WO2006009888A2 - C-met kinase binding proteins - Google Patents
C-met kinase binding proteins Download PDFInfo
- Publication number
- WO2006009888A2 WO2006009888A2 PCT/US2005/021558 US2005021558W WO2006009888A2 WO 2006009888 A2 WO2006009888 A2 WO 2006009888A2 US 2005021558 W US2005021558 W US 2005021558W WO 2006009888 A2 WO2006009888 A2 WO 2006009888A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- monomer
- domain
- domains
- polypeptide
- met
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/566—Immunoassay; Biospecific binding assay; Materials therefor using specific carrier or receptor proteins as ligand binding reagents where possible specific carrier or receptor proteins are classified with their target compounds
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/475—Assays involving growth factors
- G01N2333/4753—Hepatocyte growth factor; Scatter factor; Tumor cytotoxic factor II
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/82—Translation products from oncogenes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
Definitions
- Hepatocyte Growth Factor/Scatter Factor is a mesenchyme- derived pleiotropic factor, which regulates cell growth, cell motility, and morphogenesis of various types of cells and mediates epithelial-mesenchymal interactions responsible for morphogenic tissue interactions during embryonic development and organogenesis.
- HGF was originally identified as a potent mitogen for hepatocytes, it has also been identified as an angiogenic growth factor.
- Met was first identified in the 1980s as an oncogene and is the receptor for HGF. The proto-oncogene c-MET, was found to encode a receptor tyrosine kinase.
- phosphorylation of receptor In response to HGF treatment a range of activities are observed: phosphorylation of receptor, docking of signaling intermediates Gab-1/Grb2, culminating in activation of kinases such as PI3K, ERKl and 2, and AKT. These activities aid in cell growth, survival, migration, and neovascularization.
- HGF/SF Hepatocyte Growth Factor/Scatter Factor
- HGF and/or Met are frequently expressed in carcinomas, in other types of human solid tumours and in their metastases, and that HGF and/or Met over- or misexpression often correlates with poor prognosis.
- unequivocal evidence that implicates Met in human cancer is provided by the activating mutations that have been discovered in both sporadic and inherited forms of human renal papillary carcinomas.
- the present invention provides a polypeptide comprising a monomer domain that binds to c-MET.
- the monomer domain is a non-naturally-occurring monomer domain consisting of 30 to 50 amino acids; comprises at least one disulfide bond; and optionally, binds to an ion.
- the monomer domain is an LDL receptor class
- the monomer domain is an LDL receptor class A monomer domain comprising the following sequence: EFXCXNGXCIPXXWXCDGXDDCGDXSDE, wherein X is any amino acid.
- the polypeptide comprises at least one and no more than six monomer domains that bind c-MET. In some embodiments, the polypeptide comprises at least two monomer domains that bind c-MET.
- the polypeptide further comprises a second monomer domain, wherein the second monomer domain has a binding specificity for a blood factor, thereby increasing the serum half-life of the polypeptide when the polypeptide is injected into an animal compared to the serum half-life of a polypeptide lacking the blood factor-binding monomer domain.
- the blood factor is serum albumin, an immunoglobulin or an erythrocyte.
- the second monomer domain binds to immunoglobulin (IgG) and the second monomer domain is an LDL receptor class A monomer domain comprising a sequence selected from the following: CXSSGRCIPXXWVCDGXXDCRDXSDE, and CXSSGRCIPXXWLCDGXXDCRDXSDE, wherein X is any amino acid.
- the second monomer domain binds to immunoglobulin (IgG) and the second monomer domain is an LDL receptor class A monomer domain comprising the following sequence:
- the second monomer domain comprises CHPTGQFRCRSSGRCVSPTWVCDGDNDU ⁇ DMS ⁇ J ⁇ NCSAP ASEPPGSL. In some embodiments, the second monomer domain comprises CHPTGQFRCRSSGRCVSPTWVCDGDNDCGDNSDEENC
- binding of at least one monomer domain to c- MET inhibits dimerization of Met.
- at least one monomer domain binds to the Sema domain of c-MET, thereby preventing binding of Met ligands to c-MET.
- the polypeptide comprises at least one and no more than six monomer domains, hi some embodiments, the polypeptide comprises at least two monomer domains and the monomer domains are linked by a linker.
- the linker is a peptide linker, hi some embodiments, the linker is between 4 to 12 amino acids long.
- the monomer domains are each between 35 to 45 amino acids.
- each monomer domain comprises two disulfide bonds. In some embodiments, each monomer domain comprises three disulfide bonds.
- the ion is a metal ion. hi some embodiments, the ion is a calcium ion.
- At least one of the monomer domains is derived from a LDL-receptor class A domain. In some embodiments, at least one of the monomer domains is derived from an EGF-like domain.
- the monomer comprises an amino acid sequence in which at least 10% of the amino acids in the sequence are cysteine; and/or at least 25% of the amino acids are non-naturally-occurring amino acids.
- the present invention also provides methods for identifying a polypeptide that binds to c-MET.
- the method comprises, screening a library of polypeptides for affinity to c-MET; and selecting a polypeptide comprising at least one monomer domain that binds to c- MET, wherein the monomer domain: is a non-naturally-occurring monomer domain; comprises at least one disulfide bond; and binds to an ion.
- the selected polypeptide comprises a monomer domain comprising any of the following:
- the selecting step comprises selecting a polypeptide that reduces HGF-mediated cell proliferation and/or migration, hi some embodiments, the method further comprises selecting a polypeptide that inhibits tumor growth in an animal.
- the monomer domain comprises an amino acid sequence in which at least 10% of the amino acids in the sequence are cysteine; and/or at least 25% of the amino acids are non-naturally-occurring amino acids.
- the method further comprises linking the monomer domain in the selected polypeptide to a second monomer domain to form a library of multimers, each multimer comprising at least two monomer domains; screening the library of multimers for the ability to bind to c-MET; and selecting a multimer that binds c-MET.
- the method further comprises linking the monomer domain in the selected polypeptide to a second monomer domain to form a library of multimers, each multimer comprising at least two monomer domains; screening the library of multimers for the ability to bind to a target molecule other than the c-MET; and selecting a multimer that binds to the target molecule.
- the method further comprises a step of mutating at least one monomer domain, thereby providing a library comprising mutated monomer domains.
- the library of monomer domains is expressed as a phage display, ribosome display or cell surface display.
- the polypeptide comprises at least two monomer domains and the monomer domains are linked by a linker.
- the linker is a peptide linker. In some embodiments, the linker is between 4 to 12 amino acids long.
- the monomer domains are each between 35 to 45 amino acids.
- each monomer domain comprises two disulfide bonds. In some embodiments, each monomer domain comprises three disulfide bonds.
- the ion is a metal ion. In some embodiments, the ion is a calcium ion.
- At least one of the monomer domains is derived from a LDL-receptor class A domain, hi some embodiments, at least one of the monomer domains is derived from an EGF-like domain.
- the monomer domain comprises an amino acid sequence in which at least 10% of the amino acids in the sequence are cysteine; and/or at least 25% of the amino acids are non-naturally-occurring amino acids.
- the present invention also provides polynucleotides encoding a polypeptide comprising a monomer domain that binds to c-MET, wherein the monomer domain: is a non-naturally-occurring monomer domain consisting of 30 to 50 amino acids; comprises at least one disulfide bond.
- the present invention also provides [34] A polypeptide comprising a monomer domain that binds to immunoglobulin-G (IgG), wherein the monomer domain is an LDL receptor class A monomer domain comprising sequence selected from the following: CXSSGRCIPXXWVCDGXXDCRDXSDE, CXSSGRCIPXXWLCDGXXDCRDXSDE, and [EQ]FXCRX[ST]XRC[IV]XXXW[ILV]CDGXXDCXD[DN]SDE wherein X is any amino acid and amino acids in brackets are alternative amino acids at a single position; and wherein the polypeptide has an increased serum Jtialt-lite when the polypeptide is injected into an animal compared to the serum half-life of a polypeptide lacking the monomer domain that binds to IgG.
- IgG immunoglobulin-G
- the monomer domain comprises CHPTGQFRCRSSGRCVSPTWVCDGDNDCGDNSDEENCSAPASEPPGSL. In some embodiments, the monomer domain comprises CHPTGQFRCRSSGRCVSPTWVCDGDNDCGDNSDEENC.
- the polypeptide comprises a second monomer domain with binding specificity for a molecule other than IgG, wherein the second monomer domain: has between 30-100 amino acids; is a non-naturally-occurring monomer domain; comprises at least one disulfide bond.
- the second monomer domain is a non- naturally-occuring LDL-receptor class A domain.
- the present invention also provides polynucleotides that encode the polypeptides as described above.
- Metal also referred to as “c-MET,” refers to the Hepatocyte Growth Factor/Scatter Factor (HGF/SF)-binding receptor tyrosine kinase.
- HGF/SF Hepatocyte Growth Factor/Scatter Factor
- phosphorylation of receptor In response to HGF treatment a range of activities are observed: phosphorylation of receptor, docking of signaling intermediates Gab-1/Grb2, culminating in activation of kinases such as PI3K, ERKl and 2, and AKT.
- kinases such as PI3K, ERKl and 2
- AKT AKT
- monomer domain or “monomer” are used interchangeably and herein refer to a discrete region found in a protein or polypeptide.
- a monomer domain forms a native three-dimensional structure in solution in the absence of flanking native amino acid sequences.
- Monomer domains of the invention will often bind to a target molecule.
- a polypeptide that forms a three-dimensional structure that binds to a target molecule is a monomer domain.
- me term “monomer domain” does not encompass the complementarity determining region (CDR) of an antibody.
- loop refers to that portion of a monomer domain that is typically exposed to the environment by the assembly of the scaffold structure of the monomer domain protein, and which is involved in target binding.
- the present invention provides three types of loops that are identified by specific features, such as, potential for disulfide bonding, bridging between secondary protein structures, and molecular dynamics (i.e., flexibility).
- the three types of loop sequences are a cysteine-defined loop sequence, a structure-defined loop sequence, and a B-factor-defmed loop sequence.
- cyste-defined loop sequence refers to a subsequence of a naturally occurring monomer domain-encoding sequence that is bound at each end by a cysteine residue that is conserved with respect to at least one other naturally occurring monomer domain of the same family. Cysteine-defined loop sequences are identified by multiple sequence alignment of the naturally occurring monomer domains, followed by sequence analysis to identify conserved cysteine residues. The sequence between each consecutive pair of conserved cysteine residues is a cysteine-defined loop sequence. The cysteine-defined loop sequence does not include the cysteine residues adjacent to each terminus.
- Monomer domains having cysteine-defined loop sequences include the LDL receptor A-domains, EGF-like domains, sushi domains, Fibronectin type 1 domains, and the like.
- LDL receptor A-domains represented by the consensus sequence, CX 6 CX 4 CX 6 CX 5 CXgC, wherein X 6 , X 4 , X 5 , and Xs each represent a cysteine-defined loop sequence comprising the designated number of amino acids.
- structure-defined loop sequence refers to a subsequence of a monomer-domain encoding sequence that is bound at each end to subsequences that each form a secondary structure.
- Secondary structures for proteins with known three dimensional structures are identified in accordance with the algorithm STRIDE for assigning protein secondary structure as described in Frishman, D. and Argos, P. (1995) "Knowledge-based secondary structure assignment," Proteins, 23(4):566-79 (see also //hgmp.mrc.ac.uk/Registered/Option/stride.html at the World Wide Web).
- Secondary structures for proteins with unknown or uncharacterized three dimensional structures are identified in accordance with the algorithm described in Jones, D.T.
- Secondary structures include, for example, pleated sheets, helices, and the like. Examples of monomer domains having structure-defined loop sequences are the C2 domains, Ig domains, Factor 5/8 C domains, Fibronectin type 3 domains, and the like.
- B-factor-defmed loop sequence refers to a subsequence of at least three amino acid residues of a monomer-domain encoding sequence in which the B- factors for the alpha carbons in the B-factor-defmed loop are among the 25% highest alpha carbon B factors in the entire monomer domain. Typically the average alpha-carbon B-factor for the subsequence is at least about 65.
- B-factor (or "temperature factor” or "Debye- Waller factor”) is derived from X-ray scattering data.
- the B-factor is a factor that can be applied to the X-ray scattering term for each atom, or for groups of atoms, that describes the degree to which electron density is spread out B-factors employed in the practice of the present invention may be either isotropic or anisotropic.
- the term "average alpha-carbon B-factor" refers to:
- multimer is used herein to indicate a polypeptide comprising at least two monomer domains. The separate monomer domains in a multimer can be joined together by a linker. A multimer is also known as a combinatorial mosaic protein or a recombinant mosaic protein.
- family and family class are used interchangeably to indicate proteins that are grouped together based on similarities in their amino acid sequences. These similar sequences are generally conserved because they are important for the function of the protein and/or the maintenance of the three dimensional structure of the protein. Examples of such families include the LDL Receptor A-domain family, the EGF- like family, and the like. Additionally, related sequences that bind to the same target molecule can be divided into families based on common sequence motifs.
- ligand also referred to herein as a "target molecule,” encompasses a wide variety of substances and molecules, which range from simple molecules to complex targets.
- Target molecules can be proteins, nucleic acids, lipids, carbohydrates or any other molecule capable of recognition by a polypeptide domain.
- a target molecule can include a chemical compound (i.e., non-biological compound such as, e.g., an organic molecule, an inorganic molecule, or a molecule having both organic and inorganic atoms, but excluding polynucleotides and proteins), a mixture of chemical compounds, an array of spatially localized compounds, a biological macromolecule, a bacteriophage peptide display library, a polysome peptide display library, an extract made from a biological materials such as bacteria, plants, fungi, or animal (e.g., mammalian) cells or tissue, a protein, a toxin, a peptide hormone, a cell, a virus, or the like.
- a chemical compound i.e., non-biological compound such as, e.g., an organic molecule, an inorganic molecule, or a molecule having both organic and inorganic atoms, but excluding polynucleotides and proteins
- Target molecules include, e.g., a whole cell, a whole tissue, a mixture of related or unrelated proteins, a mixture of viruses or bacterial strains or the like.
- Target molecules can also be defined by inclusion in screening assays described herein or by enhancing or inhibiting a specific protein interaction (i.e., an agent that selectively inhibits a binding interaction between two predetermined polypeptides).
- linker is used herein to indicate a moiety or group of moieties that joins or connects two or more discrete separate monomer domains.
- the linker allows the discrete separate monomer domains to remain separate when joined together in a multimer.
- the linker moiety is typically a substantially linear moiety.
- Suitable linkers include polypeptides, polynucleic acids, peptide nucleic acids and the like.
- Suitable linkers also include optionally substituted alkylene moieties that have one or more oxygen atoms incorporated in the carbon backbone. Typically, the molecular weight of the linker is less than about 2000 daltons.
- the molecular weight of the linker is less than about 1500 daltons and usually is less than about 1000 daltons.
- the linker can be small enough to allow the discrete separate monomer domains to cooperate, e.g., where each of the discrete separate monomer domains in a multimer binds to the same target molecule via separate binding sites.
- Exemplary linkers include a polynucleotide encoding a polypeptide, or a polypeptide of amino acids or other non-naturally occurring moieties.
- the linker can be a portion of a native sequence, a variant thereof, or a synthetic sequence. Linkers can comprise, e.g., naturally occurring, non-naturally occurring amino acids, or a combination of both.
- a monomer domain is a separate domain in a protein because it has an independent property that can be recognized and separated from the protein. For instance, the ligand binding ability of the A-domain in the LDLR is an independent property.
- Other examples of separate include the separate monomer domains in a multimer that remain separate independent domains even when complexed or joined together in the multimer by a linker.
- Another example of a separate property is the separate binding sites in a multimer for a ligand.
- directed evolution refers to a process by which polynucleotide variants are generated, expressed, and screened for an activity (e.g., a polypeptide with binding activity) in a recursive process. One or more candidates in the screen are selected and the process is then repeated using polynucleotides that encode the selected candidates to generate new variants.
- Directed evolution involves at least two rounds of variation generation and can include 3, 4, 5, 10, 20 or more rounds of variation generation and selection. Variation can be generated by any method known to those of skill in the art, including, e.g., by error-prone PCR, gene recombination, chemical mutagenesis and the like.
- shuffling is used herein to indicate recombination between non-identical sequences.
- shuffling can include crossover via homologous recombination or via non-homologous recombination, such as via cre/lox and/or flp/frt systems.
- Shuffling can be carried out by employing a variety of different formats, including for example, in vitro and in vivo shuffling formats, in silico shuffling formats, shuffling formats that utilize either double-stranded or single-stranded templates, primer based shuffling formats, nucleic acid fragmentation-based shuffling formats, and oligonucleotide-mediated shuffling formats, all of which are based on recombination events between non-identical sequences and are described in more detail or referenced herein below, as well as other similar recombination-based formats.
- random refers to a polynucleotide sequence or an amino acid sequence composed of two or more amino acids and constructed by a stochastic or random process.
- the random polynucleotide sequence or amino acid sequence can include framework or scaffolding motifs, which can comprise invariant sequences.
- pseudorandom refers to a set of sequences, polynucleotide or polypeptide, that have limited variability, so that the degree of residue variability at some positions is limited, but any pseudorandom position is allowed at least some degree of residue variation.
- polypeptide As used herein interchangeably to refer to an amino acid sequence of two or more amino acids.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, ⁇ -carboxyglutamate, and O-phosp ⁇ osenne.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an ⁇ carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g. , norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
- Constant amino acid substitution refers to the interchangeability of residues having similar side chains.
- a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine
- a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine
- a group of amino acids having amide- containing side chains is asparagine and glutamine
- a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan
- a group of amino acids having basic side chains is lysine, arginine, and histidine
- a group of amino acids having sulfur- containing side chains is cysteine and methionine.
- nucleic acid sequence refers to a single or double- stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5' to the 3' end or an. analog thereof.
- encoding refers to a polynucleotide sequence encoding one or more amino acids. The term does not require a start or stop codon. An amino acid sequence can be encoded in any one of six different reading frames provided by a polynucleotide sequence.
- promoter refers to regions or sequence located upstream and/or downstream from the start of transcription that are involved in recognition and binding of RNA polymerase and other proteins to initiate transcription.
- a "vector” refers to a polynucleotide, which when independent of the host chromosome, is capable of replication in a host organism. Examples of vectors include plasmids. Vectors typically have an origin of replication. Vectors can comprise, e.g., transcription and translation terminators, transcription and translation initiation sequences, and promoters useful for regulation of the expression of the particular nucleic acid.
- recombinant' wnen use ⁇ witn reterence e.g., to a cell, or nucleic acid, protein, or vector
- the term "recombinant' wnen use ⁇ witn reterence, e.g., to a cell, or nucleic acid, protein, or vector indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified.
- recombinant cells express genes that are not found within the native
- nonrecombinant form of the cell or express native genes that are otherwise abnormally expressed, under-expressed or not expressed at all.
- the phrase "specifically (or selectively) binds" to a polypeptide when referring to a monomer or multimer, refers to a binding reaction that can be determinative of the presence of the polypeptide in a heterogeneous population of proteins (e.g., a cell or tissue lysate) and other biologies.
- the specified monomer or multimer binds to a particular target molecule above background (e.g., 2X, 5X, 1OX or more above background) and does not bind in a significant amount to other molecules present in the sample.
- nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same.
- substantially identical refers to two or more nucleic acids or polypeptide sequences having a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, or 95% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
- identity or substantial identity exists over a region that is at least about 50 nucleotides in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides or amino acids in length.
- a polynucleotide or amino acid sequence is "heterologous to" a second sequence if the two sequences are not linked in the same manner as found in naturally- occurring sequences.
- a promoter operably linked to a heterologous coding sequence refers to a coding sequence which is different from any naturally-occurring allelic variants.
- heterologous linker when used in reference to a multimer, indicates that the multimer comprises a linker and a monomer that are not found in the same relationship to each other in nature (e.g., they form a non-naturally occurring fusion protein).
