1300223A (zh) * | 1998-03-12 | 2001-06-20 | 宝洁公司 | 具有含酶抑制剂的皮肤护理组合物的一次性吸湿用品 |
| US6750229B2 (en) * | 1998-07-06 | 2004-06-15 | Johnson & Johnson Consumer Companies, Inc. | Methods for treating skin pigmentation |
| US5989528A (en) | 1998-07-30 | 1999-11-23 | The Procter & Gamble Company | Sunscreen compositions |
| US5935556A (en) | 1998-07-30 | 1999-08-10 | The Procter & Gamble Company | Sunscreen compositions |
| US5972316A (en) | 1998-10-16 | 1999-10-26 | The Procter & Gamble Company | UV protection compositions |
| US5968485A (en) | 1998-10-16 | 1999-10-19 | The Procter & Gamble Company | UV protection compositions |
| WO2000024371A1 (en) | 1998-10-23 | 2000-05-04 | The Procter & Gamble Company | Skin care compositions |
| EP1267800A4 (en) * | 2000-03-31 | 2004-08-25 | Gen Hospital Corp | METHOD FOR INFLUENCING HAIR GROWTH |
| US20020098524A1 (en) * | 2000-04-14 | 2002-07-25 | Murray Christopher J. | Methods for selective targeting |
| US6537968B1 (en) | 2000-07-24 | 2003-03-25 | Alphamed Pharmaceuticals Corp | Treatment of lupus erythematosus |
| US20020160061A1 (en) * | 2001-02-28 | 2002-10-31 | Claude Saliou | Use of legume products for the treatment of external aggressions |
| TWI233361B (en) * | 2001-04-13 | 2005-06-01 | Gen Hospital Corp | Methods of preventing UVB-induced skin damage |
| AU2003216389A1 (en) | 2002-02-21 | 2003-09-09 | Essentia Biosystems, Inc. | Induction of hair growth with vascular endothelial growth factor |
| EP1689766B1 (en) | 2003-11-06 | 2012-04-25 | Danisco US Inc. | Expression in filamentous fungi of protease inhibitors and variants thereof |
| ATE482972T1 (de) * | 2003-11-06 | 2010-10-15 | Danisco Us Inc | Tgf-beta1-bindende und geträgerte peptide |
-
2006
- 2006-04-25 US US11/919,717 patent/US9084734B2/en not_active Expired - Fee Related
- 2006-04-25 BR BRPI0613548-0A patent/BRPI0613548A2/pt not_active IP Right Cessation
- 2006-04-25 JP JP2008510044A patent/JP5348749B2/ja not_active Expired - Fee Related
- 2006-04-25 CN CN2006800151170A patent/CN101278051B/zh not_active Expired - Fee Related
- 2006-04-25 EP EP06751417A patent/EP1880007A2/en not_active Withdrawn
- 2006-04-25 CA CA2607142A patent/CA2607142C/en not_active Expired - Fee Related
- 2006-04-25 WO PCT/US2006/015711 patent/WO2006121610A2/en not_active Ceased
- 2006-04-25 AU AU2006246425A patent/AU2006246425B2/en not_active Ceased
Cited By (78)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10821077B2 (en) | 2002-10-25 | 2020-11-03 | Foamix Pharmaceuticals Ltd. | Dicarboxylic acid foamable vehicle and pharmaceutical compositions thereof |
| US9320705B2 (en) | 2002-10-25 | 2016-04-26 | Foamix Pharmaceuticals Ltd. | Sensation modifying topical composition foam |
| US10322085B2 (en) | 2002-10-25 | 2019-06-18 | Foamix Pharmaceuticals Ltd. | Dicarboxylic acid foamable vehicle and pharmaceutical compositions thereof |
| US8119150B2 (en) | 2002-10-25 | 2012-02-21 | Foamix Ltd. | Non-flammable insecticide composition and uses thereof |
| US9713643B2 (en) | 2002-10-25 | 2017-07-25 | Foamix Pharmaceuticals Ltd. | Foamable carriers |
| US11033491B2 (en) | 2002-10-25 | 2021-06-15 | Vyne Therapeutics Inc. | Dicarboxylic acid foamable vehicle and pharmaceutical compositions thereof |
| US10117812B2 (en) | 2002-10-25 | 2018-11-06 | Foamix Pharmaceuticals Ltd. | Foamable composition combining a polar solvent and a hydrophobic carrier |
| US9668972B2 (en) | 2002-10-25 | 2017-06-06 | Foamix Pharmaceuticals Ltd. | Nonsteroidal immunomodulating kit and composition and uses thereof |
| US8486376B2 (en) | 2002-10-25 | 2013-07-16 | Foamix Ltd. | Moisturizing foam containing lanolin |
| US9622947B2 (en) | 2002-10-25 | 2017-04-18 | Foamix Pharmaceuticals Ltd. | Foamable composition combining a polar solvent and a hydrophobic carrier |