- a "non-naturally-occurring amino acid" in a protein sequence refers to any amino acid other than the amino acid that occurs in the corresponding position in an alignment with a naturally-occurring polypeptide with the lowest smallest sum probability where the comparison window is the length of the monomer domain queried and when compared to a naturally-occuring sequence in the non-redundant ("nr") database of Genbank using BLAST 2.0 as described herein.
- Percentage of sequence identity is determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison and multiplying the result by 100 to yield the percentage of sequence identity.
- nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Such sequences are then said to be “substantially identical.” This definition also refers to the complement of a test sequence.
- identity exists over a region that is at least about 50 amino acids or nucleotides in length, or more preferably over a region that is 75-100 amino acids or nucleotides in length.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
- sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
- a “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Methods of alignment of sequences for comparison are well-known in the art.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. MoI. Biol.
- BLAST 2.0 algorithm is described in Altschul et al. (1990) J. MoI. Biol. 215:403-410, respectively.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/).
- HSPs high scoring sequence pairs
- T is referred to as the neighborhood word score threshold (Altschul et al., supra).
- initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them.
- the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative- scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm also performs a statistical analysis of the similarity between two sequences ⁇ see, e.g., Karlin and Altschul (1993) Proc. Natl. Acad. Sd. USA 90:5873-5787).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
- Figure 1 schematically illustrates the alignment of partial amino acid sequence from a variety of the LDL-receptor class A-domains to demonstrate the conserved cysteines.
- the connectivity of cysteines in the three disulfide bonds of the folded domain is illustrated schematically on the consensus sequence. Residues whose side-chains contribute to calcium binding are designated with an asterisk in the consensus sequence.
- FIG. 2 panel A schematically illustrates an example of an A-domain.
- Panel A schematically illustrates conserved amino acids in an A-domain of about 40 amino acids long. The conserved cysteine residues are indicated by C, and the conserved negatively charged amino acids are indicated by a circle with a minus ("-") sign. Circles with an "H” indicate conserved hydrophobic residues.
- Panel B schematically illustrates two folded A- domains connected via a linker. Panel B also indicates two calcium binding sites, dark circles with Ca +2 , and three disulfide bonds within each folded A-domain for a total of 6 disulfide bonds.
- Figure 3 indicates some of the ligands recognized by naturally- occurring members of the LDL-receptor family, which include inhibitors, proteases, protease complexes, vitamin-carrier complexes, proteins involved in lipoprotein metabolism, non- human ligands, antibiotics, viruses, and others.
- Figure 4 schematically illustrates a general scheme for identifying monomer domains that bind to a ligand, isolating the selected monomer domains, creating multimers of the selected monomer domains by joining the selected monomer domains in various combinations and screening the multimers to identify multimers comprising more than one monomer that binds to a ligand.
- FIG. 5 is a schematic representation of another selection strategy (guided selection).
- a monomer domain with appropriate binding properties is identified from a library of monomer domains.
- the identified monomer domain is then linked to monomer domains from another library of monomer domains to form a library of multimers.
- the multimer library is screened to identify a pair of monomer domains that bind simultaneously to the target. This process can then be repeated until the optimal binding properties are obtained in the multimer.
- Figure 6 depicts an alignment of A domains. At the top and the bottom of the figure, small letters (a-q) indicate conserved residues.
- Figure 7 illustrates various possible antibody-monomer or multimer conformations.
- the monomer or multimer replaces the Fab fragment of the antibody.
- Figure 8 depicts a possible conformation of a multimer of the invention comprising at least one monomer domain that binds to a half-life extending molecule and other monomer domains binding to one or optionally two or more target molecules.
- two monomer domains bind to two first target molecules.
- the two monomer domains can bind to different sites on one first target molecule (not depicted).
- Figure 9 shows a comparison between c-METFc, a c-MET-specific monomer (M26) and a c-MET-specific dimer (RM12; RecM12) with regards to their relative abilities to block HGF-induced proliferation of serum-starved A549-SC human lung adenocarcinoma cells.
- Figure 10 illustrates the serum half-life in monkeys of monomers that bind to IgG.
- the present invention provides for non-naturally-occurring proteins that bind to c-MET.
- the proteins of the present invention comprise a domain that binds to c-MET. These domains may be readily identified using a variety of polypeptide scaffolds to generate a plurality of polypeptide valiants and then selecting a variant that binds to c-MET.
- the present invention therefore also provides for selecting a protein that binds to c-MET. Proteins that bind c-MET are useful, e.g., for treating individuals with solid tumors that express c-MET.
- the polypeptides of the invention are also useful to detect tissues in which Met is expressed and can be used to target molecules to those tissues.
- c-MET is inactive in its resting monomer state and dimer formation results in receptor activation (often even in absence of ligand binding).
- the mature form of the receptor consists of a solely extracellular ⁇ chain and a longer ⁇ chain encompassing the remainder of the extracellular domain, a transmembrane domain and a cytoplasmic tail.
- the cytoplasmic tail contains the juxtamembrane domain, a kinase domain and docking sites for signaling intermediates.
- the ⁇ chain and the first 212 amino acids of the ⁇ chain also known as the Sema domain (Kong-Beltran, et al, Cancer Cell 6:75-84 (2004), are sufficient for binding to HGF.
- the polypeptides of the invention comprise at least one monomer domain that inhibits dimerization of c-MET ⁇ and ⁇ chains and/or functions as an antagonist to prevent ligands of c-MET from binding and/or activating c-MET.
- the present invention provides for polypeptides comprising single domains
- multimers of the domains may also be synthesized and used.
- all of the domains of the multimer bind c-MET.
- each of the domains are identical and bind to the same portion (i.e., "epitope") of c-MET.
- the monomer domains bind to the Sema domain of c-MET.
- at least some of the domains in the multimer bind to different portions of c-MET.
- at least some of the domains of the polypeptide bind to a molecule or molecules other than c-MET ⁇ e.g., a blood factor such as serum albumin, immunoglobulin, or erythrocytes).
- Monomer domains can be polypeptide chains of any size.
- monomer domains have about 25 to about 500, about 30 to about 200, about 30 to about 100, about 35 to about 50, about 35 to about 100, about 90 to about 200, about 30 to about 250, about 30 to about 60, about 9 to about 150, about 100 to about 150, about 25 to about 50, or about 30 to about 150 amino acids.
- a monomer domain of the present invention can comprise, e.g., from about 30 to about 200 amino acids; from about 25 to about 180 amino acids; from about 40 to about 150 amino acids; from about 50 to about 130 amino acids; or from about 75 to about 125 amino acids.
- Monomer domains can typically maintain a stable conformation in solution, and are often heat stable, e.g., stable at 95° C for at least 10 minutes without losing binding affinity. Sometimes, monomer domains can fold independently into a stable conformation.
- the stable conformation is stabilized by ions (e.g., such as metal or calcium ions).
- the stable conformation can optionally contain disulfide bonds (e.g., at least one, two, or three or more disulfide bonds). The disulfide bonds can optionally be formed between two cysteine residues.
- monomer domains, or monomer domain variants are substantially identical to the sequences exemplified.
- the invention provides monomer domains that bind to a c-MET polypeptide or a portion thereof.
- a portion of a polypeptide can be, e.g., at least 5, 10, 15, 20, 30, 50, 100, or more contiguous amino acids of the polypeptide.
- a large number of c-MET binding sequences having an A domain scaffold were generated. As described in detail in the examples, ten families ⁇ i.e., Families 1- 10, or "Fam 1-10") of monomer domains that bind to c-MET have been identified. The consensus motifs generated based on these families indicate common amino acid residues between c-MET binders.
- amino acid at "X" positions will be selected from amino acids in the analogous position of one of the exemplified c-MET binders either from the same family or a different family.
- Family 1 has the following consensus motif: Cxxx [EQ] FXCXSTXRC [ IV] xxxWxCDGDNDCEDxSDEx [89] Exemplary sequences comprising the c-MET Family 1 motif are displayed in the examples. References to c-MET binding monomers or multimers encompass each Family 1 sequence exemplified in the examples.
- Family 2 has the following motif: Cxxxx [EQ] FECXSTXRC [ IV] xxxWxCDGxNDCEDxSDEx [91] Exemplary sequences comprising the c-MET Family 2 motif are displayed in the examples. References to c-MET binding monomers or multimers encompass each Family 2 sequence exemplified in the examples.
- Family 4 has the following motif: Cxxx [EQ] FQCXSTXRC [ IV] PxxWxCDGxNDCEDSSDExxC
- Family 7 has the following motif: Cxxxx [EQ] FXCXSTXRC [ ILV] xxxWxCxxxxDCxDxSDxxxxxCx
- [102] Family 8 has the following motif: Cxxx [EQ] FxCxxxxxC [ ILV] xxxWxCDGxNDCxDxSxExxxxC
- Family 9 has the following motif: Cxxxx [EQ] FXCXSTXRC [ ILV] PxxWxCxGxxDCxDxSDEx
- Family 10 has the following motif: Cxxxx [EQ] FxCxxxxxC [ ILV] xxxWxCDGxxDCxDxSDEx which can be further condensed as:
- the invention further provide monomer domains that bind to a blood factor (e.g., serum albumin, immunoglobulin, or erythrocytes).
- a blood factor e.g., serum albumin, immunoglobulin, or erythrocytes.
- the monomer domains bind to an immunoglobulin polypeptide or a portion thereof.
- the present invention provides a method for extending the serum half- life of a protein, including, e.g., a multimer of the invention or a protein of interest in an animal.
- the protein of interest can be any protein with therapeutic, prophylactic, or otherwise desirable functionality.
- This method comprises first providing a monomer domain that has been identified as a binding protein that specifically binds to a half-life extender such as a blood-carried molecule or cell, such as serum albumin (e.g., human serum albumin), IgG, red blood cells, etc.
- the half-life extender-binding monomer is then covalently linked to another monomer domain that has a binding affinity for the protein of interest (e.g., c-MET or a different target).
- This complex formation results in the half-life extension protecting the multimer and/or bound protein(s) from proteolytic degradation and/or other removal of the multimer and/or protein(s) and thereby extending the half-life of the protein and/or multimer.
- One variation of this use of the invention includes the half-life extender-binding monomer covalently linked to the protein of interest.
- the protein of interest may include a monomer domain, a multimer of monomer domains, or a synthetic drug.
- monomers that bind to either immunoglobulins or erythrocytes could be generated using the above method and could be used for half-life extension.
- the half-life extender-binding multimers are typically multimers of at least two domains, chimeric domains, or mutagenized domains (i.e., one that binds to Met and one that binds to the blood-carried molecule or cell). Suitable domains include all of those described herein, that are further screened and selected for binding to a half-life extender.
- the half-life extender-binding multimers are generated in accordance with the methods for making multimers described herein, using, for example, monomer domains pre- screened for half-life extender -binding activity.
- the serum half-life of a molecule can be extended to be, e.g., at least 1, 2, 3, 4, 5, 10, 20, 30, 40, 50, 60, 70 80, 90, 100, 150, 200, 250, 400, 500 or more hours.
- cysteine-rich domains comprising disulfide bonds.
- Cysteine-rich domains employed in the practice of the present invention typically do not form an ⁇ helix, a ⁇ sheet, or a ⁇ -barrel structure.
- the disulfide bonds promote folding of the domain into a three-dimensional structure.
- cysteine-rich domains have at least two disulfide bonds, more typically at least three disulfide bonds. In some embodiments, at least 5, 10, 15 or 20% of the amino acids in a monomer domain are cysteines.
- Domains can have any number of characteristics.
- the domains have low or no immunogenicity in an animal (e.g., a human). Domains can have a small size. In some embodiments, the domains are small enough to penetrate skin or other tissues. Domains can have a range of in vivo half-lives or stabilities.
- Illustrative monomer domains suitable for use in the practice of the present invention include, e.g., an EGF-like domain, a Kringle-domain, a f ⁇ bronectin type I domain, a fibronectin type II domain, a fibronectin type III domain, a PAN domain, a GIa domain, a SRCR domain, a Kunitz/Bovine pancreatic trypsin Inhibitor domain, a Kazal-type serine protease inhibitor domain, a Trefoil (P-type) domain, a von Willebrand factor type C domain, an Anaphylatoxin-like domain, a CUB domain, a thyroglobulin type I repeat, LDL- receptor class A domain, a Sushi domain, a Link domain, a Thrombospondin type I domain, an Immunoglobulin-like domain, a C-type lectin domain, a MAM domain, a von Willebrand factor type A domain,
- suitable monomer domains can be selected from the families of protein domains that contain ⁇ -sandwich or ⁇ -barrel three dimensional structures as defined by such computational sequence analysis tools as Simple Modular Architecture Research Tool (SMART), see Shultz et al, SMART: a web-based tool for the study of genetically mobile domains, (2000) Nucleic Acids Research 28(1):231-234) or CATH (see Pearl et.al, Assigning genomic sequences to CATH, (2000) Nucleic Acids Research 28(l):277-282).
- SMART Simple Modular Architecture Research Tool
- monomer domains of the present invention include domains other than a fibronectin type III domain, an anticalin domain and a Ig-like domain from CTLA-4. Some aspects of these domains are described in WOO 1/64942 entitled “Protein scaffolds for antibody mimics and other binding proteins” by Lipovsek et al., published on September 7, 2001 , WO99/16873 entitled “Anticalins” by Beste et al., published April 8, 1999 and WO 00/60070 entitled "A polypeptide structure for use as a scaffold” by Desmet, et al., published on October 12, 2000. [123] As described supra, monomer domains are optionally cysteine rich.
- Suitable cysteine rich monomer domains include, e.g., the LDL receptor class A domain ("A- domain") or the EGF domain.
- the monomer domains can also have a cluster of negatively charged residues.
- Other features of monomer domains can include the ability to bind ligands or the ability to bind an ion (e.g., Ca 2+ binding by the LDL receptor A-domain).
- Monomer domains that bind ions to maintain their secondary structure include, e.g., A domain, EGF domain, EF Hand (e.g., such as those found in present in calmodulin and troponin C), Cadherin domain, C-type lectin, C2 domain, Annexin, Gla-domain, Trombospondin type 3 domain, all of which bind calcium, and zinc fingers (e.g., C2H2 type C3HC4 type (RING finger), Integrase Zinc binding domain, PHD finger, GATA zinc finger, FYVE zinc finger, B-box zinc finger), which bind zinc.
- ion-binding provides stability of secondary structure while providing sufficient flexibility to allow for numerous binding conformations depending on primary sequence.
- monomer domains may be selected for the ability to bind to targets other than the target that a homologous naturally occurring domain may bind.
- the invention provides monomer domains (and multimers comprising such monomers) that do not bind to the target or the class or family of target proteins that a substantially identical naturally occurring domain may bind.
- Characteristics of a monomer domain can include the ability to fold independently and the ability to form a stable structure.
- the structure of the monomer domain is often conserved, although the polynucleotide sequence encoding the monomer need not be conserved.
- the A-domain structure is conserved among the members of the A-domain family, while the A-domain nucleic acid sequence is not.
- a monomer domain is classified as an A-domain by its cysteine residues and its affinity for calcium, not necessarily by its nucleic acid sequence. See, Figures 1 and 2.
- the A-domains (sometimes called "complement-type repeats” or “LDL receptor type or class A domains") contain about 30-50 or 30-65 amino acids. In some embodiments, the domains comprise about 35-45 amino acids and in some cases about 40 amino acids. Within the 30-50 amino acids, there are about 6 cysteine residues. Of the six cysteines, disulfide bonds typically are found between the following cysteines: Cl and C3, C2 and C5, C4 and C6. The cysteine residues of the domain are disulfide linked to form a compact, stable, functionally independent moiety. See, Figure 3. Clusters of these repeats make up a ligand binding domain, and differential clustering can impart specificity with respect to the ligand binding.
- a domain sequences and consensus sequences are depicted in Figures 1 and 2.
- One typical consensus sequence useful to identify A domains is the following: C-[VILMA]-X (5r C-[DNH]-X (3) -[DENQHT]-C-X (3 , 4) -[STADE]- [DEH]-[DE]- X ( i (5) -C, where the residues in brackets indicate possible residues at one position. "X( # >" indicates number of residues. These residues can be any amino acid residue.
- a domain variants comprise sequences substantially identical to any of the above-described sequences. Note that reference to "LDL receptor class A" domain, for the purposes of this invention, is not intended to indicate origin or binding properties of the domain.
- Additional exemplary A domains include the following sequence:
- Naturally-occurring human A-domains are identified based on cDNA sequences. See, e.g., Figure 6.
- Exemplary proteins containing naturally-occurring A-domains include, e.g., complement components (e.g., C6, C7, C8, C9 5 and Factor I), serine proteases (e.g., enteropeptidase, matriptase, and corin), transmembrane proteins (e.g., ST7, LRP3, LRP5 and LRP6) and endocytic receptors (e.g., Sortilin-related receptor, LDL-receptor, VLDLR, LRPl, LRP2, and ApoER2).
- complement components e.g., C6, C7, C8, C9 5 and Factor I
- serine proteases e.g., enteropeptidase, matriptase, and corin
- transmembrane proteins e.g., ST7, LRP3, LRP5 and
- a domains and A domain variants can be readily employed in the practice of the present invention as monomer domains and variants thereof. Further description of A domains can be found in the following publications and references cited therein: Howell and Hertz, The LDL receptor gene family: signaling functions during development, (2001) Current Opinion in Neurobiology . 11:74-81; Herz (2001), supra; Krieger, The "best” ofcholesterols, the “worst” of cholesterols: A tale of two receptors, (1998) PNAS 95: 4077-4080; Goldstein and Brown, The Cholesterol quartet, (2001) Science.
- EGF monomer domains include the sequence:
- Each of the domains described below employ exemplary motifs (z. e. , scaffolds). Certain positions are marked x, indicating that any amino acid can occupy the position. These positions can include a number of different amino acid possibilities, thereby allowing for sequence diversity and thus affinity for different target molecules.
- brackets in motifs indicates alternate possible amino acids within a position (e.g., "[ekq]” indicates that either E, K or Q may be at that position).
- Use of parentheses in a motif indicates that that the positions within the parentheses may be present or absent (e.g., "([ekq])” indicates that the position is absent or either E, K, or Q may be at that position).
- each x represents a possible position.
- each amino acid is independently selected from any amino acid
- ⁇ represents an aromatic/hydrophobic amino acid such as, e.g., W, Y, F, or L
- ⁇ represents a hydrophobic amino acid such as, e.g., V, I, L, A, M, or F
- ⁇ represents a smallor polar amino acid such as, e.g., G, A, S, or T
- ⁇ represents a charged amino acid such as, e.g., K, R, E, Q, or D
- ⁇ represents a small amino acid such as, e.g.,; V, A, S, or T
- ⁇ represents a negatively charged amino acid such as, e.g., D, E, or N.
- Suitable domains include, e.g. thrombospondin type 1 domains, trefoil domains, and thyroglobulin domains.
- Thrombospondin type 1 (“TSP 1 ”) domains contain about 30-50 or 30- 65 amino acids. Li some embodiments, the domains comprise about 35-55 amino acids and in some cases about 50 amino acids. Within the 35-55 amino acids, there are typically about 4 to about 6 cysteine residues. Of the six cysteines, disulfide bonds typically are found between the following cysteines: Cl and C5, C2 and C6, C3 and C4. The cysteine residues of the domain are disulfide linked to form a compact, stable, functionally independent moiety comprising distorted beta strands. Clusters of these repeats make up a ligand binding domain, and differential clustering can impart specificity with respect to the ligand binding.
- TSPl domain sequences and consensus sequences are as follows: (1) (XXXXXX)C 1 XXXC 2 XXXXX(X)XXXXXC 3 XXXX(XXX)XXXXXC 4 XXXXx(X)XXxCs(X)XXXxCg;
- thrombospondin type 1 domain variants comprise sequences substantially identical to any of the above-described sequences.
- proteins containing the naturally occurring thrombospondin domains include, e.g., proteins in the complement pathway (e.g., properdin, C6, C7, C8A, C8B, and C9), extracellular matrix proteins (e.g., mindin, F- spondin, SCO-spondin,), circumsporozoite surface protein 2, and TRAP proteins of Plasmodium.
- Thrombospondin type 1 domains are further described in, e.g., Roszmusz et al, BBRC 296:156 (2002); Higgins et al, J Immunol. 155:5777-85 (1995); Schultz-Cherry et ⁇ /., J. Biol. Chem. 270:7304-7310 (1995); Schultz-Cherry et al., J. Biol. Chem. 269:26783-8 (1994); Bork, FEBS Lett 327:125-30 (1993); and Leung-Hagesteijn et al, Cell 71 :289-99 (1992).
- Trefoil monomer domains are typically about about 30-50 or 30-65 amino acids, hi some embodiments, the domains comprise about 35-55 amino acids and in some cases about 45 amino acids. Within the 35-55 amino acids, there are typically about 6 cysteine residues. Of the six cysteines, disulfide bonds typically are found between the following cysteines: Cl and C5, C2 and C4, C3 and C6.
- proteins containing naturally occurring trefoil domains include, e.g., protein pS2 (TFFl), spasmolytic peptide SP (TFF2), intestinal trefoil factor (TFF3), intestinal surcease-isomaltase, and proteins which may be involved in defense against microbial infections by protecting the epithelia (e.g.,Xenopus xPl, xP4, integumentary mucins A.I and Cl.
- Trefoil domains are further described in, e.g., Sands and Podolsky, Amu. Rev. Physiol.
- Exemplary trefoil domain sequences and consensus sequences are as follows: ( 1 ) C 1 (XX)XXXXXXXXC 2 XX(X)XXXXXC 3 XXXC 4 C 5 XXXXx(X)XXXXxCe (2) C 1 (XX)XXXXXRXC 2 XX(X)XXXXXXC 3 XXXXC 4 CSXXXX(X)XXXXC 6
- Thyroglobulin domain Another exemplary monomer domain suitable for use in the present invention is the thyroglobulin domain.
- Thyroglobulin monomer domains are typically about 30-85 or 30-80 amino acids. In some embodiments, the domains comprise about 35-75 amino acids and in some cases about 65 amino acids. Within the 35-75 amino acids, there are typically about 6 cysteine residues. Of the six cysteines, disulfide bonds typically are found between the following cysteines: Cl and C2, C3 and C4, C5 and C6. [143] To date at least 251 naturally occurring thyroglobulin domains have been identified based on cDNA sequences.
- Tg contains 10 repeats of a domain of about 65 amino acids which is known as the Tg type-1 repeat PUBMED:3595599, PUBMED:8797845.
- Exemplary proteins containing naturally occurring thyroglobulin domains include e.g., the HLA class II associated invariant chain, human pancreatic carcinoma marker proteins, nidogen (entactin), insulin-like growth factor binding proteins (IGFBP), saxiphilin, chum salmon egg cysteine proteinase inhibitor, and equistatin.
- the Thyr-1 and related domains belong to MEROPS proteinase inhibitor family 131, clan IX.
- Thyroglobulin domains are further described in, e.g., Molina et al, Eur. J. Biochem. 240:125- 133 (1996); Guncar et al, EMBO J 18:793-803 (1999); Chong and Speicher, D W 276:5804- 5813 (2001).
- Laminin-EGF domains are typically about 30-85 or 30- 80 amino acids. In some embodiments, the domains comprise about 45-65 amino acids and in some cases about 50 amino acids. Within the 45-65 amino acids, there are typically about 8 cysteine residues which interact to form 4 disulfide bonds.
- Laminins are a major noncollagenous component of basement membranesthat mediate cell adhesion, growth migration, and differentiation. They are composed of distinct but related alpha, beta, and gamma chains. The three chains form a cross-shaped molecule that consist of a long arm and three short globular arms. The long arm consist of a coiled coil structure contributed by all three chains and cross-linked by interchain disulphide bonds.
- the monomer domain is a Notch/LNR monomer domain, a DSL monomer domain, an Anato monomer domain, an integrin beta monomer domain, and a Ca-EGF monomer domain.
- the Ca-EGF monomer domain comprises the following sequence: DXdEC 1 XX(XX)XXXXC 2 X(XX)XXXXC 3 XNXXGXfXC 4 X(XXX)XC 5 XXgXXXXXXx(XXXx)XXxC 6 .
- the Notch/LNR monomer domain comprises the following sequence: C 1 xx(xx)xxxC2XxxxxnGxC 3 xxxC 4 nxxxC 5 xxDGxDC 6
- the DSL monomer domain comprises the following sequence: C 1 XXx YygxxC 2 xxfC 3 xxxxdxxxhxxC 4 xxxGxxxC 5 xxGWxGxxC 6 .
- Anato monomer domain comprises the following sequence: C 1 C 2 xdgxxxxx(x)xxxxC 3 exrxxxxxx(xx)xxC 4 xxxfxxC 5 C 6 .
- the integrin beta monomer domain comprises the following sequence: C 1 xxC 2 xxxxpxC 3 xwC4xxxxfxxx(gx)xxxxRC 5 dxxxxLxxxgC 6 ; and "x" is any amino acid.
- C 1 -C 5 , C 2 -C 4 and C 3 -C 6 of the Notch/LNR monomer domain form disulfide bonds; and C 1 -C 5 , C 2 -C 4 and C 3 -C 6 of the DSL monomer domain form disulfide bonds.
- the Ca-EGF monomer domain comprises the following sequence:
- the Notch/LNR monomer domain comprises the following sequence: C] . xx(x[ ⁇ ⁇ ])xxxC 2 x[ ⁇ s]xxx[ ⁇ ][Gk]xC 3 [nd]x[ ⁇ sa]C 4 [ ⁇ s]xx[aeg]C 5 x[ ⁇ ]DGxDC 6 .
- the DSL monomer domain comprises the following sequence: C 1 XXX[OC] [ ⁇ h] [Gsna]xxC 2 xx[ ⁇ ] C 3 x[pae]xx[Da]xx[ ⁇ l] [Hrgk] [ ⁇ k]xC 4 [dnsg]xxGxxxC 5 xx
- the Anato monomer domain comprises the following sequence:
- the integrin beta monomer domain comprises the following sequence: C ! XxC 2 [P]xx[ghds] [Pk]xC 3 [ ⁇ ] [ ⁇ ] C 4 xxxx[ ⁇ ]xxx([Gr]xx)x[ ⁇ ]xRC 5 [Dnae]xxxxL[ ⁇ k]xx[G n]C 6 ; ⁇ is selected from: w, y, f, and 1; ⁇ is selected from: v, 1, 1, a, m, and f; ⁇ is selected from: g, a, s, and t; ⁇ is selected from: k, r, e, q, and d; ⁇ is selected from: v, a, s, and t; and ⁇ is selected from: d, e, and n.
- the Ca-EGF monomer domain comprises the following sequence:
- the Notch/LNR monomer domain comprises the following sequence: C 1 xx(x[yiflv])xxxC 2 x[dens]xxx[Nde][Gk]xC 3 [nd]x[densa]C 4 [Nsde]xx[aeg]C 5 x[wyfJDGx
- the DSL monomer domain comprises the following sequence:
- the Anato monomer domain comprises the following sequence:
- the integrin beta monomer domain comprises the following sequence:
- Polynucleotides encoding the monomer domains are typically employed to make monomer domains via expression.
- Nucleic acids that encode monomer domains can be derived from a variety of different sources.
- Libraries of monomer domains can be prepared by expressing a plurality of different nucleic acids encoding naturally occurring monomer domains, altered monomer domains (i.e., monomer domain variants), or a combinations thereof.
- libraries may be designed in which a scaffold of amino acids remain constant (e.g., an LDL A receptor domain, EGF domain) while the intervening amino acids in the scaffold comprise randomly generated amino acids.
- the invention provides methods of identifying monomer domains that bind to a selected or desired ligand or mixture of ligands.
- monomer domains are identified or selected for a desired property (e.g., binding affinity) and then the monomer domains are formed into multimers. See, e.g., Figure 4.
- a desired property e.g., binding affinity
- any method resulting in selection of domains with a desired property e.g., a specific binding property
- the methods can comprise providing a plurality of different nucleic acids, each nucleic acid encoding a monomer domain; translating the plurality of different nucleic acids, thereby providing a plurality of different monomer domains; screening the plurality of different monomer domains for binding of the desired ligand or a mixture of ligands; and, identifying members of the plurality of different monomer domains that bind the desired ligand or mixture of ligands.
- Monomer domains can be naturally-occurring or altered (non-natural variants). The term "naturally occurring" is used herein to indicate that an object can be found in nature.
- natural monomer domains can include human monomer domains or optionally, domains derived from different species or sources, e.g., mammals, primates, rodents, fish, birds, reptiles, plants, etc.
- the natural occurring monomer domains can be obtained by a number of methods, e.g., by PCR amplification of genomic DNA or cDNA.
- Monomer domains of the present invention can be naturally-occurring domains or non-naturally occurring variants.
- Libraries of monomer domains employed in the practice of the present invention may contain naturally-occurring monomer domain, non- naturally occurring monomer domain variants, or a combination thereof.
- Monomer domain variants can include ancestral domains, chimeric domains, randomized domains, mutated domains, and the like.
- ancestral domains can be based on phylogenetic analysis.
- Chimeric domains are domains in which one or more regions are replaced by corresponding regions from other domains of the same family.
- chimeric domains can be constructed by combining loop sequences from multiple related domains of the same family to form novel domains with potentially lowered immunogenicity .
- Those of skill in the art will recognized the immunologic benefit of constructing modified binding domain monomers by combining loop regions from various related domains of the same family rather than creating random amino acid sequences.
- the resulting domains may contain novel binding properties but may not contain any immunogenic protein sequences because all of the exposed loops are of human origin.
- the combining of loop amino acid sequences in endogenous context can be applied to all of the monomer constructs of the invention.
- the present invention provides a method for generating a library of chimeric monomer domains derived from human proteins, the method comprising: providing loop sequences corresponding to at least one loop from each of at least two different naturally occurring variants of a human protein, wherein the loop sequences are polynucleotide or polypeptide sequences; and covalently combining loop sequences to generate a library of at least two different chimeric sequences, wherein each chimeric sequence encodes a chimeric monomer domain having at least two loops.
- the chimeric domain has at least four loops, and usually at least six loops.
- the present invention provides three types of loops that are identified by specific features, such as, potential for disulfide bonding, bridging between secondary protein structures, and molecular dynamics (i.e., flexibility).
- the three types of loop sequences are a cysteine-defmed loop sequence, a structure-defined loop sequence, and a B-factor-defmed loop sequence.
- Randomized domains are domains in which one or more regions are randomized.
- the randomization can be based on full randomization, or optionally, partial randomization based on natural distribution of sequence diversity.
- the present invention also provides recombinant nucleic acids encoding one or more polypeptides comprising one or a plurality of monomer domains that bind c-MET.
- the polypeptide can be selected to comprise a non-naturally occuring domain from the group consisting of: an EGF-like domain, a Kringle-domain, a fibronectin type I domain, a fibronectin type II domain, a fibronectin type III domain, a PAN domain, a GIa domain, a SRCR domain, a Kunitz/Bovine pancreatic trypsin Inhibitor domain, a Kazal-type serine protease inhibitor domain, a Trefoil (P-type) domain, a von Willebrand factor type C domain, an Anaphylatoxin-like domain, a CUB domain, a thyroglobulin type I repeat, LDL-receptor class A domain, a Sushi domain, a Link domain, a
- compositions of the present invention including the compositions produced by the methods of the present invention, e.g., monomer domains and/or immuno-domains, as well as multimers and libraries thereof can be optionally bound to a matrix of an affinity material.
- affinity material include beads, a column, a solid support, a microarray, other pools of reagent-supports, and the like.
- Multimers comprise at least two monomer domains.
- multimers of the invention can comprise from 2 to about 10 monomer domains, from 2 and about 8 monomer domains, from about 3 and about 10 monomer domains, about 7 monomer domains, about 6 monomer domains, about 5 monomer domains, or about 4 monomer domains.
- the multimer comprises 3 or at least 3 monomer domains.
- the mutimers have no more than 2, 3, 4, 5, 6, 7, or 8 monomer domains.
- the multimers of the invention may be, e.g., less than 100 kD, less than 9OkD, less than 8OkD, less than 7OkD, less than 6OkD, less than 50kd, less than 4OkD, less than 3OkD, less than 25kD, less than 2OkD, less than 15kD, less than 1 OkD or may be smaller or larger.
- the monomer domains have been pre-selected for binding to the target molecule of interest (e.g., Met).
- each monomer domain specifically binds to one target molecule (e.g., c-Met). In some of these embodiments, each monomer binds to a different position (analogous to an epitope) on a target molecule. Multiple monomer domains that bind to the same target molecule results in an avidity effect resulting in improved affinity of the multimer for the target molecule compared to the affinity of each individual monomer. In some embodiments, the multimer has an avidity of at least about 1.5, 2, 3, 4, 5, 10, 20, 50, 100, 200, 500, or 1000 times the avidity of a monomer domain alone.
- At least one, two, three, four or more (e.g., all) monomers of a multimer bind an ion such as calcium or another ion.
- Multimers can comprise a variety of combinations of monomer domains.
- the selected monomer domains can be identical or different.
- the selected monomer domains can comprise various different monomer domains from the same monomer domain family, or various monomer domains from different domain families , or optionally, a combination of both.
- the monomer domains may be selected from Families 1 - 10 of c-Met binding monomer domains.
- at least one of the monomer domains is selected from from Family 10 of the c-Met binding monomer domains. Exemplary c-MET-binding dimers (comprised of two c-MET-binding monomers) are listed in the examples. [173]
- Multimers that are generated in the practice of the present invention may be any of the following:
- a homo-multimer (a multimer of the same domain, i.e., Al-Al-Al-Al);
- hetero-multimer include multimers where Al, A2, A3 and A4 are different non-naturally occurring variants of a particular LDL-receptor class A domains, or where some of Al, A2, A3, and A4 are naturally-occurring variants of a LDL-receptor class A domain.
- a hetero-multimer of domains from different monomer domain classes e.g., Al- B2-A2-B1.
- Al and A2 are two different monomer domains (either naturally occurring or non-naturally-occurring) from LDL-receptor class A
- Bl and B2 are two different monomer domains (either naturally occurring or non-naturally occurring) from class EGF-like domain).
- the multimer comprises monomer domains with specificities for different target molecules (e.g., a blood factor such as serum albumin, immunoglobulin, or erythrocytes).
- a blood factor such as serum albumin, immunoglobulin, or erythrocytes.
- the multimers of the invention comprises 1, 2, 3, or more monomer domains that bind to Met and at least one monomer domain that binds to a second target molecule.
- Exemplary target molecules include, e.g., a serum molecule that extends the serum half-life of the multimer (e.g., an immunoglobulin or serum albumin), EGFR gene family members, VEGF receptors, PDGF receptor, other receptor tyrosine kinases, integrins, other molecules implicated in tumorigenesis, or markers of tumor tissue.
- Exemplary molecule that extends the serum half- life of a multimer include, e.g., red blood cells (i.e., erythrocytes), IgG, and serum albumin such as HSA.
- An exemplary multimer will include a monomer domain from Family 10 of the c-MET binding monomer domains and monomer domain from Family 2 or 3 of the immunoglobulin binding monomer domains.
- Multimer libraries employed in the practice of the present invention may contain homo-multimers, hetero-multimers of different monomer domains (natural or non-natural) of the same monomer class, or hetero-multimers of monomer domains (natural or non-natural) from different monomer classes, or combinations thereof.
- Multimers of the present invention may have at least one immuno-domain such as a minibody, a single-domain antibody, a single chain variable fragment (ScFv), or a Fab fragment; and at least one monomer domain, such as, for example, an EGF-like domain, a Kringle-domain, a fibronectin type I domain, a fibronectin type II domain, a fibronectin type III domain, a PAN domain, a GIa domain, a SRCR domain, a Kunitz/Bovine pancreatic trypsin Inhibitor domain, a Kazal-type serine protease inhibitor domain, a Trefoil (P-type) domain, a von Willebrand factor type C domain, an Anaphylatoxin-like domain, a
- Domains need not be selected before the domains are linked to form multimers.
- the domains can be selected for the ability to bind to a target molecule before being linked into multimers.
- a multimer can comprise two domains that bind to one target molecule and a third domain that binds to a second target molecule.
- the multimers of the present invention may have the following qualities: multivalent, multispecific, single chain, heat stable, extended serum and/or shelf half-life. Moreover, at least one, more than one or all of the monomer domains may bind an ion (e.g., a metal ion or a calcium ion), at least one, more than one or all monomer domains may be derived from LDL receptor A domains and/or EGF-like domains, at least one, more than one or all of the monomer domains may be non-naturally occurring, and/or at least one, more than one or all of the monomer domains may comprise 1, 2, 3, or 4 disulfide bonds per monomer domain.
- an ion e.g., a metal ion or a calcium ion
- at least one, more than one or all monomer domains may be derived from LDL receptor A domains and/or EGF-like domains
- at least one, more than one or all of the monomer domains may be non-natural
- the multimers comprise at least two (or at least three) monomer domains, wherein at least one monomer domain is a non-naturally occurring monomer domain and the monomer domains bind calcium. In some embodiments, the multimers comprise at least 4 monomer domains, wherein at least one monomer domain is non-naturally occurring, and wherein: a. each monomer domain is between 30-100 amino acids and each of the monomer domains comprise at least one disulfide linkage; or b. each monomer domain is between 30-100 amino acids and is derived from an extracellular protein; or c. each monomer domain is between 30-100 amino acids and binds to a protein target.
- the multimers comprise at least 4 monomer domains, wherein at least one monomer domain is non-naturally occurring, and wherein: a. each monomer domain is between 35-100 amino acids; or b. each domain comprises at least one disulfide bond and is derived from a human protein and/or an extracellular protein.
- the multimers comprise at least two monomer domains, wherein at least one monomer domain is non-naturally occurring, and wherein each domain is: a. 25-50 amino acids long and comprises at least one disulfide bond; or b. 25-50 amino acids long and is derived from an extracellular protein; or c. 25-50 amino acids and binds to a protein target; or d. 35-50 amino acids long.
- the multimers comprise at least two monomer domains, wherein at least one monomer domain is non-naturally-occurring and: a. each monomer domain comprises at least one disulfide bond; or b. at least one monomer domain is derived from an extracellular protein; or c. at least one monomer domain binds to a target protein.
- the monomer domains and/or multimers identified can have biological activity, which is meant to include at least specific binding affinity for a selected or desired ligand, and, in some instances, will further include the ability to block the binding of other compounds, to stimulate or inhibit metabolic pathways, to act as a signal or messenger, to stimulate or inhibit cellular activity, and the like.
- Monomer domains can be generated to function as ligands for receptors where the natural ligand for the receptor has not yet been identified (orphan receptors). These orphan ligands can be created to either block or activate the receptor top which they bind.
- a single ligand can be used, or optionally a variety of ligands can be used to select the monomer domains and/or multimers.
- a monomer domain of the present invention can bind a single ligand or a variety of ligands.
- a multimer of the present invention can have multiple discrete binding sites for a single ligand, or optionally, can have multiple binding sites for a variety of ligands.
- the multimer comprises monomer domains with specificities for different proteins.
- the different proteins can be related or unrelated. Examples of related proteins including members of a protein family or different serotypes of a virus.
- the monomer domains of a multimer can target different molecules in a physiological pathway (e.g., different blood coagulation proteins).
- monomer domains bind to proteins in unrelated pathways (e.g., two domains bind to blood factors, two other domains bind to inflammation-related proteins and a fifth binds to serum albumin),
- a multimer is comprised of monomer domains that bind to different pathogens or contaminants of interest. Such multimers are useful as a single detection agent capable of detecting for the possibility of any of a number of pathogens or contaminants.