| US8119109B2 (en) | 2002-10-25 | 2012-02-21 | Foamix Ltd. | Foamable compositions, kits and methods for hyperhidrosis |
| US9211259B2 (en) | 2002-11-29 | 2015-12-15 | Foamix Pharmaceuticals Ltd. | Antibiotic kit and composition and uses thereof |
| US8119106B2 (en) | 2003-04-28 | 2012-02-21 | Foamix Ltd | Foamable iodine compositions |
| US8114385B2 (en) | 2003-08-04 | 2012-02-14 | Foamix Ltd. | Oleaginous pharmaceutical and cosmetic foam |
| US9636405B2 (en) | 2003-08-04 | 2017-05-02 | Foamix Pharmaceuticals Ltd. | Foamable vehicle and pharmaceutical compositions thereof |
| US8795693B2 (en) | 2003-08-04 | 2014-08-05 | Foamix Ltd. | Compositions with modulating agents |
| WO2007085846A1 (en) * | 2006-01-27 | 2007-08-02 | Reckitt Benckiser (Uk) Limited | Use of a vegf binding peptide to retard hair growth |
| US9682021B2 (en) | 2006-11-14 | 2017-06-20 | Foamix Pharmaceuticals Ltd. | Substantially non-aqueous foamable petrolatum based pharmaceutical and cosmetic compositions and their uses |
| WO2008150155A3 (en) * | 2007-06-08 | 2010-03-04 | Otc Pharma International B.V. | Composition for shaving |
| NL1033954C2 (nl) * | 2007-06-08 | 2008-12-09 | Otc Pharma Internat B V | Samenstelling voor scheren. |
| US11103454B2 (en) | 2007-08-07 | 2021-08-31 | Vyne Therapeutics Inc. | Wax foamable vehicle and pharmaceutical compositions thereof |
| US10369102B2 (en) | 2007-08-07 | 2019-08-06 | Foamix Pharmaceuticals Ltd. | Wax foamable vehicle and pharmaceutical compositions thereof |
| US9662298B2 (en) | 2007-08-07 | 2017-05-30 | Foamix Pharmaceuticals Ltd. | Wax foamable vehicle and pharmaceutical compositions thereof |
| DE102007041735A1 (de) | 2007-09-04 | 2009-03-05 | Egon Tech | Aminosäure-Mineral-Peptid-Komplex, insbesondere quanten-mechanisch modifiziert, als Rezeptur zur Regulierung der Haut |
| JP2010540921A (ja) * | 2007-09-27 | 2010-12-24 | フンダシオン レイナ メルセデス パラ ラ インベスティガシオン サニタリア | ヒトgstt1に対する抗体(抗−hgstt1)の検出のための免疫学的分析方法 |
| WO2009063158A3 (en) * | 2007-11-14 | 2010-07-15 | Reckitt & Colman (Overseas) Limited | Personal care article |
| US8343945B2 (en) | 2007-12-07 | 2013-01-01 | Foamix Ltd. | Carriers, formulations, methods for formulating unstable active agents for external application and uses thereof |
| US8900553B2 (en) | 2007-12-07 | 2014-12-02 | Foamix Pharmaceuticals Ltd. | Oil and liquid silicone foamable carriers and formulations |
| US9795564B2 (en) | 2007-12-07 | 2017-10-24 | Foamix Pharmaceuticals Ltd. | Oil-based foamable carriers and formulations |
| US11433025B2 (en) | 2007-12-07 | 2022-09-06 | Vyne Therapeutics Inc. | Oil foamable carriers and formulations |
| WO2010044786A1 (en) | 2008-10-15 | 2010-04-22 | Danisco Us Inc., Genencor Division | Modified variant bowman birk protease inhibitors |
| JP2012505652A (ja) * | 2008-10-15 | 2012-03-08 | ダニスコ・ユーエス・インク | 修飾変異ボウマンブリックプロテアーゼインヒビター |
| US7803902B2 (en) | 2008-10-15 | 2010-09-28 | Danisco Us Inc. | Modified variant bowman birk protease inhibitors |
| US7772181B2 (en) | 2008-10-15 | 2010-08-10 | Danisco Us Inc. | Personal care compositions comprising modified variant Bowman Birk Protease Inhibitors |
| US7947475B2 (en) | 2008-10-15 | 2011-05-24 | Danisco Us Inc. | Modified variant Bowman Birk protease inhibitors |
| US8962796B2 (en) | 2008-10-15 | 2015-02-24 | Danisco Us Inc. | Modified variant Bowman Birk protease inhibitors |
| RU2509776C2 (ru) * | 2008-10-15 | 2014-03-20 | ДАНИСКО ЮЭс ИНК. | МОДИФИЦИРОВАННЫЕ ВАРИАНТЫ ИНГИБИТОРОВ ПРОТЕАЗ Bowman Birk |
| US8394941B2 (en) | 2008-10-15 | 2013-03-12 | Danisco Us Inc. | Modified variant Bowman Birk Protease Inhibitors |
| AU2008362898B2 (en) * | 2008-10-15 | 2013-02-28 | Danisco Us Inc. | Modified variant Bowman Birk Protease inhibitors |
| US10363216B2 (en) | 2009-04-28 | 2019-07-30 | Foamix Pharmaceuticals Ltd. | Foamable vehicles and pharmaceutical compositions comprising aprotic polar solvents and uses thereof |