- the multimers of the invention bind to the same or other multimers to form aggregates.
- Aggregation can be mediated, for example, by the presence of hydrophobic domains on two monomer domains, resulting in the formation of non-covalent interactions between two monomer domains.
- aggregation may be facilitated by one or more monomer domains in a multimer having binding specificity for a monomer domain in another multimer.
- Aggregates can also form due to the presence of affinity peptides on the monomer domains or multimers. Aggregates can contain more target molecule binding domains than a single multimer.
- Multimers with affinity for both a cell surface target and a second target may provide for increased avidity effects.
- membrane fluidity can be more flexible than protein linkers in optimizing (by self-assembly) the spacing and valency of the interactions, hi some cases, multimers will bind to two different targets, each on a different cell or one on a cell and another on a molecule with multiple binding sites.
- the monomers or multimers of the present invention are linked to another polypeptide to form a fusion protein.
- Any polypeptide in the art may be used as a fusion partner, though it can be useful if the fusion partner forms multimers.
- monomers or multimers of the invention may, for example, be fused to the following locations or combinations of locations of an antibody:
- one or more monomer or multimer domains of the invention is linked to a molecule (e.g., a protein, nucleic acid, organic small molecule, etc.) useful as a pharmaceutical.
- a molecule e.g., a protein, nucleic acid, organic small molecule, etc.
- exemplary pharmaceutical proteins include, e.g., cytokines, antibodies, chemokines, growth factors, interleukins, cell-surface proteins, extracellular domains, cell surface receptors, cytotoxins, etc.
- Exemplary small molecule pharmaceuticals include toxins or therapeutic agents.
- a metal can be bound to the polypeptides of the invention. This can be useful, e.g., as a contrast agent, e.g., for MRI.
- the monomer or multimers are selected to bind to a tissue- or disease-specific target protein.
- Tissue-specific proteins are proteins that are expressed exclusively, or at a significantly higher level, in one or several particular tissue(s) compared to other tissues in an animal.
- monomer domains that bind to Met may be used to target other molecules, including other monomer domains, to the liver. This may be used to target liver-specific diseases, for example, by targeting therapeutic or toxic molecules to the liver.
- An example of a liver disease that can be treated is hepatocellular carcinoma.
- disease-specific proteins are proteins that are expressed exclusively, or at a significantly higher level, in one or several diseased cells or tissues compared to other non-diseased cells or tissues in an animal.
- the monomers or multimers that bind to the target protein are linked to the pharmaceutical protein or small molecule such that the resulting complex or fusion is targeted to the specific tissue or disease-related cell(s) where the target protein (e.g., c-MET) is expressed.
- Monomers or multimers for use in such complexes or fusions can be initially selected for binding to the target protein and may be subsequently selected by negative selection against other cells or tissue (e.g., to avoid targeting bone marrow or other tissues that set the lower limit of drug toxicity) where it is desired that binding be reduced or eliminated in other non-target cells or tissues.
- the therapeutic window is increased so that a higher dose may be administered safely.
- in vivo panning can be performed in animals by injecting a library of monomers or multimers into an animal and then isolating the monomers or multimers that bind to a particular tissue or cell of interest.
- the fusion proteins described above may also include a linker peptide between the pharmaceutical protein and the monomer or multimers.
- a peptide linker sequence may be employed to separate, for example, the polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures.
- Fusion proteins may generally be prepared using standard techniques, including chemical conjugation. Fusion proteins can also be expressed as recombinant proteins in an expression system by standard techniques.
- Multimers or monomer domains of the invention can be produced according to any methods known in the art.
- E. coli comprising a pET- derived plasmid encoding the polypeptides are induced to express the protein. After harvesting the bacteria, they may be lysed and clarified by centrifugation. The polypeptides may be purified using Ni-NTA agarose elution and refolded by dialysis. Misfolded proteins may be neutralized by capping free sulfhydrils with iodoacetic acid.
- Q sepharose elution, butyl sepharose flow-through, SP sepharose elution, DEAE sepharose elution, and/or CM sepharose elution may be used to purify the polypeptides.
- Equivalent anion and/or cation exchange purification steps may also be employed.
- the polypeptide comprising a monomer or multimer of the invention is linked to itself (C-terminus to N-terminus), e.g., for proteion stability.
- Monomer domains can be joined by a linker to form a multimer.
- a linker may be positioned between each separate discrete monomer domain in a multimer.
- Joining the selected monomer domains via a linker can be accomplished using a variety of techniques known in the art. For example, combinatorial assembly of polynucleotides encoding selected monomer domains can be achieved by restriction digestion and re-ligation, by PCR-based, self-priming overlap reactions, or other recombinant methods.
- the linker can be attached to a monomer before the monomer is identified for its ability to bind to a target multimer or after the monomer has been selected for the ability to bind to a target multimer.
- the linker can be naturally-occurring, synthetic or a combination of both.
- the synthetic linker can be a randomized linker, e.g., both in sequence and size.
- the randomized linker can comprise a fully randomized sequence, or optionally, the randomized linker can be based on natural linker sequences.
- the linker can comprise, e.g,. a non-polypeptide moiety, a polynucleotide, a polypeptide or the like.
- a linker can be rigid, or flexible, or a combination of both. Linker flexibility can be a function of the composition of both the linker and the monomer domains that the linker interacts with.
- the linker joins two selected monomer domain, and maintains the monomer domains as separate discrete monomer domains.
- the linker can allow the separate discrete monomer domains to cooperate yet maintain separate properties such as multiple separate binding sites for the same ligand in a multimer, or e.g., multiple separate binding sites for different ligands in a multimer.
- Choosing a suitable linker for a specific case where two or more monomer domains (i.e. polypeptide chains) are to be connected may depend on a variety of parameters including, e.g.
- the present invention provides methods for optimizing the choice of linker once the desired monomer domains/variants have been identified.
- libraries of multimers having a composition that is fixed with regard to monomer domain composition, but variable in linker composition and length can be readily prepared and screened as described above.
- linkers can be found in, e.g., U.S. Patent
- a TARGETMOLECULE [201] Those of skill in the art can readily identify monomer domains with a desired property (e.g., binding affinity). For those embodiments, any method resulting in selection of domains with a desired property (e.g., a specific binding property) can be used.
- the methods can comprise providing a plurality of different nucleic acids, each nucleic acid encoding a monomer domain; translating the plurality of different nucleic acids, thereby providing a plurality of different monomer domains; screening the plurality of different monomer domains for binding of the desired ligand or a mixture of ligands; and, identifying members of the plurality of different monomer domains that bind the desired ligand or mixture of ligands.
- any method of mutagenesis such as site-directed mutagenesis and random mutagenesis (e.g., chemical mutagenesis) can be used to produce monomer domains, e.g., for a monomer domain library.
- error-prone PCR is employed to create variants. Additional methods include aligning a plurality of naturally occurring monomer domains by aligning conserved amino acids in the plurality of naturally occurring monomer domains; and, designing the non-naturally occurring monomer domain by maintaining the conserved amino acids and inserting, deleting or altering amino acids around the conserved amino acids to generate the non-naturally occurring monomer domain.
- the conserved amino acids comprise cysteines.
- the inserting step uses random amino acids, or optionally, the inserting step uses portions of the naturally occurring monomer domains.
- the portions could ideally encode loops from domains from the same family.
- Amino acids are inserted or exchanged using synthetic oligonucleotides, or by shuffling, or by restriction enzyme based recombination.
- Human chimeric domains of the present invention are useful for therapeutic applications where minimal immunogenicity is desired.
- the present invention provides methods for generating libraries of human chimeric domains.
- Human chimeric monomer domain libraries can be constructed by combining loop sequences from different variants of a human monomer domain, as described above.
- the loop sequences that are combined may be sequence-defined loops, structure-defined loops, B-factor-defmed loops, or a combination of any two or more thereof.
- a human chimeric domain library can be generated by modifying naturally-occurring human monomer domains at the amino acid level, as compared to the loop level.
- modifying naturally-occurring human monomer domains at the amino acid level as compared to the loop level.
- only those residues that naturally occur in protein sequences from the same family of human monomer domains are utilized to create the chimeric sequences.
- Libraries of human chimeric monomer domains can be employed to identify human chimeric monomer domains that bind to a target of interest by: screening the library of human chimeric monomer domains for binding to a target molecule, and identifying a human chimeric monomer domain that binds to the target molecule.
- Suitable naturally-occurring human monomer domain sequences employed in the initial sequence alignment step include those corresponding to any of the naturally-occurring monomer domains described herein.
- monomer domains of the invention are screened for potential immunogenicity by: providing a candidate protein sequence; comparing the candidate protein sequence to a database of human protein sequences; identifying portions of the candidate protein sequence that correspond to portions of human protein sequences from the database; and determining the extent of correspondence between the candidate protein sequence and the human protein sequences from the database.
- a database of human protein sequences that is suitable for use in the practice of the invention method for screening candidate proteins can be found at ncbi.nlm.nih.gov/blast/Blast.cgi at the World Wide Web (in addition, the following web site can be used to search short, nearly exact matches: cbi.mm.nih.gov/blast/Blast.cgi? CMD
- the method is particularly useful in determining whether a crossover sequence in a chimeric protein, such as, for example, a chimeric monomer domain, is likely to cause an immunogenic event. If the crossover sequence corresponds to a portion of a sequence found in the database of human protein sequences, it is believed that the crossover sequence is less likely to cause an immunogenic event.
- Information pertaining to portions of human protein sequences from the database can be used to design a protein library of human-like chimeric proteins.
- Such library can be generated by using information pertaining to "crossover sequences" that exist in naturally occurring human proteins.
- the term "crossover sequence” refers herein to a sequence that is found in its entirety in at least one naturally occurring human protein, in which portions of the sequence are found in two or more naturally occurring proteins. Thus, recombination of the latter two or more naturally occurring proteins would generate a chimeric protein in which the chimeric portion of the sequence actually corresponds to a sequence found in another naturally occurring protein.
- the crossover sequence contains a chimeric junction of two consecutive amino acid residue positions in which the first amino acid position is occupied by an amino acid residue identical in type and position found in a first and second naturally occurring human protein sequence, but not a third naturally occurring human protein sequence.
- the second amino acid position is occupied by an amino acid residue identical in type and position found in a second and third naturally occurring human protein sequence, but not the first naturally occurring human protein sequence.
- the "second" naturally occurring human protein sequence corresponds to the naturally occurring human protein in which the crossover sequence appears in its entirety, as described above.
- a library of human-like chimeric proteins is generated by: identifying human protein sequences from a database that correspond to proteins from the same family of proteins; aligning the human protein sequences from the same family of proteins to a reference protein sequence; identifying a set of subsequences derived from different human protein sequences of the same family, wherein each subsequence shares a region of identity with at least one other subsequence derived from a different naturally occurring human protein sequence; identifying a chimeric junction from a first, a second, and a third subsequence, wherein each subsequence is derived from a different naturally occurring human protein sequence, and wherein the chimeric junction comprises two consecutive amino acid residue positions in which the first amino acid position is occupied by an amino acid residue common to the first and second naturally occurring human protein sequence, but not the third naturally occurring human protein sequence, and the second amino acid position is occupied by an amino acid residue common to the second and third naturally occurring human protein sequence, and generating human
- the chimeric junction is C-D.
- the first naturally-occurring human protein sequence is D- E-F-G, and the second is B-C-D-E-F, and the third is A-B-C-D, then the chimeric junction is D-E.
- Human-like chimeric protein molecules can be generated in a variety of ways.
- oligonucleotides comprising sequences encoding the chimeric junctions can be recombined with oligonucleotides corresponding in sequence to two or more subsequences from the above-described set of subsequences to generate a human-like chimeric protein, and libraries thereof.
- the reference sequence used to align the naturally occurring human proteins is a sequence from the same family of naturally occurring human proteins, or a chimera or other variant of proteins in the family.
- Nucleic acids encoding fragments of naturally-occurring monomer domains can also be mixed and/or recombined (e.g., by using chemically or enzymatically- produced fragments) to generate full-length, modified monomer domains.
- the fragments and the monomer domain can also be recombined by manipulating nucleic acids encoding domains or fragments thereof. For example, ligating a nucleic acid construct encoding fragments of the monomer domain can be used to generate an altered monomer domain.
- Altered monomer domains can also be generated by providing a collection of synthetic oligonucleotides (e.g., overlapping oligonucleotides) encoding conserved, random, pseudorandom, or a defined sequence of peptide sequences that are then inserted by ligation into a predetermined site in a polynucleotide encoding a monomer domain.
- sequence diversity of one or more monomer domains can be expanded by mutating the monomer domain(s) with site-directed mutagenesis, random mutation, pseudorandom mutation, defined kernal mutation, codon-based mutation, and the like.
- the resultant nucleic acid molecules can be propagated in a host for cloning and amplification. In some embodiments, the nucleic acids are shuffled.
- the present invention also provides a method for recombining a plurality of nucleic acids encoding monomer domains and screening the resulting library for monomer domains that bind to the desired ligand or mixture of ligands or the like.
- Selected monomer domain nucleic acids can also be back-crossed by shuffling with polynucleotide sequences encoding neutral sequences (i.e., having insubstantial functional effect on binding), such as for example, by back-crossing with a wild-type or naturally-occurring sequence substantially identical to a selected sequence to produce native-like functional monomer domains.
- subsequent selection is applied to retain the property, e.g., binding to the ligand.
- the monomer library is prepared by shuffling.
- monomer domains are isolated and shuffled to combinatorially recombine the nucleic acid sequences that encode the monomer domains (recombination can occur between or within monomer domains, or both).
- the first step involves identifying a monomer domain having the desired property, e.g., affinity for a certain ligand. While maintaining the conserved amino acids during the recombination, the nucleic acid sequences encoding the monomer domains can be recombined, or recombined and joined into multimers.
- a significant advantage of the present invention is that known ligands, or unknown ligands can be used to select the monomer domains and/or multimers. No prior information regarding ligand structure is required to isolate the monomer domains of interest or the multimers of interest.
- the monomer domains and/or multimers identified can have biological activity, which is meant to include at least specific binding affinity for a selected or desired ligand, and, in some instances, will further include the ability to block the binding of other compounds, to stimulate or inhibit metabolic pathways, to act as a signal or messenger, to stimulate or inhibit cellular activity, and the like.
- Monomer domains can be generated to function as ligands for receptors where the natural ligand for the receptor has not yet been identified (orphan receptors). These orphan ligands can be created to either block or activate the receptor to which they bind.
- a single ligand can be used, or optionally a variety of ligands can be used to select the monomer domains and/or multimers.
- a monomer domain of the present invention can bind a single ligand or a variety of ligands.
- a multimer of the present invention can have multiple discrete binding sites for a single ligand, or optionally, can have multiple binding sites for a variety of ligands.
- the invention also includes compositions that are produced by methods of the present invention.
- the present invention includes monomer domains selected or identified from a library and/or libraries comprising monomer domains produced by the methods of the present invention.
- the present invention also provides libraries of monomer domains and libraries of nucleic acids that encode monomer domains.
- the libraries can include, e.g., about 100, 250, 500 or more nucleic acids encoding monomer domains, or the library can include, e.g., about 100, 250, 500 or more polypeptides that encode monomer domains.
- Libraries can include monomer domains containing the same cysteine frame, e.g., A-domains or EGF-like domains.
- variants are generated by recombining two or more different sequences from the same family of monomer domains (e.g., the LDL receptor class A domain).
- monomer domains e.g., the LDL receptor class A domain
- two or more different monomer domains from different families can be combined to form a multimer.
- the multimers are , formed from monomers or monomer variants of at least one of the following family classes: an EGF-like domain, a Kringle-domain, a fibronectin type I domain, a fibronectin type II domain, a fibronectin type III domain, a PAN domain, a GIa domain, a SRCR domain, a Kunitz/Bovine pancreatic trypsin Inhibitor domain, a Kazal-type serine protease inhibitor domain, a Trefoil (P-type) domain, a von Willebrand factor type C domain, an Anaphylatoxin-like domain, a CUB domain, a thyroglobulin type I repeat, LDL-receptor class A domain, a Sushi domain, a Link domain, a Thrombospondin type I domain, an Immunoglobulin-like domain, a C-type lectin domain, a MAM domain, a von Willebrand factor type A domain
- a data set of nucleic acid character strings encoding monomer domains can be generated e.g., by mixing a first character string encoding a monomer domain, with one or more character string encoding a different monomer domain, thereby producing a data set of nucleic acids character strings encoding monomer domains, including those described herein.
- the monomer domain and the different monomer domain can include one or more domains found in the Pfam database and/or the SMART database.
- the methods can further comprise inserting the first character string encoding the monomer domain and the one or more second character string encoding the different monomer domain in a computer and generating a multimer character string(s) or library(s), thereof in the computer.
- the libraries can be screened for a desired property such as binding of a desired ligand or mixture of ligands.
- members of the library of monomer domains can be displayed and prescreened for binding to a known or unknown ligand or a mixture of ligands.
- the monomer domain sequences can then be mutagenized (e.g., recombined, chemically altered, etc.) or otherwise altered and the new monomer domains can be screened again for binding to the ligand or the mixture of ligands with an improved affinity.
- the selected monomer domains can be combined or joined to form multimers, which can then be screened for an improved affinity or avidity or altered specificity for the ligand or the mixture of ligands.
- Altered specificity can mean that the specificity is broadened, e.g., binding of multiple related viruses, or optionally, altered specificity can mean that the specificity is narrowed, e.g., binding within a specific region of a ligand.
- Those of skill in the art will recognize that there are a number of methods available to calculate avidity. See, e.g., Mammen et al, Angew Chem Int. Ed. 37:2754-2794 (1998); Muller et al, Anal. Biochem. 261:149-158 (1998).
- Preliminary screens can be conducted by screening for agents capable of binding to c-MET, as at least some of the agents so identified are likely c-MET modulators (e.g., antagonists or agonists).
- the binding assays usually involve contacting a c-MET protein (or a fragment thereof such as a fragment comprising the SEMA rdomain or the ⁇ chain) with one or more test agents (i.e., monomers or multimers of the invention) and allowing sufficient time for the protein and test agents to form a binding complex. Any binding complexes formed can be detected using any of a number of established analytical techniques. Protein binding assays include, but are not limited to, immunohistochemical binding assays, flow cytometry or other assays.
- the c-MET protein utilized in such assays can be naturally expressed, cloned or synthesized. Similar methods can be used to identify monomer domains or multimers that bind IgG.
- the screening methods of the invention can be performed as in vitro or cell-based assays.
- Cell based assays can be performed in any cells in which c-MET is expressed.
- Cell-based assays may involve whole cells or cell fractions containing a c-MET receptor to screen for agent binding or modulation of activity of c-MET by the agent.
- Exemplary cell types that can be used according to the methods of the invention include, e.g., any mammalian cells, as well as fungal cells, including yeast, and bacterial cells.
- Cells can be primary cells or tumor cells or other types of immortal cell lines. Of course, c-MET can be expressed in cells that do not endogenously contain c-MET.
- c-MET activity assays may also be used to identify a modulator (antagonist or agonist) of c-MET.
- one or more test agents are contacted to a cell expressing c-MET and then tested for an activity of c-MET.
- Exemplary c- MET activities include HGF-dependent or constitutive kinase activity. See, e.g., Christensen et al, Cancer Res. 63:7345-7355 (2003).
- down stream molecular events can also be monitored to determine signaling activity.
- c-MET induces cell growth (proliferation and survival), cell motility, invasion and morphology changes.
- c-MET indirectly mediates phosphorylation of Gab- 1, Akt, signal transducer and activator of transcription 3, phospholipase C ⁇ , and focal adhesions kinase, among others. See, e.g., Christensen et al, Cancer Res. 63:7345-7355 (2003).
- activity assays are also used to confirm that identified antagonist monomers or multimers (i.e., that compete with HGF) lack agonist activity (i.e., that they do not activate c-MET in the absence of HGF or another agonist).
- Agents that are initially identified by any of the foregoing screening methods can be further tested to validate the apparent activity. Such studies may be conducted with suitable animal models. The basic format of such methods involves administering a lead compound identified during an initial screen to an animal that serves as a model for humans and then determining if c-MET is in fact modulated and/or the disease or condition is ameliorated.
- the animal models utilized in validation studies generally are mammals of any kind. Specific examples of suitable animals include, but are not limited to, primates, mice and rats.
- Selection of monomer domains that bind c-MET from a library of domains can be accomplished by a variety of procedures.
- one method of identifying monomer domains which have a desired property involves translating a plurality of nucleic acids, where each nucleic acid encodes a monomer domain, screening the polypeptides encoded by the plurality of nucleic acids, and identifying those monomer domains that, e.g., bind to a desired ligand or mixture of ligands, thereby producing a selected monomer domain.
- the monomer domains expressed by each of the nucleic acids can be tested for their ability to bind to the ligand by methods known in the art (i.e. panning, affinity chromatography, FACS analysis).
- selection of monomer domains can be based on binding to a ligand such as c-MET, or a fragment therof or other target molecule (e.g., lipid, carbohydrate, nucleic acid and the like).
- a ligand such as c-MET
- target molecule e.g., lipid, carbohydrate, nucleic acid and the like.
- Other molecules can optionally be included in the methods along with the target, e.g., ions such as Ca +2 .
- the selection basis can include selection based on a slow dissociation rate, which is usually predictive of high affinity.
- the valency of the ligand can also be varied to control the average binding affinity of selected monomer domains.
- the ligand can be bound to a surface or substrate at varying densities, such as by including a competitor compound, by dilution, or by other method known to those in the art. High density (valency) of predetermined ligand can be used to enrich for monomer domains that have relatively low affinity, whereas a low density (valency) can preferentially enrich for higher affinity monomer domains.
- a variety of reporting display vectors or systems can be used to express nucleic acids encoding the monomer domains and/or multimers of the present invention and to test for a desired activity.
- a phage display system is a system in which monomer domains are expressed as fusion proteins on the phage surface
- Phage display can involve the presentation of a polypeptide sequence encoding monomer domains on the surface of a filamentous bacteriophage, typically as a fusion with a bacteriophage coat protein.
- each phage particle or cell serves as an individual library member displaying a single species of displayed polypeptide in addition to the natural phage or cell protein sequences.
- the nucleic acids are cloned into the phage DNA at a site which results in the transcription of a fusion protein, a portion of which is encoded by the plurality of the nucleic acids.
- the phage containing a nucleic acid molecule undergoes replication and transcription in the cell.
- the leader sequence of the fusion protein directs the transport of the fusion protein to the tip of the phage particle.
- the fusion protein that is partially encoded by the nucleic acid is displayed on the phage particle for detection and selection by the methods described above and below.
- the phage library can be incubated with a predetermined ligand such as c-MET or a fragment thereof, so that phage particles which present a fusion protein sequence that binds to the ligand can be differentially partitioned from those that do not present polypeptide sequences that bind to the predetermined ligand.
- the separation can be provided by immobilizing the predetermined ligand.
- the phage particles i.e., library members
- which are bound to the immobilized ligand are then recovered and replicated to amplify the selected phage subpopulation for a subsequent round of affinity enrichment and phage replication.
- the phage library members that are thus selected are isolated and the nucleotide sequence encoding the displayed polypeptide sequence is determined, thereby identifying the sequence(s) of polypeptides that bind to the predetermined ligand.
- Such methods are further described in PCT patent publication Nos. 91/17271, 91/18980, and 91/19818 and 93/08278.
- Examples of other display systems include ribosome displays, a nucleotide-linked display (see, e.g., U.S. Patent Nos. 6,281,344; 6,194,550, 6,207,446, 6,214,553, and 6,258,558), polysome display, cell surface displays and the like.
- the cell surface displays include a variety of cells, e.g., E. coli, yeast and/or mammalian cells.
- the nucleic acids e.g., obtained by PCR amplification followed by digestion, are introduced into the cell and translated.
- polypeptides encoding the monomer domains or the multimers of the present invention can be introduced, e.g., by injection, into the cell.
- the monomer and multimer libraries of the invention can be screened for a desired property such as binding of a desired ligand (e.g., c-MET) or mixture of ligands.
- a desired ligand e.g., c-MET
- members of the library of monomer domains can be displayed and prescreened for binding to a known or unknown ligand or a mixture of ligands.
- the monomer domain sequences can then be mutagenized(e.g., recombined, chemically altered, etc.) or otherwise altered and the new monomer domains can be screened again for binding to the ligand or the mixture of ligands with an improved affinity.
- the selected monomer domains can be combined or joined to form multimers, which can then be screened for an improved affinity or avidity or altered specificity for the ligand or the mixture of ligands.
- Altered specificity can mean that the specificity is broadened, e.g., binding of multiple related ligands, or optionally, altered specificity can mean that the specificity is narrowed, e.g., binding within a specific region of a ligand.
- Those of skill in the art will recognize that there are a number of methods available to calculate avidity. See, e.g., Mammen et ah, Angew Chem Int. Ed. 37:2754-2794 (1998); Muller et al., Anal. Biochem. 261:149-158 (1998).
- a first screening of a library can be performed at relatively lower stringency, thereby selected as many particles associated with a target molecule as possible.
- the selected particles can then be isolated and the polynucleotides encoding the monomer or multimer can be isolated from the particles. Additional variations can then be generated from these sequences and subsequently screened at higher affinity.
- compositions of the present invention e.g., monomer domains as well as multimers and libraries thereof can be optionally bound to a matrix of an affinity material.
- affinity material include beads, a column, a solid support, a microarray, other pools of reagent-supports, and the like.
- multimers capable of binding relatively large targets they can be generated by a "walking" selection method. This method is carried out by providing a library of monomer domains and screening the library of monomer domains for affinity to a first target molecule. Once at least one monomer that binds to the target is identified, that monomer is covalently linked to a new library or each remaining member of the original library of monomer domains. This new library of multimers (dimers) is then screened for multimers that bind to the target with an increased affinity, and a multimer that binds to the target with an increased affinity can be identified.
- the "walking" monomer selection method provides a way to assemble a multimer that is composed of monomers that can act additively or even synergistically with each other given the restraints of linker length. This walking technique is very useful when selecting for and assembling multimers that are able to bind large target proteins with high affinity. The walking method can be repeated to add more monomers thereby resulting in a multimer comprising 2, 3, 4, 5, 6, 7, 8 or more monomers linked together.
- the selected multimer comprises more than two domains.
- Such multimers can be generated in a step fashion, e.g., where the addition of each new domain is tested individually and the effect of the domains is tested in a sequential fashion. See, e.g., Figure 5.
- domains are linked to form multimers comprising more than two domains and selected for binding without prior knowledge of how smaller multimers, or alternatively, how each domain, bind.
- the methods of the present invention also include methods of evolving monomers or multimers.
- Intra-domain recombination can be introduced into monomers across the entire monomer or by taking portions of different monomers to form new recombined units.
- Interdomain recombination e.g., recombining different monomers into or between multimers
- recombination of modules e.g., multiple monomers within a multimer
- Inter-library recombination is also contemplated.
- Methods for evolving monomers or multimers can comprise, e.g., any or all of the following steps: providing a plurality of different nucleic acids, where each nucleic acid encoding a monomer domain; translating the plurality of different nucleic acids, which provides a plurality of different monomer domains; screening the plurality of different monomer domains for binding of the desired ligand (e.g., c-MET) or mixture of ligands; identifying members of the plurality of different monomer domains that bind the desired ligand or mixture of ligands, which provides selected monomer domains; joining the selected monomer domains with at least one linker to generate at least one multimer, wherein the at least one multimer comprises at least two of the selected monomer domains and the at least one linker; and, screening the at least one multimer for an improved affinity or avidity or altered specificity for the desired ligand or mixture of ligands as compared to the selected monomer domains .
- the desired ligand e.
- Variation can be introduced into either monomers or multimers.
- An example of improving monomers includes intra-domain recombination in which two or more (e.g., three, four, five, or more ) portions of the monomer are amplified separately under conditions to introduce variation (for example by shuffling or other recombination method) in the resulting amplification products, thereby synthesizing a library of variants for different portions of the monomer.
- variation for example by shuffling or other recombination method
- the "middle" primer(s) may be selected to correspond to any segment of the monomer, and will typically be based on the scaffold or one or more consensus amino acids within the monomer (e.g., cysteines such as those found in A domains).
- multimers may be created by introducing variation at the monomer level and then recombining monomer variant libraries.
- multimers single or pools
- desired properties may be recombined to form longer multimers.
- variation is introduced (typically synthetically) into the monomers or into the linkers to form libraries. This may be achieved, e.g., with two different multimers that bind to two different targets, thereby eventually selecting a multimer with a portion that binds to one target and a portion that binds a second target.
- Additional variation can be introduced by inserting linkers of different length and composition between domains. This allows for the selection of optimal linkers between domains.
- optimal length and composition of linkers will allow for optimal binding of domains.
- the domains with a particular binding affinity(s) are linked via different linkers and optimal linkers are selected in a binding assay. For example, domains are selected for desired binding properties and then formed into a library comprising a variety of linkers. The library can then be screened to identify optimal linkers. Alternatively, multimer libraries can be formed where the effect of domain or linker on target molecule binding is not known.
- Methods of the present invention also include generating one or more selected multimers by providing a plurality of monomer domains.
- the plurality of monomer domains is screened for binding of a desired ligand or mixture of ligands.
- Members of the plurality of domains that bind the desired ligand or mixture of ligands are identified, thereby providing domains with a desired affinity.
- the identified domains are joined with at least one linker to generate the multimers, wherein each multimer comprises at least two of the selected domains and the at least one linker; and, the multimers are screened for an improved affinity or avidity or altered specificity for the desired ligand or mixture of ligands as compared to the selected domains, thereby identifying the one or more selected multimers.
- Multimer libraries may be generated, in some embodiments, by combining two or more libraries or monomers or multimers in a recombinase-based approach, where each library member comprises as recombination site (e.g., a lox site).
- libraries are constructed in phage vectors, which may be transformed into E. coli, library size (10 9 - 10 10 ) is limited by the transformation efficiency of E. coli.
- a recombinase/recombination site system e.g., the Cre-loxP system
- in vivo recombination can be exploited to generate libraries that are not limited in size by the transformation efficiency of E. coli.
- the Cre-loxP system may be used to generate dimer libraries with 10 10 , 10 11 , 10 12 , 10 13 , or greater diversity.
- E. coli as a host for one na ⁇ ve monomer library and a filamentous phage that carries a second na ⁇ ve monomer library are used.
- the library size in this case is limited only by the number of infective phage (carrying one library) and the number of infectible E. coli cells (carrying the other library).
- Selection of multimers can be accomplished using a variety of techniques including those mentioned above for identifying monomer domains.
- Other selection methods include, e.g., a selection based on an improved affinity or avidity or altered specificity for the ligand compared to selected monomer domains.
- a selection can be based on selective binding to specific cell types, or to a set of related cells or protein types (e.g., different virus serotypes).
- Optimization of the property selected for, e.g., avidity of a ligand can then be achieved by recombining the domains, as well as manipulating amino acid sequence of the individual monomer domains or the linker domain or the nucleotide sequence encoding such domains, as mentioned in the present invention.
- One method for identifying multimers can be accomplished by displaying the multimers.
- the multimers are optionally expressed or displayed on a variety of display systems, e.g., phage display, ribosome display, polysome display, nucleotide-linked display ⁇ see, e.g., U.S. Patent Nos. 6,281,344;
- Cell surface displays can include but are not limited to E. coli, yeast or mammalian cells.
- display libraries of multimers with multiple binding sites can be panned for avidity or affinity or altered specificity for a ligand or for multiple ligands.
- Monomers or multimers can be screened for target binding activity in yeast cells using a two-hybrid screening assay.
- the monomer or multimer library to be screened is cloned into a vector that directs the formation of a fusion protein between each monomer or multimer of the library and a yeast transcriptional activator fragment (i.e., Gal4).
- Sequences encoding the "target" protein are cloned into a vector that results in the production of a fusion protein between the target and the remainder of the Gal4 protein (the DNA binding domain).
- a third plasmid contains a reporter gene downstream of the DNA sequence of the Gal4 binding site. A monomer that can bind to the target protein brings with it the Gal4 activation domain, thus reconstituting a functional Gal4 protein.
- Another useful screening system for carrying out the present invention is the E.coli/BCCP interactive screening system (Germino et al. (1993) Proc. Nat. Acad. ScL (U.S.A.) 90:993; Guarente L. (1993) Proc. Nat. Acad. ScL (U.S.A.) 90:1639).
- Other variations include the use of multiple binding compounds, such that monomer domains, multimers or libraries of these molecules can be simultaneously screened for a multiplicity of ligands or compounds that have different binding specificity. Multiple predetermined ligands or compounds can be concomitantly screened in a single library, or sequential screening against a number of monomer domains or multimers. hi one variation, multiple ligands or compounds, each encoded on a separate bead (or subset of beads), can be mixed and incubated with monomer domains, multimers or libraries of these molecules under suitable binding conditions. The collection of beads, comprising multiple ligands or compounds, can then be used to isolate, by affinity selection, selected monomer domains, selected multimers or library members.
- subsequent affinity screening rounds can include the same mixture of beads, subsets thereof, or beads containing only one or two individual ligands or compounds.
- This approach affords efficient screening, and is compatible with laboratory automation, batch processing, and high throughput screening methods.
- multimers can be simultaneously screened for the ability to bind multiple ligands, wherein each ligand comprises a different label.
- each ligand can be labeled with a different fluorescent label, contacted simultaneously with a multimer or multimer library.
- Multimers with the desired affinity are then identified (e.g., by FACS sorting) based on the presence of the labels linked to the desired labels.
- affinity agents Libraries of either monomer domains or multimers (referred in the following discussion for convenience as "affinity agents" can be screened (i.e., panned) simultaneously against multiple ligands in a number of different formats. For example, multiple ligands can be screened in a simple mixture, in an array, displayed on a cell or tissue (e.g., a cell or tissue provides numerous molecules that can be bound by the monomer domains or multimers of the invention), and/or immobilized.
- the libraries of affinity agents can optionally be displayed on yeast or phage display systems. Similarly, if desired, the ligands (e.g., encoded in a cDNA library) can be displayed in a yeast or phage display system.
- the affinity agent library is panned against the multiple ligands.
- the resulting "hits" are panned against the ligands one or more times to enrich the resulting population of affinity agents.
- affinity agents are displayed on phage.
- Affinity agents identified as binding in the initial screen are divided into a first and second portion.
- the first portion is infected into bacteria, resulting in either plaques or bacterial colonies, depending on the type of phage used.
- the expressed phage are immobilized and then probed with ligands displayed in phage selected as described below.
- the second portion are coupled to beads or otherwise immobilized and a phage display library containing at least some of the ligands in the original mixture is contacted to the immobilized second portion.
- Phage that bind to the second portion are subsequently eluted and contacted to the immobilized phage described in the paragraph above. Phage-phage interactions are detected (e.g., using a monoclonal antibody specific for the ligand-expressing phage) and the resulting phage polynucleotides can be isolated.
- the identity of an affinity agent-ligand pair is determined. For example, when both the affinity agent and the ligand are displayed on a phage or yeast, the DNA from the pair can be isolated and sequenced.
- polynucleotides specific for the ligand and affinity agent are amplified.
- Amplification primers for each reaction can include 5' sequences that are complementary such that the resulting amplification products are fused, thereby forming a hybrid polynucleotide comprising a polynucleotide encoding at least a portion of the affinity agent and at least a portion of the ligand.
- the resulting hybrid can be used to probe affinity agent or ligand (e.g., cDNA-encoded) polynucleotide libraries to identify both affinity agent and ligand.
- affinity agent or ligand e.g., cDNA-encoded
- polynucleotide libraries e.g., cDNA-encoded polynucleotide libraries.
- the above-described methods can be readily combined with "walking" to simultaneously generate and identify multiple multimers, each of which bind to a ligand in a mixture of ligands.
- a first library of affinity agents (monomer domains or multimers) are panned against multiple ligands and the eluted affinity agents are linked to the first or a second library of affinity agents to fo ⁇ n a library of multimeric affinity agents (e.g., comprising 2, 3, 4, 5, 6, 7, 8, 9, or more monomer), which are subsequently panned against the multiple ligands.
- This method can be repeated to continue to generate larger multimeric affinity agents.
- Increasing the number of monomer domains may result in increased affinity and avidity for a particular target. For example, the inventors have found that trimers of monomer domains that bind CD28 have a higher affinity than dimmers, which in turn have a higher affinity than single CD28-binding monomer domains alone.
- the panning is optionally repeated to enrich for significant binders.
- walking will be facilitated by inserting recombination sites (e.g., lox sites) at the ends of monomers and recombining monomer libraries by a recombinase-mediated event.
- recombination sites e.g., lox sites
- the selected multimers of the above methods can be further manipulated, e.g., by recombining or shuffling the selected multimers (recombination can occur between or within multimers or both), mutating the selected multimers, and the like. This results in altered multimers which then can be screened and selected for members that have an enhanced property compared to the selected multimer, thereby producing selected altered multimers.
- Naturally or non-naturally occurring monomer domains may be recombined or variants may be formed.
- the domains initially or later are selected for those sequences that are less likely to be immunogenic in the host for which they are intended.
- a phage library comprising the recombined domains is panned for a desired affinity.
- Monomer domains or multimers expressed by the phage may be screened for IC 50 for a target.
- Hetero- or homo-meric multimers may be selected.
- the selected polypeptides may be selected for their affinity to any target, including, e.g., hetero- or homo- multimeric targets.
- Linkers, multimers or selected multimers produced by the methods indicated above and below are features of the present invention.
- Libraries comprising multimers e.g, a library comprising about 100, 250, 500 or more members produced by the methods of the present invention or selected by the methods of the present invention are provided.
- one or more cell comprising members of the libraries are also included.
- Libraries of the recombinant polypeptides are also a feature of the present invention, e.g., a library comprising about 100, 250, 500 or more different recombinant polypetides.
- compositions of the present invention can be bound to a matrix of an affinity material, e.g., the recombinant polypeptides.
- affinity material include, e.g., beads, a column, a solid support, and/or the like.
- the present invention also includes methods of therapeutically or propliylactically treating a disease or disorder by administering in vivo or ex vivo one or more nucleic acids or polypeptides of the invention described above (or compositions comprising a pharmaceutically acceptable excipient and one or more such nucleic acids or polypeptides) to a subject, including, e.g., a mammal, including a human, primate, mouse, pig, cow, goat, rabbit, rat, guinea pig, hamster, horse, sheep; or a non-mammalian vertebrate such as a bird (e.g., a chicken or duck), fish, or invertebrate.
- a mammal including a human, primate, mouse, pig, cow, goat, rabbit, rat, guinea pig, hamster, horse, sheep; or a non-mammalian vertebrate such as a bird (e.g., a chicken or duck), fish, or inverte
- c-MET antagonists including c-MET-binding monomer domains or multimers of the invention, are useful in treatment of human cancers expressing c-MET.
- a compendium of human cancers known to express c-MET and/or its ligand HGF can be found in Table 1, p. 922 of Birchmeier, C, Birchmeier, W., Gherardi, E. & Vande Woude, G. F. Met, metastasis, motility and more. Nat Rev MoI Cell Biol 4, 915-25 (2003).
- c-MET antagonists are of therapeutic value in all of these cancers.
- c-MET antagonists are useful in meeting a significant unmet medical need in pancreatic cancer, mesothelioma, myeloma, head and neck cancer, lung (NSCLC) cancer, ovarian cancer, breast cancer, prostate cancer, colon cancer, glioblastoma and osteosarcoma.