| US9884017B2 (en) | 2009-04-28 | 2018-02-06 | Foamix Pharmaceuticals Ltd. | Foamable vehicles and pharmaceutical compositions comprising aprotic polar solvents and uses thereof |
| US10213384B2 (en) | 2009-04-28 | 2019-02-26 | Foamix Pharmaceuticals Ltd. | Foamable vehicles and pharmaceutical compositions comprising aprotic polar solvents and uses thereof |
| US10350166B2 (en) | 2009-07-29 | 2019-07-16 | Foamix Pharmaceuticals Ltd. | Non surface active agent non polymeric agent hydro-alcoholic foamable compositions, breakable foams and their uses |
| US11219631B2 (en) | 2009-07-29 | 2022-01-11 | Vyne Pharmaceuticals Inc. | Foamable compositions, breakable foams and their uses |
| US10092588B2 (en) | 2009-07-29 | 2018-10-09 | Foamix Pharmaceuticals Ltd. | Foamable compositions, breakable foams and their uses |
| US9849142B2 (en) | 2009-10-02 | 2017-12-26 | Foamix Pharmaceuticals Ltd. | Methods for accelerated return of skin integrity and for the treatment of impetigo |
| US10610599B2 (en) | 2009-10-02 | 2020-04-07 | Foamix Pharmaceuticals Ltd. | Topical tetracycline compositions |
| US12138311B2 (en) | 2009-10-02 | 2024-11-12 | Journey Medical Corporation | Topical tetracycline compositions |
| US10086080B2 (en) | 2009-10-02 | 2018-10-02 | Foamix Pharmaceuticals Ltd. | Topical tetracycline compositions |
| US10213512B2 (en) | 2009-10-02 | 2019-02-26 | Foamix Pharmaceuticals Ltd. | Topical tetracycline compositions |
| US10238746B2 (en) | 2009-10-02 | 2019-03-26 | Foamix Pharmaceuticals Ltd | Surfactant-free water-free foamable compositions, breakable foams and gels and their uses |
| US10265404B2 (en) | 2009-10-02 | 2019-04-23 | Foamix Pharmaceuticals Ltd. | Compositions, gels and foams with rheology modulators and uses thereof |
| US10322186B2 (en) | 2009-10-02 | 2019-06-18 | Foamix Pharmaceuticals Ltd. | Topical tetracycline compositions |
| US10029013B2 (en) | 2009-10-02 | 2018-07-24 | Foamix Pharmaceuticals Ltd. | Surfactant-free, water-free formable composition and breakable foams and their uses |
| US10835613B2 (en) | 2009-10-02 | 2020-11-17 | Foamix Pharmaceuticals Ltd. | Compositions, gels and foams with rheology modulators and uses thereof |
| US10821187B2 (en) | 2009-10-02 | 2020-11-03 | Foamix Pharmaceuticals Ltd. | Compositions, gels and foams with rheology modulators and uses thereof |
| US9675700B2 (en) | 2009-10-02 | 2017-06-13 | Foamix Pharmaceuticals Ltd. | Topical tetracycline compositions |
| US10967063B2 (en) | 2009-10-02 | 2021-04-06 | Vyne Therapeutics Inc. | Surfactant-free, water-free formable composition and breakable foams and their uses |
| US10463742B2 (en) | 2009-10-02 | 2019-11-05 | Foamix Pharmaceuticals Ltd. | Topical tetracycline compositions |
| US10517882B2 (en) | 2009-10-02 | 2019-12-31 | Foamix Pharmaceuticals Ltd. | Method for healing of an infected acne lesion without scarring |
| US10137200B2 (en) | 2009-10-02 | 2018-11-27 | Foamix Pharmaceuticals Ltd. | Surfactant-free water-free foamable compositions, breakable foams and gels and their uses |
| US10946101B2 (en) | 2009-10-02 | 2021-03-16 | Vyne Therapeutics Inc. | Surfactant-free water-free foamable compositions, breakable foams and gels and their uses |
| EP2519251A4 (en) * | 2009-12-30 | 2013-08-28 | Solae Llc | ISOLATED CLEANED BOWMAN BIRK PROTEASE HEMMER PROTEINS FROM A SOYA PROCESSING STREAM |
| US20130023480A1 (en) * | 2009-12-30 | 2013-01-24 | Solae, Llc | Purified Bowman-Birk Protease Inhibitor Proteins Isolated from a Soy Processing Sttream |
| US20150190318A1 (en) * | 2012-07-26 | 2015-07-09 | Solae, Llc | Emulsifying agent for use in personal care products and industrial products |
| EP3308836B1 (de) | 2013-07-04 | 2020-09-09 | Beiersdorf AG | Octocrylenfreies, geruchsstabiles sonnenschutzmittel |