- exemplary cancers include bladder, breast, cervical, colorectal, oesophageal, gastric, kidney, liver, lung, nasopharyngeal, gall bladder, prostate or thyroid cancer, osteosarcoma, synovial sarcoma, rhabdomosarcoma, MFH/fibrosarcoma, Kaposi's sarcoma, multiple myeloma, lymphomas, adult T-cell leukemia, glioblastomas, astrocytomas, melanoma, and Wilm's tumor.
- Individuals can be treated, for example, by once weekly intravenous injections of a soluble formulation of a c-MET antagonist composed of c-MET-binding monomer domains or multimers of the invention, optionally in combination with one or more additional therapeutic entities, for example either biologic or chemotherapeutic.
- one or more cells or a population of cells of interest of the subject e.g., tumor cells, tumor tissue sample, organ cells, blood cells, cells of the skin, lung, heart, muscle, brain, mucosae, liver, intestine, spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth, tongue, etc.
- a selected monomer domain and/or multimer of the invention that is effective in prophylactically or therapeutically treating the disease, disorder, or other condition.
- the contacted cells are then returned or delivered to the subject to the site from which they were obtained or to another site (e.g., including those defined above) of interest in the subject to be treated.
- the contacted cells can be grafted onto a tissue, organ, or system site (including all described above) of interest in the subject using standard and well-known grafting techniques or, e.g., delivered to the blood or lymph system using standard delivery or transfusion techniques.
- the invention also provides in vivo methods in which one or more cells or a population of cells of interest of the subject are contacted directly or indirectly with an amount of a selected monomer domain and/or multimer of the invention effective in prophylactically or therapeutically treating the disease, disorder, or other condition.
- the selected monomer domain and/or multimer is typically administered or transferred directly to the cells to be treated or to the tissue site of interest (e.g., tumor cells, tumor tissue sample, organ cells, blood cells, cells of the skin, lung, heart, muscle, brain, mucosae, liver, intestine, spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth, tongue, etc.) by any of a variety of formats, including topical administration, injection (e.g., by using a needle or syringe), or vaccine or gene gun delivery, pushing into a tissue, organ, or skin site.
- the tissue site of interest e.g., tumor cells, tumor tissue sample, organ cells, blood cells, cells of the skin, lung, heart, muscle, brain, mucosae, liver, intestine, spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth, tongue, etc.
- the selected monomer domain and/or multimer can be delivered, for example, intramuscularly, intradermally, subdermally, subcutaneously, orally, intraperitoneally, intrathecally, intravenously, or placed within a cavity of the body (including, e.g., during surgery), or by inhalation or vaginal or rectal administration.
- the selected monomer domain and/or multimer is typically administered or transferred indirectly to the cells to be treated or to the tissue site of interest, including those described above (such as, e.g., skin cells, organ systems, lymphatic system, or blood cell system, etc.), by contacting or administering the polypeptide of the invention directly to one or more cells or population of cells from which treatment can be facilitated.
- tumor cells within the body of the subject can be treated by contacting cells of the blood or lymphatic system, skin, or an organ with a sufficient amount of the selected monomer domain and/or multimer such that delivery of the selected monomer domain and/or multimer to the site of interest (e.g., tissue, organ, or cells of interest or blood or lymphatic system within the body) occurs and effective prophylactic or therapeutic treatment results.
- site of interest e.g., tissue, organ, or cells of interest or blood or lymphatic system within the body
- Such contact, administration, or transfer is typically made by using one or more of the routes or modes of administration described above.
- the invention provides ex vivo methods in which one or more cells of interest or a population of cells of interest of the subject (e.g., tumor cells, tumor tissue sample, organ cells, blood cells, cells of the skin, lung, heart, muscle, brain, mucosae, liver, intestine, spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth, tongue, etc.) are obtained or removed from the subject and transformed by contacting said one or more cells or population of cells with a polynucleotide construct comprising a nucleic acid sequence of the invention that encodes a biologically active polypeptide of interest (e.g., a selected monomer domain and/or multimer) that is effective in prophylactically or therapeutically treating the disease, disorder, or other condition.
- a polynucleotide construct comprising a nucleic acid sequence of the invention that encodes a biologically active polypeptide of interest (e.g., a selected monomer domain and/or multimer) that is effective in
- the one or more cells or population of cells is contacted with a sufficient amount of the polynucleotide construct and a promoter controlling expression of said nucleic acid sequence such that uptake of the polynucleotide construct (and promoter) into the cell(s) occurs and sufficient expression of the target nucleic acid sequence of the invention results to produce an amount of the biologically active polypeptide, encoding a selected monomer domain and/or multimer, effective to prophylactically or therapeutically treat the disease, disorder, or condition.
- the polynucleotide construct can include a promoter sequence (e.g., CMV promoter sequence) that controls expression of the nucleic acid sequence of the invention and/or, if desired, one or more additional nucleotide sequences encoding at least one or more of another polypeptide of the invention, a cytokine, adjuvant, or co-stimulatory molecule, or other polypeptide of interest.
- a promoter sequence e.g., CMV promoter sequence
- additional nucleotide sequences encoding at least one or more of another polypeptide of the invention, a cytokine, adjuvant, or co-stimulatory molecule, or other polypeptide of interest.
- the transformed cells are returned, delivered, or transferred to the subject to the tissue site or system from which they were obtained or to another site (e.g., tumor cells, tumor tissue sample, organ cells, blood cells, cells of the skin, lung, heart, muscle, brain, mucosae, liver, intestine, spleen, stomach, lymphatic system, cervix, vagina, prostate, mouth, tongue, etc.) to be treated in the subject.
- the cells can be grafted onto a tissue, skin, organ, or body system of interest in the subject using standard and well-known grafting techniques or delivered to the blood or lymphatic system using standard delivery or transfusion techniques.
- Such delivery, administration, or transfer of transformed cells is typically made by using one or more of the routes or modes of administration described above.
- Expression of the target nucleic acid occurs naturally or can be induced (as described in greater detail below) and an amount of the encoded polypeptide is expressed sufficient and effective to treat the disease or condition at the site or tissue system.
- the invention provides in vivo methods in which one or more cells of interest or a population of cells of the subject (e.g., including those cells and cells systems and subjects described above) are transformed in the body of the subject by contacting the cell(s) or population of cells with (or administering or transferring to the cell(s) or population of cells using one or more of the routes or modes of administration described above) a polynucleotide construct comprising a nucleic acid sequence of the invention that encodes a biologically active polypeptide of interest (e.g., a selected monomer domain and/or multimer) that is effective in prophylactically or therapeutically treating the disease, disorder, or other condition.
- a biologically active polypeptide of interest e.g., a selected monomer domain and/or multimer
- the polynucleotide construct can be directly administered or transferred to cell(s) suffering from the disease or disorder (e.g., by direct contact using one or more of the routes or modes of administration described above).
- the polynucleotide construct can be indirectly administered or transferred to cell(s) suffering from the disease or disorder by first directly contacting non-diseased cell(s) or other diseased cells using one or more of the routes or modes of administration described above with a sufficient amount of the polynucleotide construct comprising the nucleic acid sequence encoding the biologically active polypeptide, and a promoter controlling expression of the nucleic acid sequence, such that uptake of the polynucleotide construct (and promoter) into the cell(s) occurs and sufficient expression of the nucleic acid sequence of the invention results to produce an amount of the biologically active polypeptide effective to prophylactically or therapeutically treat the disease or disorder, and whereby the polynucleotide construct or the resulting expressed polypeptide is transferred naturally or
- the polynucleotide construct can include a promoter sequence (e.g., CMV promoter sequence) that controls expression of the nucleic acid sequence and/or, if desired, one or more additional nucleotide sequences encoding at least one or more of another polypeptide of the invention, a cytokine, adjuvant, or co-stimulatory molecule, or other polypeptide of interest.
- a promoter sequence e.g., CMV promoter sequence
- additional nucleotide sequences encoding at least one or more of another polypeptide of the invention, a cytokine, adjuvant, or co-stimulatory molecule, or other polypeptide of interest.
- compositions comprising an excipient and the polypeptide or nucleic acid of the invention can be administered or delivered.
- a composition comprising a pharmaceutically acceptable excipient and a polypeptide or nucleic acid of the invention is administered or delivered to the subject as described above in an amount effective to treat the disease or disorder.
- the amount of polynucleotide administered to the cell(s) or subject can be an amount such that uptake of said polynucleotide into one or more cells of the subject occurs and sufficient expression of said nucleic acid sequence results to produce an amount of a biologically active polypeptide effective to enhance an immune response in the subject, including an immune response induced by an immunogen (e.g., antigen).
- an immunogen e.g., antigen
- the amount of polypeptide administered to cell(s) or subject can be an amount sufficient to enhance an immune response in the subject, including that induced by an immunogen (e.g., antigen).
- the expression of the polynucleotide construct can be induced by using an inducible on- and off-gene expression system.
- on- and off-gene expression systems include the Tet-OnTM Gene Expression System and Tet-OffTM Gene Expression System ⁇ see, e.g., Clontech Catalog 2000, pg. 110-111 for a detailed description of each such system), respectively.
- controllable or inducible on- and off-gene expression systems are known to those of ordinary skill in the art. With such system, expression of the target nucleic of the polynucleotide construct can be regulated in a precise, reversible, and quantitative manner. Gene expression of the target nucleic acid can be induced, for example, after the stable transfected cells containing the polynucleotide construct comprising the target nucleic acid are delivered or transferred to or made to contact the tissue site, organ or system of interest.
- Such systems are of particular benefit in treatment methods and formats in which it is advantageous to delay or precisely control expression of the target nucleic acid (e.g., to allow time for completion of surgery and/or healing following surgery; to allow time for the polynucleotide construct comprising the target nucleic acid to reach the site, cells, system, or tissue to be treated; to allow time for the graft containing cells transformed with the construct to become incorporated into the tissue or organ onto or into which it has been spliced or attached, etc.).
- the target nucleic acid e.g., to allow time for completion of surgery and/or healing following surgery; to allow time for the polynucleotide construct comprising the target nucleic acid to reach the site, cells, system, or tissue to be treated; to allow time for the graft containing cells transformed with the construct to become incorporated into the tissue or organ onto or into which it has been spliced or attached, etc.
- a pair of monomers or multimers are selected to bind to the same target (i.e., for use in sandwich-based assays).
- two different monomers or multimers typically are able to bind the target protein simultaneously.
- One approach to identify such pairs involves the following: (1) immobilizing the phage or protein mixture that was previously selected to bind the target protein (2) contacting the target protein to the immobilized phage or protein and washing;
- One use of the multimers or monomer domains of the invention is use to replace antibodies or other affinity agents in detection or other affinity-based assays.
- monomer domains or multimers are selected against the ability to bind components other than a target in a mixture.
- the general approach can include performing the affinity selection under conditions that closely resemble the conditions of the assay, including mimicking the composition of a sample during the assay.
- a step of selection could include contacting a monomer domain or multimer to a mixture not including the target ligand and selecting against any monomer domains or multimers that bind to the mixture.
- the mixtures (absent the target ligand, which could be depleted using an antibody, monomer domain or multimer) representing the sample in an assay (serum, blood, tissue, cells, urine, semen, etc) can be used as a blocking agent.
- an assay serum, blood, tissue, cells, urine, semen, etc.
- the invention can be used in the application for creating antagonists, where the selected monomer domains or multimers block the interaction between two proteins, e.g., the ⁇ and ⁇ chains of Met and/or between Met and HGF.
- the invention can generate agonists.
- multimers binding two different proteins, e.g., enzyme and substrate can enhance protein function, including, for example, enzymatic activity and/or substrate conversion.
- the monomer domains are used for ligand inhibition, ligand clearance or ligand stimulation. Possible ligands in these methods, include, e.g., HGF.
- a monomer domain is selected that binds to the ligand (e.g., HGF) at a portion of the ligand that contacts the ligand's receptor, or that binds to the receptor at a portion of the receptor that binds contacts the ligand, thereby preventing the ligand-receptor interaction.
- the monomer domains can optionally be linked to a half-life extender, if desired.
- Ligand clearance refers to modulating the half-life of a soluble ligand in bodily fluid. For example, most monomer domains, absent a half-life extender, have a short half-life. Thus, binding of a monomer domain to the ligand will reduce the half-life of the ligand, thereby reducing ligand concentration by clearing the ligand through the kidney so long as the complex is no larger than the maximum size able to pass through the kidney (less than about 50 or 40 kD).
- the portion of the ligand (e.g., HGF) bound by the monomer domain will generally not matter, though it may be beneficial to bind the ligand at the portion of the ligand that binds to its receptor (e.g., Met), thereby further inhibiting the ligand's effect.
- This method is useful for reducing the concentration of any molecule in the bloodstream.
- a multimer comprising a first monomer domain that binds to a half-life extender and a second monomer domain that binds to a portion of the ligand that does not bind to the ligand's receptor can be used to increase the half-life of the ligand.
- a multimer comprising a first monomer domain that binds to the ligand and a second monomer domain that binds to the receptor can be used to increase the effective affinity of the ligand for the receptor.
- multimers comprising at least two monomers that bind to receptors are used to bring two receptors into proximity by both binding the multimer, thereby activating the receptors.
- Further examples of potential uses of the invention include monomer domains, and multimers thereof, that are capable of drug binding (e.g., binding radionucleotides for targeting, pharmaceutical binding for half-life extension of drugs, controlled substance binding for overdose treatment and addiction therapy), immune function modulating (e.g., immunogenicity blocking by binding such receptors as CTLA-4, immunogenicity enhancing by binding such receptors as CD80,or complement activation by Fc type binding), and specialized delivery (e.g., slow release by linker cleavage, electrotransport domains, dimerization domains, or specific binding to: cell entry domains, clearance receptors such as FcR, oral delivery receptors such as plgR for trans-mucosal transport, and blood-brain transfer receptors such as transferrinR).
- drug binding e.g., binding radionucleotides for targeting, pharmaceutical binding for half-life extension of drugs, controlled substance binding for overdose treatment and addiction therapy
- immune function modulating e.g., immunogenicity blocking by binding
- monomers or multimers can be linked to a detectable label (e.g., Cy3, Cy5, etc.) or linked to a reporter gene product (e.g., CAT, luciferase, horseradish peroxidase, alkaline phosphotase, GFP, etc.).
- a detectable label e.g., Cy3, Cy5, etc.
- a reporter gene product e.g., CAT, luciferase, horseradish peroxidase, alkaline phosphotase, GFP, etc.
- Monomers or multimers of the invention that bind to Met may also be used in diagnostic and predictive applications in which is is useful to detect Met. For example, detection of Met can be used to predict prognosis of breast cancer, wherein higher abundance of Met than in a normal tissue indicates a poor prognosis. See, e.g., U.S. Patent No. 6,673,559. LX. FURTHER MANIPULATING MONOMER DOMAINS AND/OR
- polypeptide of the present invention can be altered. Descriptions of a variety of diversity generating procedures for generating modified or altered nucleic acid sequences encoding these polypeptides are described herein and the references cited therein.
- Another aspect of the present invention includes the cloning and expression of monomer domains, selected monomer domains, multimers and/or selected multimers coding nucleic acids.
- multimer domains can be synthesized as a single protein using expression systems well known in the art.
- the present invention also relates to the introduction of vectors of the invention into host cells, and the production of monomer domains, selected monomer domains, multimers and/or selected multimers of the invention by recombinant techniques.
- Host cells are genetically engineered (i.e., transduced, transformed or transfected) with the vectors of this invention, which can be, for example, a cloning vector or an expression vector.
- the vector can be, for example, in the form of a plasmid, a viral particle, a phage, etc.
- the engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants, or amplifying the monomer domain, selected monomer domain, multimer and/or selected multimer gene(s) of interest.
- the culture conditions such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to those skilled in the art and in the references cited herein, including, e.g., Freshney (1994) Culture of Animal Cells, a Manual of Basic Technique, third edition, Wiley- Liss, New York and the references cited therein.
- polypeptides of the invention can also be produced in non-animal cells such as plants, yeast, fungi, bacteria and the like. Indeed, as noted throughout, phage display is an especially relevant technique for producing such polypeptides. In addition to Sambrook, Berger and Ausubel, details regarding cell culture can be found in Payne et al. (1992) Plant Cell and Tissue Culture in Liquid Systems John Wiley & Sons, Inc.
- the present invention also includes alterations of monomer domains, immuno-domains and/or multimers to improve pharmacological properties, to reduce immunogenicity, or to facilitate the transport of the multimer and/or monomer domain into a cell or tissue (e.g., through the blood-brain barrier, or through the skin).
- These types of alterations include a variety of modifications (e.g., the addition of sugar-groups or glycosylation), the addition of PEG, the addition of protein domains that bind a certain protein (e.g., HSA or other serum protein), the addition of proteins fragments or sequences that signal movement or transport into, out of and through a cell.
- Additional components can also be added to a multimer and/or monomer domain to manipulate the properties of the multimer and/or monomer domain.
- a variety of components can also be added including, e.g., a domain that binds a known receptor (e.g., a Fc-region protein domain that binds a Fc receptor), a toxin(s) or part of a toxin, a prodomain that can be optionally cleaved off to activate the multimer or monomer domain, a reporter molecule (e.g., green fluorescent protein), a component that bind a reporter molecule (such as a radionuclide for radiotherapy, biotin or avidin) or a combination of modifications.
- a domain that binds a known receptor e.g., a Fc-region protein domain that binds a Fc receptor
- a prodomain that can be optionally cleaved off to activate the multimer or monomer domain
- a reporter molecule e.g
- Another aspect of the invention is the development of specific non- human animal models in which to test the immunogenicity of the monomer or multimer domains.
- the method of producing such non-human animal model comprises: introducing into at least some cells of a recipient non-human animal, vectors comprising genes encoding a plurality of human proteins from the same family of proteins, wherein the genes are each operably linked to a promoter that is functional in at least some of the cells into which the vectors are introduced such that a genetically modified non-human animal is obtained that can express the plurality of human proteins from the same family of proteins.
- Suitable non-human animals employed in the practice of the present invention include all vertebrate animals, except humans (e.g., mouse, rat, rabbit, sheep, and the like).
- the plurality of members of a family of proteins includes at least two members of that family, and usually at least ten family members.
- the plurality includes all known members of the family of proteins.
- Exemplary genes that can be used include those encoding monomer domains, such as, for example, members of the LDL receptor class A-domain family, the EGF-like domain family, as well as the other domain families described herein.
- the non-human animal models of the present invention can be used to screen for immunogenicity of a monomer or multimer domain that is derived from the same family of proteins expressed by the non-human animal model.
- the present invention includes the non-human animal model made in accordance with the method described above, as well as transgenic non-human animals whose somatic and germ cells contain and express DNA molecules encoding a plurality of human proteins from the same family of proteins (such as the monomer domains described herein), wherein the DNA molecules have been introduced into the transgenic non-human animal at an embryonic stage, and wherein the DNA molecules are each operably linked to a promoter in at least some of the cells in which the DNA molecules have been introduced.
- FIG. 1 An example of a mouse model useful for screening LDL receptor class A-domain derived binding proteins is described as follows. Gene clusters encoding the wild type human LDL receptor class A-domain monomers are amplified from human cells using PCR. Almost all of the 200 different A-domains can be amplified with only three separate PCR amplification reactions of about 7kb each. These fragments are then used to generate transgenic mice according to the method described above. The transgenic mice will recognize the human A-domains as "self, thus mimicking the "selfness" of a human with regard to A-domains.
- mice Individual A-domain-derived monomers or multimers are tested in these mice by injecting the A-domain-derived monomers or multimers into the mice, then analyzing the immune response (or lack of response) generated. The mice are tested to determine if they have developed a mouse anti-human response (MAHR). Monomers and multimers that do not result in the generation of a MAHR are likely to be non-immunogenic when administered to humans.
- MAHR mouse anti-human response
- Kits comprising the components needed in the methods (typically in an unmixed form) and kit components (packaging materials, instructions for using the components and/or the methods, one or more containers (reaction tubes, columns, etc.)) for holding the components are a feature of the present invention.
- Kits of the present invention may contain a multimer library, or a single type of monomer or multimer. Kits can also include reagents suitable for promoting target molecule binding, such as buffers or reagents that facilitate detection, including detectably-labeled molecules. Standards for calibrating a ligand binding to a monomer domain or the like, can also be included in the kits of the invention.
- the present invention also provides commercially valuable binding assays and kits to practice the assays.
- one or more ligand is employed to detect binding of a monomer domain, immuno-domains and/or multimer.
- Such assays are based on any known method in the art, e.g., flow cytometry, fluorescent microscopy, plasmon resonance, and the like, to detect binding of a ligand(s) to the monomer domain and/or multimer.
- Kits based on the assay are also provided. The kits typically include a container, and one or more ligand.
- kits optionally comprise directions for performing the assays, additional detection reagents, buffers, or instructions for the use of any of these components, or the like.
- kits can include cells, vectors, (e.g., expression vectors, secretion vectors comprising a polypeptide of the invention), for the expression of a monomer domain and/or a multimer of the invention.
- the present invention provides for the use of any composition, monomer domain, immuno-domain, multimer, cell, cell culture, apparatus, apparatus component or kit herein, for the practice of any method or assay herein, and/or for the use of any apparatus or kit to practice any assay or method herein and/or for the use of cells, cell cultures, compositions or other features herein as a therapeutic formulation.
- manufacture of all components herein as therapeutic formulations for the treatments described herein is also provided.
- the present invention provides computers, computer readable media and integrated systems comprising character strings corresponding to monomer domains, selected monomer domains, multimers and/or selected rnultimers and nucleic acids encoding such polypeptides. These sequences can be manipulated by in silico recombination methods, or by standard sequence alignment or word processing software. [301] For example, different types of similarity and considerations of various stringency and character string length can be detected and recognized in the integrated systems herein. For example, many homology determination methods have been designed for comparative analysis of sequences of biopolymers, for spell checking in word processing, and for data retrieval from various databases.
- BLAST is described in Altschul et al, (1990) J. MoI. Biol. 215:403-
- HSPs high scoring sequence pairs
- Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0).
- M forward score for a pair of matching residues; always > 0
- N penalty score for mismatching residues; always ⁇ 0.
- a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- W wordlength
- E expectation
- PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, (1987) J. MoI. Evol. 35:351-360. The method used is similar to the method described by Higgins & Sharp, (1989) CABIOS 5:151-153. The program can align, e.g., up to 300 sequences of a maximum length of 5,000 letters. The multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences.
- This cluster can then be aligned to the next most related sequence or cluster of aligned sequences.
- Two clusters of sequences can be aligned by a simple extension of the pairwise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pairwise alignments.
- the program can also be used to plot a dendogram or tree representation of clustering relationships. The program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison. For example, in order to determine conserved amino acids in a monomer domain family or to compare the sequences of monomer domains in a family, the sequence of the invention, or coding nucleic acids, are aligned to provide structure-function information.
- the computer system is used to perform "in silico" sequence recombination or shuffling of character strings corresponding to the monomer domains.
- Methods for Making Character Strings, Polynucleotides & Polypeptides Having Desired Characteristics are set forth in "Methods For Making Character Strings, Polynucleotides & Polypeptides Having Desired Characteristics" by Selifonov and Stemmer, filed February 5, 1999 (USSN 60/118854) and “Methods For Making Character Strings, Polynucleotides & Polypeptides Having Desired Characteristics” by Selifonov and Stemmer, filed October 12, 1999 (USSN 09/416,375).
- genetic operators are used in genetic algorithms to change given sequences, e.g., by mimicking genetic events such as mutation, recombination, death and the like.
- Multi-dimensional analysis to optimize sequences can be also be performed in the computer system, e.g., as described in the '375 application.
- a digital system can also instruct an oligonucleotide synthesizer to synthesize oligonucleotides, e.g., used for gene reconstruction or recombination, or to order oligonucleotides from commercial sources (e.g., by printing appropriate order forms or by linking to an order form on the Internet).
- an oligonucleotide synthesizer to synthesize oligonucleotides, e.g., used for gene reconstruction or recombination, or to order oligonucleotides from commercial sources (e.g., by printing appropriate order forms or by linking to an order form on the Internet).
- the digital system can also include output elements for controlling nucleic acid synthesis (e.g., based upon a sequence or an alignment of a recombinant, e.g., recombined, monomer domain as herein), i.e., an integrated system of the invention optionally includes an oligonucleotide synthesizer or an oligonucleotide synthesis controller.
- the system can include other operations that occur downstream from an alignment or other operation performed using a character string corresponding to a sequence herein, e.g., as noted above with reference to assays.
- Starting materials for identifying monomer domains and creating multimers from the selected monomer domains and procedures can be derived from any of a variety of human and/or non-human sequences.
- one or more monomer domain gene(s) are selected from a family of monomer domains that bind to a certain ligand.
- the nucleic acid sequences encoding the one or more monomer domain gene can be obtained by PCR amplification of genomic DNA or cDNA, or optionally, can be produced synthetically using overlapping oligonucleotides.
- sequences are then cloned into a cell surface display format (i.e., bacterial, yeast, or mammalian (COS) cell surface display; phage display) for expression and screening.
- a cell surface display format i.e., bacterial, yeast, or mammalian (COS) cell surface display; phage display
- the recombinant sequences are transfected (transduced or transformed) into the appropriate host cell where they are expressed and displayed on the cell surface.
- the cells can be stained with a labeled (e.g., fluorescently labeled), desired ligand.
- the stained cells are sorted by flow cytometry, and the selected monomer domains encoding genes are recovered (e.g., by plasmid isolation, PCR or expansion and cloning) from the positive cells.
- the process of staining and sorting can be repeated multiple times (e.g., using progressively decreasing concentrations of the desired ligand until a desired level of enrichment is obtained).
- any screening or detection method known in the art that can be used to identify cells that bind the desired ligand or mixture of ligands can be employed.
- the selected monomer domain encoding genes recovered from the desired ligand or mixture of ligands binding cells can be optionally recombined according to any of the methods described herein or in the cited references.
- the recombinant sequences produced in this round of diversification are then screened by the same or a different method to identify recombinant genes with improved affinity for the desired or target ligand.
- the diversification and selection process is optionally repeated until a desired affinity is obtained.
- the selected monomer domain nucleic acids selected by the methods can be joined together via a linker sequence to create multimers, e.g., by the combinatorial assembly of nucleic acid sequences encoding selected monomer domains by DNA ligation, or optionally, PCR-based, self-priming overlap reactions.
- the nucleic acid sequences encoding the multimers are then cloned into a cell surface display format (i.e., bacterial, yeast, or mammalian (COS) cell surface display; phage display) for expression and screening.
- COS mammalian
- the cells can be stained with a labeled, e.g., fluorescently labeled, desired ligand or mixture of ligands.
- the stained cells are sorted by flow cytometry, and the selected multimers encoding genes are recovered (e.g., by PCR or expansion and cloning) from the positive cells.
- Positive cells include multimers with an improved avidity or affinity or altered specificity to the desired ligand or mixture of ligands compared to the selected monomer domain(s).
- the process of staining and sorting can be repeated multiple times (e.g., using progressively decreasing concentrations of the desired ligand or mixture of ligands until a desired level of enrichment is obtained).
- any screening or detection method known in the art that can be used to identify cells that bind the desired ligand or mixture of ligands can be employed.
- the selected multimer encoding genes recovered from the desired ligand or mixture of ligands binding cells can be optionally recombined according to any of the methods described herein or in the cited references.
- the recombinant sequences produced in this round of diversification are then screened by the same or a different method to identify recombinant genes with improved avidity or affinity or altered specificity for the desired or target ligand.
- the diversification and selection process is optionally repeated until a desired avidity or affinity or altered specificity is obtained.
- a monomer-encoding plasmid vector (pCK-derived vector; see below), flanked by orthologous loxP sites, was recombined in a Cre-dependent manner with a phage vector via its compatible loxP sites.
- the recombinant phage vectors were detected by PCR using primers specific for the recombinant construct. DNA sequencing indicated that the correct recombinant product was generated.
- pCK-cre-lox-Monomer-loxP This vector has two particularly relevant features. First, it carries the cre gene, encoding the site-specific DNA recombinase Cre, under the control of Pi ac . Cre was PCR-amplified from p705-cre (from GeneBridges) with cre-specific primers that incorporated Xb ⁇ l (5') and Sfil (3') at the ends of the PCR product. This product was digested withZ& ⁇ l and Sfil and cloned into the identical sites of pCK, a bid, Cm R derivative of pCKl 10919-HC-Bla (pACYC ori), yielding pCK-cre.
- Cre was PCR-amplified from p705-cre (from GeneBridges) with cre-specific primers that incorporated Xb ⁇ l (5') and Sfil (3') at the ends of the PCR product. This product was digested withZ& ⁇ l and Sfil and cloned into
- the second feature is the na ⁇ ve A domain library flanked by two orthologous loxP sites, loxP( wild-type) and loxP ⁇ AS), which are required for the site- specific DNA recombination catalyzed by Cre. See, e.g., Siegel, R. W., et al.. FEBS Letters 505 :467-473 (2001). These sites rarely recombine with another. loxP sites were built into pCK-cre sequentially.
- This construct was then digested with Sphl and BgM and ligated to digested na ⁇ ve A domain library insert, which was obtained via a PCR- amplification of a preexisting A domain library pool.
- the loxP sites andmonomer are in-frame, which generates monomers with / ⁇ xP-encoded linkers.
- This library was utilized in the in vivo recombination procedure as detailed below.
- f ⁇ SE5HA-Monomer-lox-lox vector The vector is a derivative of fUSE5 from George Smith's laboratory (University of Missouri). It was subsequently modified to carry an HA tag for immunodetection assays. loxP sites were built into fUSE5HA sequentially.
- oligonucleotides loxP(I) and loxP(I)_rc, carrying loxP(WT), a string of stop codons and Xmal and iS/H-compatible overhangs were hybridized together and ligated to Xmal- and ⁇ /zl-digested fUSE5HA in a standard ligation reaction (New England Biolabs T4 ligase; overnight at 16C).
- the resulting phage vector was next digested with Xm ⁇ l and Sphl and ligated to the hybridized oligos loxP(J) and loxP(J)_rc, which carry loxP( ⁇ 1 AS) and overhangs compatible with Xmal and Sphl.
- This construct was digested with Xmal/Sfil and then ligated to pre-cut (Xmal/Sfi ⁇ ) na ⁇ ve A domain library insert (PCR product).
- the stop codons are located between the loxP sites, preventing expression of gill and consequently, the production of infectious phage.
- the ligated vector/library was subsequently transformed into an E. coli host bearing a gill-expressing plasmid that allows the rescue of the fUSE5HA-Monomer-lox- lox phage, as detailed below.
- pCK-g/// This plasmid carries gill under the control of its native promoter. It was constructed by PCR-amplifying gill and its promoter from VCSMl 3 helper phage (Stratagene) with primers gIIIPromoter_EcoRI and gIIIPromoter_HinDIII. This product was digested with Ec ⁇ Bl and HmDIII and cloned into the same sites of pCKl 10919- HC-BIa. As gill is under the control of its own promoter, gill expression is presumably constitutive. pCK-gZZ/ was transformed into E. coli EClOO (Epicentre).
- Electrocompetent cells carrying pCK-glll were prepared by a standard protocol. These cells had a transformation frequency of 4 x 10 8 / ⁇ g DNA and were electroporated with large-scale ligations ( ⁇ 5 ⁇ g vector DNA) of fUSE5HA-lox-lox vector and the na ⁇ ve A domain library insert. After individual electroporations (100 ng DNA/electroporation) with ⁇ 70 ⁇ L cells/cuvette, 930 ⁇ L warm SOC media were added, and the cells were allowed to recover with shaking at 37C for 1 hour.
- tetracycline was added to a final concentration of 0.2 ⁇ g/mL, and the cells were shaken for ⁇ 45 minutes at 37C. An aliquot of this culture was removed, 10-fold serially diluted and plated to determine the resulting library size (1.8 x 10 7 ). The remaining culture was diluted into 2 x 500 mL 2xYT (with 20 ⁇ g/mL chloramphenicol and 20 ⁇ g/mL tetracycline to select for pCK-gZ// and the fUSE5HA-based vector, respectively) and grown overnight at 3OC.
- the ligated pCK/ na ⁇ ve A domain library is electroporated into a bacterial F + host, with an expected library size of approximately 10 . After an hour-long recovery period at 37C with shaking, the electroporated cells are diluted to OD 600 ⁇ 0.05 in 2xYT (plus 20 ⁇ g/mL chloramphenicol) and grown to mid-log phase at 37C before infection by fUSEHA- Monomer-lox-lox.
- the CaEGF domain library, E3 encodes a protein domain of 36-43 amino acids having the following pattern:
- V AZCZG
- N AZCZGZT
- the Group 1 PCR fragments were digested with Bpml and group 2 PCR fragments were digested with BsrDI. Digestion products were purified using Qiagen Qiaquick columns and then ligated together. The ligated DNA was then amplified in a PCR using two primers. These are:
- the PCR products were purified with Qiagen Qiaquick columns and digested with Sfil.
- the digested product was purified with Qiagen Qiaquick columns.
- the DNA fragments were ligated into the Sfil restriction sites of phage display vector fuse5- HA(G4S)4, a derivative of fuse5 carrying an in-frame HA-epitope and a glycine, serine flexible linker.
- the ligation mixture was electroporated into TransforMaxTM EC 100TM electrocompetent E. coli cells.
- Transformed E. coli cells were grown overnight at 37°C in 2xYT medium containing 20 ⁇ gZml tetracycline.
- the resulting library contained 2X10 9 independent clones. Phage particles were purified from the culture medium by PEG- precipitation.
- the titer of the phage was 1.3XlO 12 ZmI. The sequences of 24 individual clones were determined and these were consistent with
- Recombination can be used for intradomain optimization.
- FOr example a PCR overlap reaction can be used that recombines two or more segments of a single domain relative to each other.
- This recombination process has many applications.
- One application is to recombine a large pool of hundreds of previously selected clones without sequence information. All that is needed for each overlap to work is one known region of (relatively) constant sequence that exists in the same location in each of the clones (fixed site approach).
- For A domains typically these clones would have been derived from a library in which 20-25 amino acids distributed over all five inter-cysteine segments were randomized.
- the intra-domain recombination method can also be performed on a pool of sequence-related monomer domains by standard DNA recombination (e.g., Stemmer, Nature 370:389-391 (1994)) based on random fragmentation and reassembly based on DNA sequence homology, which does not require a fixed overlap site in all of the clones that are to be recombined.
- standard DNA recombination e.g., Stemmer, Nature 370:389-391 (1994)
- random fragmentation and reassembly based on DNA sequence homology, which does not require a fixed overlap site in all of the clones that are to be recombined.
- Another application of this process is to create multiple separate, na ⁇ ve (meaning unpanned) libraries in each of which only one of the intercysteine loops is randomized, to randomize a different loop in each library. After panning of these libraries separately against the target, the selected clones are then recombined. From each panned library only the randomized segment is amplified by PCR and multiple randomized segments are then combined into a single domain, creating a shuffled library which is panned and/or screened for increased potency. This process can also be used to shuffle a small number of clones of known sequence.
- cysteine residues are logical places for the crossover.
- there are other ways to determine optimal crossover sites such as computer modeling.
- residues with highest entropy, or the least number of intramolecular contacts may also be good sites for crossovers.
- C1-C6 cysteines
- X(n) sequence of n amino acids with any residue at each position
- E1-E3 glutamine
- F phenylalanine
- R1-R2 arginine
- A alanine
- G1-G4 glycine
- V valine
- the library was constructed by creating a library of DNA sequences, containing tyrosine codons (TAT) or variable non-conserved codons (NNK), by assembly PCR as described in Stemmer et al, Gene 164:49-53 (1995).
- TAT tyrosine codons
- NNK variable non-conserved codons
- the rate of tyrosine residues was increased by including tyrosine codons in the oligonucleotides, because tyrosines were found to be overrepresented in antibody binding sites, presumably because of the large number of different contacts that tyrosine can make.
- the oligonucleotides used in this PCR reaction are:
- Pool 1 contained oligonucleotides 1-9
- pool 2 contained 10-17
- pool 3 contained only 18
- pool 4 contained 19-27.
- the fully assembled library was obtained through an additional 8 cycles of PCR using pool 1 and 4.
- the library fragments were digested with Xmal and Sf-I.
- the DNA fragments were ligated into the corresponding restriction sites of phage display vector fuse5-HA, a derivative of fuse5 carrying an in-frame HA-epitope.
- the ligation mixture was electroporated into TransforMaxTM EC 100TM electrocompetent E. coli cells resulting in a library of 2X10 9 individual clones.
- Transformed E. coli cells were grown overnight at 37°C in 2xYT medium containing 20 ⁇ g/ml tetracycline. Phage particles were purified from the culture medium by PEG-precipitation and a titer of 1.1 Xl O 13 ZmI was determined. Sequences of 24 clones were determined and were consistent with the expectations of the library design.
- This example describes optimization of multimers by optimizing monomers andZor linkers for binding to a target.
- One approach for optimizing multimer binding to targets involves optimization of monomers, multimers and linkers.
- a library of monomers is panned for binding to the target (e.g., Met).
- the target e.g., Met
- some of the monomers may bind at locations on the target that are far away from each other, such that the domains that bind to these sites cannot be connected by a linker peptide. It is therefore useful to create and screen a large library of homo- or heterotrimers from these monomers before optimization of the monomers.
- These trimer libraries can be screened, e.g., on phage (typical for heterotrimers created from a large pool of monomers) or made and assayed separately (e.g., for homotrimers). By this method, the best trimer is identified.
- the assays may include binding assays to a target or agonist or antagonist potency determination of the multimer in functional protein- or cell-based assays.
- the monomelic domain(s) of the single best trimer are then optimized as a second step. Homomultimers are easiest to optimize, since only one domain sequence exists, though heteromultimers may also be synthesized. For homomultimers, an increase in binding by the multimer compared to the monomer is an avidity effect.
- Linker libraries may be formed, e.g., from linkers with an NNK composition and/or variable sequence length.
- the best clones (e.g., determined by potency in the inhibition or other functional assay) are converted into multimers composed of multiple (e.g., two, three, four, five, six, seven, eight, etc.) sequence-optimized domains and length- and sequence-optimized linkers.
- half-domain sequences selected against different targets can be combined into a single sequence which would be able to bind simultaneously or alternatively to the selected targets.
- creating binding sites that occupy only half a domain allows for the creation of molecules that are half as large and would have half the number of immunogenic epitopes, reducing the risk of immunogenicity.
- a canonical A-domain sequence is shown below with high-diversity positions represented as an X. Positions that belong to either the Top, Bottom, Loop 1, or Loop 2 categories are designated with a star.
- Example 6 This example describes screening for monomers or multimers that bind c-MET (also known as HGFR).
- Phage libraries were panned through several rounds either on solid support (e.g. Nunc Maxisorp plates) or in solution (e.g. Dynal Streptavidin or Protein A beads). Output phage pools with (a) the highest frequency of individual phage clones that bind to c-MET and (b) high sequence diversity among the binding-positive phage clones were chosen for protein screening.
- solid support e.g. Nunc Maxisorp plates
- Dynal Streptavidin or Protein A beads e.g. Dynal Streptavidin or Protein A beads
- Alternative reagents e.g. casein or milk can be used for blocking.
- Blocking Beads Coating solution was removed and beads were washed twice with TBS [pH 7.5J/2 mM CaCl 2 . 500 ⁇ l 1% BSA (protease-free) was added in TBS[pH 7.5]/2 mM CaCl 2 and rotated for 1 hr at room temperature. As noted above, alternative blocking reagents can be used.
- phage addition buffer 1% nonfat dry milk/ 0.2% BSA (protease-free), or other appropriate blocking agent
- TBS [pH 7.5]/2 mM CaCl 2 /0.1 % Tween-20 over a period of 30 - 45 min. Bead resuspension was facilitated by dispensing wash buffer directly onto collected beads or by pipetting up and down (not by vortexing). Alternatively, a KingFisher apparatus (Thermo LabSystems) or equivalent can be used for bead washing.