| TWI610687B (zh) * | 2013-11-13 | 2018-01-11 | 愛茉莉太平洋股份有限公司 | 使用天然乳化劑的低黏度化妝品組成物 |
| US20150238403A1 (en) * | 2014-02-21 | 2015-08-27 | Amorepacific Corporation | Low viscous cosmetic composition using a natural emulsifying agent |
| US10555885B2 (en) | 2014-02-21 | 2020-02-11 | Amorepacific Corporation | Low viscous cosmetic composition using a natural emulsifying agent |
| US10786007B2 (en) | 2015-03-27 | 2020-09-29 | Philip Morris Products S.A. | Resealable aerosol-generating article |
| WO2017172955A1 (en) * | 2016-03-29 | 2017-10-05 | Safewhite, Inc. | Polyelectrolyte dental adhesives for whitening teeth and teeth components |
| US9937120B2 (en) | 2016-03-29 | 2018-04-10 | Safewhite, Inc. | Polyelectrolyte dental adhesives for whitening teeth and teeth components |
| US10201491B2 (en) | 2016-03-29 | 2019-02-12 | Safewhite, Inc. | Polyelectrolyte dental adhesives for whitening teeth and teeth components |
| US10849847B2 (en) | 2016-09-08 | 2020-12-01 | Foamix Pharamaceuticals Ltd. | Compositions and methods for treating rosacea and acne |
| US10398641B2 (en) | 2016-09-08 | 2019-09-03 | Foamix Pharmaceuticals Ltd. | Compositions and methods for treating rosacea and acne |
| US11324691B2 (en) | 2016-09-08 | 2022-05-10 | Journey Medical Corporation | Compositions and methods for treating rosacea and acne |
| CN116694606A (zh) * | 2023-06-21 | 2023-09-05 | 江南大学 | 一种利用角蛋白酶水解玉米黄粉醇溶蛋白的方法 |
| CN116694606B (zh) * | 2023-06-21 | 2024-03-26 | 江南大学 | 一种利用角蛋白酶水解玉米黄粉醇溶蛋白的方法 |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2008540408A (ja) | 2008-11-20 |
| US20120014885A1 (en) | 2012-01-19 |
| WO2006121610A3 (en) | 2007-01-25 |
| JP5348749B2 (ja) | 2013-11-20 |
| BRPI0613548A2 (pt) | 2011-01-18 |
| AU2006246425A1 (en) | 2006-11-16 |
| EP1880007A2 (en) | 2008-01-23 |
| US9084734B2 (en) | 2015-07-21 |
| CN101278051B (zh) | 2011-10-05 |
| CA2607142C (en) | 2014-03-25 |
| AU2006246425B2 (en) | 2012-03-22 |
| CA2607142A1 (en) | 2006-11-16 |
| CN101278051A (zh) | 2008-10-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2006246425B2 (en) | Personal care compositions and methods for their use | |
| US7772181B2 (en) | Personal care compositions comprising modified variant Bowman Birk Protease Inhibitors | |
| AU2008362898B2 (en) | Modified variant Bowman Birk Protease inhibitors | |
| ES2375360T3 (es) | Péptidos soportados y de unión a vegf para tratar enfermedades de la piel. | |
| US8962796B2 (en) | Modified variant Bowman Birk protease inhibitors | |
| AU2012203584B2 (en) | Personal care compositions and methods for their use | |
| NZ591599A (en) | Personal care compositions and methods for their use | |
| KR20110084504A (ko) | 개질된 변이체 바우만 버크 프로테아제 저해제 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200680015117.0 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006246425 Country of ref document: AU Ref document number: 560427 Country of ref document: NZ |
|
| ENP | Entry into the national phase |
Ref document number: 2006246425 Country of ref document: AU Date of ref document: 20060425 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 6819/DELNP/2007 Country of ref document: IN |
|
| REEP | Request for entry into the european phase |
Ref document number: 2006751417 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006751417 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2607142 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2008510044 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| NENP | Non-entry into the national phase |
Ref country code: RU |
|
| ENP | Entry into the national phase |
Ref document number: PI0613548 Country of ref document: BR Kind code of ref document: A2 Effective date: 20071105 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11919717 Country of ref document: US |