- HGF the c-MET ligand
- TBS [pH 7.5]/ 2mM CaCl 2 was added, and the plates were incubated at 37 0 C for 30 min with shaking.
- K91 E. coli cells at OD 60O ⁇ 0.5 were added to each well (for plates) or to aspirated beads. The infection was allowed to proceed for 30 min at 37 0 C without shaking. Next, the 200 ⁇ L volumes were pooled and added to ⁇ 3 mL of 2xYT/0.2 ⁇ g/mL tetracycline and shaken for 15 min at 37 0 C.
- Tetracycline was added to a final concentration of 0.2 ⁇ g/mL and shaken for 15 min at 37 0 C.
- OD 600 0.5-0.6 was added to 6 wells of a 96-well polypropylene plate.
- Tetracycline was added to a final concentration of 0.2 ⁇ g/mL and the plate was shaken for 15 min at 37 0 C.
- the phage pellet was resuspended in 1 mL TBS [pH 7.5]/ 2 mM CaCl 2 , transferred to an Eppendorf tube and centrifuged at 13K rpm for at least 2 min to pellet insoluble material.
- Phase ELISAs For each output "phage pool" to be analyzed (typically Rounds 2, 3 and 4, if applicable), independent clones were inoculated into 1 mL (2xYT/ 20 ⁇ g/mL tetracycline) cultures grown in Costar 96-well polypropylene deep-well plates. Inoculating tips were left in, and plates were shaken overnight at 37 0 C. Cells were pelleted by centrifugation at 3600 rpm for 15 min. Culture supernatants were retained and ELISAs were performed as described below.
- Non-biotinylated c-MET ECD/Fc (0.1 ⁇ g/well) was directly coated onto Nunc Maxisorp plates.
- biotinylated c-MET ECD/Fc, 96-well Nunc Maxisorp plates should first be coated with 50 ⁇ L/well of 50 ⁇ g/mL (2.5 ⁇ g/well) of streptavidin, diluted in TBS [pH 7.5]/ 2 mM CaCl 2 .
- the plate was incubated at 37 0 C for 1 hr with shaking. Plates were washed three times with 200 ⁇ L/well of TBS [pH 7.5]/ 2 mM CaCl 2 .
- Wells were blocked with 200 ⁇ L/well of 1% BSA (fraction V) and the covered plate was incubated at RT for 1 hr with shaking.
- the plate was washed three times with TBS [pH
- the 96-well Maxisorp plate was coated with 100 ⁇ L/well of 1 ⁇ g/mL (0.1 ⁇ g/well) biotinylated c-MET-ECD diluted in TBS [pH 7.5]/2 mM CaCl 2 or 100 ⁇ L/well buffer only (negative control). The plate was incubated at RT for 1 hr with shaking. Plates were washed three times with TBS [pH 7.5]/2 mM CaCl 2 .
- Phage ELISA-positive phage pools were chosen for subcloning into an expression vector if they had (a) a high frequency of individual phage clones that bound to c- Met ECD/Fc and (b) high sequence diversity among the binding-positive phage clones. Pools meeting these criteria were chosen for protein screening in the process outlined below. To subclone the monomer or multimer sequences from a given phage pool into the expression vector, pEve, approximately 10 8 -10 10 phage were amplified by 25 cycles of PCR as follows:
- PCR products were run on a 3% agarose gel for analysis.
- the monomer or multimer product (approximately 200 bp) was purified with a QIAquick spin column (Qiagen), digested with Sfi I (NEB), purified again with a QIAquick column and then ligated using T4 DNA Ligase (NEB) to the Sfi I digested vector, pEve.
- the ligation was transformed into electrocompetent BL21 (DE3) E. coli and plated onto 2xYT plates containing kanamycin at 40 ⁇ g /mL. Following overnight growth, approximately 6000 individual clones were inoculated into 2xYT/kanamycin and grown overnight. Positive and negative controls were also included on the plates.
- C-Met ECD/Fc Protein ELISA 96-well Maxisorp plates were coated with 100 ⁇ L/well of 1 ⁇ g /mL (0.1 ⁇ g/well) c-MET ECD/Fc (R&D systems) diluted in TBS[pH 7.5]/ 1 mM CaCl 2 , and the plate was incubated at 4 0 C overnight or room temperature (RT) for 1.5 hr with shaking. Wells were emptied and then blocked with 200 ⁇ L/well of 1% BSA (fraction V)/TBS[ ⁇ H7.5]/l mM CaCl 2 . The covered plate was incubated at RT for 1 hr with shaking.
- the plate was washed three times with TBS [pH 7.5]/l mM CaCl 2 .
- 100 ⁇ L/well of monomer protein was added to the plate diluted in TBS [pH 7.5]/l mM CaCl 2 / 0.1% BSA/ 0.02% Tween-20.
- Protein from 1 mL heated lysate preparations was added to the wells as a single point concentration diluted 1:10. Covered plates were incubated at RT for 1.5 hr with shaking.
- the plate was washed three times with TBS [pH 7.5J/1 mM CaCl 2 / 0.02% Tween-20.
- Monomers from 1 mL heated lysate preparations were added to the wells at a single concentration (either undiluted [i.e. 1 :4 final assay dilution] or up to a 1:100 dilution [1 :400 final assay dilution]).
- 2 ⁇ L/well of unlabeled rhHGF (PeproTech) was added to the plate as a twelve-point concentration curve starting with 400 nM (i.e. 100 nM final assay concentration) and then 1 :4 serial dilutions thereafter with the last point as buffer only.
- pEve/monomer Monomers that have been subcloned into pEve (pEve/monomer) were multimerized in the following manner.
- pEve/monomer plasmids (individually or in pools) were digested with either BsrDI or Bpml (NEB).
- BsrDI or Bpml BsrDI or Bpml
- the -1.1 kb BsrDI and -2.9 Bpml fragments were isolated from 1% agarose gels and purified with Qiagen QIAquick spin columns. Pools of each of the two fragments were ligated using T4 DNA ligase (NEB); subsequently, the ligation was purified with a Qiagen QIAquick spin column.
- the multimer coding sequences were PCR-amplified from the ligation.
- the PCR products were purified and digested with Sfil (NEB), followed by ligation with pEve and transformation of BL21 (DE3) E. coli.
- This method created dimers comprised of different combinations of the starting monomers.
- This method can also be used to generate other multimers, such as trimers.
- trimers pools of pEve/dimers (e.g. in above example) and pEve/monomers (the starting collection) are the starting materials. They are processed as above.
- a molecular biology procedure similar to that described below for making "walking libraries” was also used to generate multimers. In all cases, proteins were expressed, purified and screened as above.
- walking libraries were generated by ligating phage display-selected monomers (i.e. selected monomers) with the full representation of a na ⁇ ve monomer library. These libraries were constructed in the following manner. PCR was used to amplify in two separate reactions: a) the coding sequences of the selected monomers with pETF (ACCCGTATGATGTTCCGGATTA) /pETB2r (GATGTATTCGGCCCCAGA GGCCTGCAATGAC); andb) the coding sequences of na ⁇ ve monomers in a monomer library with 21newl (GAAATTCACCTCGAAAGCAA)/23
- the -200 bp products were isolated from a 3% agarose gel and purified with Qiagen QIAquick spin columns. Each product from (a) and (b) above was digested with either BsrDI or Bpml (NEB) in separate reactions. Bpml-digested monomers have an overhang which can be ligated to BsrDI-digested monomers. The purified digestion products were ligated to one another using T4 DNA ligase (NEB).
- Ligation of BsrDI-cut na ⁇ ve monomers with Bpml-cut selected monomers generates a walking dimer library comprised of N-terminal na ⁇ ve monomers fused to C-terminal selected monomers.
- Ligation of Bpml-cut na ⁇ ve monomers with BsrDI-cut selected monomers generates a walking dimer library comprised of C-terminal na ⁇ ve monomers fused to N-terminal selected monomers.
- Primers pETF/pETB2r were used to PCR-amplify the ligated dimer coding sequences from the ligation, and the purified products were digested with Sfil followed by Xmal.
- the digested products were ligated to the phage vector fUSE5HA for the generation of a phage display dimer "walking library", typically with 10 -10 9 unique members.
- a trimer (or larger multimer) "walking library” can be generated in a similar fashion, except that the starting materials are dimers (or larger) and na ⁇ ve monomers. Walking libraries were panned against c-MET ECD/Fc and screened as described above.
- NiNTA resin Qiagen
- Milli-Q water 3 mL of 1 :1 diluted NiNTA resin/protein was used (i.e. actually 1.5 mL of resin/protein was used).
- 3 mL of resin/water mix each was added to appropriately labeled (with protein ID) clean 50 mL screw cap tube. After sonicated cells were pelleted, protein supernatant was removed and added to 50 mL tube containing the 1.5 mL of washed NiNTA resin. Protein was allowed bind to NiNTA resin by rocking gently for 0.5 hr. @ RT.
- NiNTA resin + bound protein was transferred to appropriately labeled 15 mL Clontech columns by adding 1 mL of NiNTA Wash Buffer (20 niM Tris [pH 7.5], 200 mM NaCl, 0.1 niM CaCl 2 , 20 mM imidazole) to 50 mL tube containing resin, swirling to resuspend, then pipetting the mixture into a column which has been mounted on a vacuum manifold.
- NiNTA Wash Buffer 20 niM Tris [pH 7.5], 200 mM NaCl, 0.1 niM CaCl 2 , 20 mM imidazole
- NiNTA resin + bound protein was washed with at least 10 column volumes (15 mL) of NiNTA wash buffer. 15 mL columns containing NiNTA resin + bound and washed protein was transferred to clean 15 mL screw cap collection tubes. 4 mL of Ni Elution buffer (20 mM Tris [pH 7.5], 200 mM NaCl, 0.1 mM CaCl 2 , 200 mM imidazole) was added to each column to elute off protein into the 15 mL collection tube. It was then allowed to elute by gravity.
- the anti-c-MET NiNTA purified proteins which were selected as the "best inhibitors" in AlphaScreen competition assays, were further purified by Q-Sepharose anion exchange to remove contaminants.
- Q-Sepharose Purification 1 mL of Q-Sepharose Fast-Flow Resin (Amersham Biosciences) was added to 15 mL Clontech column. Resin with 15 column volumes (or 15 mL) of 20 mM Tris [pH 7.5], 50 mM NaCl, 1 mM CaCl 2 was equilibrated. 2 mL ( ⁇ 5 mg) of filtered NiNTA-purified protein was added to resin and protein was allowed to bind to resin by gravity.
- HGF is a potent stimulator of epithelial cell proliferation.
- A549 human lung adenocarcinoma cells in assays of HGF-induced proliferation for determining efficacy of HGF and/or c-MET inhibitors is well established in the art.
- A549-SC single cell clone of the A549 cell line, termed A549-SC, was derived by limiting dilution.
- the A549-SC clone was selected on the basis of its strong cell scattering response in the presence of HGF.
- A549-SC cells were plated on collagen-coated 96 well plates (1x10 4 cells/well) in 100 ⁇ l serum-free F- 12 medium per well, then incubated for 48 hr at 37 0 C in 5% CO 2 . After 48 hr, medium was removed from the wells and replaced with dilutions of monomer, in a volume of 50 ⁇ l per well serum-free F- 12 medium. After 1 hr incubation at 37 0 C in 5% CO 2 , 50 ⁇ l serum-free F- 12 medium supplemented with 40 ng/ml recombinant human HGF was added, to give a final concentration of 20 ng/ml HGF, the EC50 for HGF.
- the plates were incubated for a further 48 hr at 37 0 C in 5% CO 2 , then pulsed with 2 ⁇ Ci tritiated methylthyrnidine per well for a further 15 hr. After pulsing, medium was removed and replaced with 200 ⁇ l 0.05% trypsin per well, and the plates were incubated at 37 0 C for 5 min. The labeled cells were then harvested to a glass fiber filter using a Tomtec Harvester 96. Incorporated label was then measured by scintillation counting.
- Figure 9 shows a comparison between c-METFc, a c-MET-specific monomer (M26) and a c-MET-specific dimer (RM12; RecM12) with regards to their relative abilities to block HGF-induced proliferation of serum-starved A549-SC human lung adenocarcinoma cells.
- the IC50 for dimer RMl 2 is 0.32nM.
- Monomer M26 showed little detectable inhibitory activity in this cell-based assay.
- This assay provides a means to screen monomers or multimers for anti- c-MET activity in an in vitro bioassay using human cells. By determining IC50 values for tested multimers or monomers, optimal molecules can be identified and ranked on the basis of their biological activity.
- Example 8 This example describes experiments demonstrating monomer binding to a c-MET-expressing human cell line.
- Monomers were constructed to include an influenza hemagluttinin (HA) epitope tag. This enables the monomer to be used as a primary flow cytometry detection agent, with a fluorescent-tagged anti-HA secondary antibody being used as the secondary detection agent.
- HA influenza hemagluttinin
- the adherent A549 cells were harvested from tissue culture plates using 10 mM EDTA in phosphate buffered saline (pH 7.4). Jurkat T cells were removed from culture medium by centrifugation. To determine monomer binding, 2.5 X 10 5 cells were stained with 10 ⁇ M c-MET monomer in 100 ⁇ l flow cytometry staining buffer ("FACS buffer:" PBS pH 7.4, 5% fetal calf serum, 0.01% sodium azide) on ice for 30 min.
- FACS buffer PBS pH 7.4, 5% fetal calf serum, 0.01% sodium azide
- Example 9 This example describes experiments designed to show monomer inhibition of HGF -induced cell scattering.
- HGF was identified as 'scatter factor', inducing a motile phenotype in epithelial cells. On addition of HGF, epithelial cell clusters break apart, and the cells migrate away from each other, or scatter. [426] A single cell clone of A549 human lung adenocarcinoma (termed
- A549-SC was isolated by limiting dilution on the basis of forming tight clusters which scatter over the course of 24 hr after addition of recombinant human HGF. This clone was used in all subsequent experiments.
- A549-SC was plated at 25 cells/well in a 96 well plate in F- 12 medium supplemented with 10% FBS. Cells were cultured until clusters of 20 to 30 cells were visible, approximately 4 days.
- the plates were then incubated for 24 hr at 37 0 C in 5% CO 2 . After 24 hr medium was removed from the plates, and the cells were fixed with 100% methanol for 15 min at room temperature, and then stained for 1 hr at room temperature with 0.2% crystal violet in 30% ethanol. Stained cells were washed with phosphate-buffered saline, and then photographed.
- the invention provides polypeptides comprising non-naturally occurring monomer domains that bind c-MET and that have the sequence GR or KR immediately preceding the third cysteine in an A domain scaffold.
- CE-SNEFQCRSTGRCVPVAWVCDGDNDCEDSSDEK NCKAPT
- CE-SNEFQCRSTGRCVPVAWVCDGDNDCEDSSDEK DCSAPASEPPGSL
- CESNQFQCHSTGRCVPQSWRCDGVNDCEDSSDETDCAP PT CLSNQFQCNSTNRCIPQHWLCDGDNDCEDSSDEKGCAATGHT
- CAADEFQCNSTGRCIPVSWVCDGVNDCEDSSDEAGC-ATSGPT CAADEFQCNSTGRCIPVSWVCDGVNDCEDSSDEAGC-ATSGPT—
- CAADEFQCNSTGRCIPVSWVCDGDNDCEDGSDESPA-LCKAPT CAADEFQCNSTGRCIPQEWVCDGVNDCEDSSDESPA-LCKAPT--
- CE-PSQFTCRSTSRCIPRTWLCDGDNDCEDGSDE ANCTA AVHT- CS-SDEFQCSSTSRCIPREWVCDGVNDCEDGSDEALAPCTS TAHT-
- CRA-NEFQCHSTGRCIPASWLCDGDNDCEDSSDE KGCGDSHILPFXTPGPST
- CRA-NEFQCHSTGRCIPASWLCDGDNDCEDSSDE TGC AKPT-
- CEA-NEFQCQSTGRCIPLNWLCDGDNDCEDGSDE TNCG TPGPT-
- CEA-SEFTCRSTDRCIPLEWLCDGDNDCEDGSDEAN CG AAART-
- Fam 10 monomer domains can be further divided into subfamilies
- c-MET-binding monomer domains having an A domain scaffold and comprising the sequence:
- c-MET binding dimers i.e., polypeptides comprising two monomer domains, each of which bind c-MET.
- Tables following each family of dimers represent consensus motifs based on alignment of the family members. Note that "Fam” designations below refer to dimer families, which are different than the monomer families listed above.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Cell Biology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Pathology (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP05787547A EP1776134A4 (en) | 2004-06-17 | 2005-06-17 | C-MET KINASE BINDING PROTEINS |
| CA2569191A CA2569191C (en) | 2004-06-17 | 2005-06-17 | C-met kinase binding proteins |
| MXPA06014796A MXPA06014796A (es) | 2004-06-17 | 2005-06-17 | Proteinas de enlace cinasa c-met. |
| JP2007516800A JP2008503216A (ja) | 2004-06-17 | 2005-06-17 | c−METキナーゼ結合タンパク質 |
| AU2005265150A AU2005265150B2 (en) | 2004-06-17 | 2005-06-17 | C-MET kinase binding proteins |
| KR1020077001057A KR101238074B1 (ko) | 2004-06-17 | 2005-06-17 | c-MET 키나제 결합 단백질 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US10/871,602 | 2004-06-17 | ||
| US10/871,602 US20050089932A1 (en) | 2001-04-26 | 2004-06-17 | Novel proteins with targeted binding |
| US10/957,351 US20060008844A1 (en) | 2004-06-17 | 2004-09-30 | c-Met kinase binding proteins |
| US10/957,351 | 2004-09-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2006009888A2 true WO2006009888A2 (en) | 2006-01-26 |
| WO2006009888A3 WO2006009888A3 (en) | 2006-07-06 |
Family
ID=35785714
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2005/021558 Ceased WO2006009888A2 (en) | 2004-06-17 | 2005-06-17 | C-met kinase binding proteins |
Country Status (8)
| Country | Link |
|---|---|
| US (3) | US20060008844A1 (https=) |
| EP (2) | EP2151453A1 (https=) |
| JP (1) | JP2008503216A (https=) |
| KR (1) | KR101238074B1 (https=) |
| AU (1) | AU2005265150B2 (https=) |
| CA (1) | CA2569191C (https=) |
| MX (1) | MXPA06014796A (https=) |
| WO (1) | WO2006009888A2 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7435562B2 (en) | 2000-07-21 | 2008-10-14 | Modular Genetics, Inc. | Modular vector systems |
| EP2016093A1 (en) * | 2006-05-05 | 2009-01-21 | Universiteit Maastricht / Carim | Peptides for use in diagnosing the presence of ruptured atherosclerotic lesions in an individual |
| US7485423B2 (en) | 2004-11-11 | 2009-02-03 | Modular Genetics, Inc. | Ladder assembly and system for generating diversity |
Families Citing this family (183)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040005673A1 (en) * | 2001-06-29 | 2004-01-08 | Kevin Jarrell | System for manipulating nucleic acids |
| WO2000040715A2 (en) * | 1999-01-05 | 2000-07-13 | Trustees Of Boston University | Improved nucleic acid cloning |
| US20050048512A1 (en) * | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| US20040175756A1 (en) * | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
| US20050089932A1 (en) * | 2001-04-26 | 2005-04-28 | Avidia Research Institute | Novel proteins with targeted binding |
| US20050053973A1 (en) * | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
| US20060008844A1 (en) * | 2004-06-17 | 2006-01-12 | Avidia Research Institute | c-Met kinase binding proteins |
| WO2007009069A2 (en) * | 2005-07-13 | 2007-01-18 | Amgen Mountain View Inc. | Heat lysis production of proteins |
| AU2006340750B2 (en) | 2005-11-28 | 2013-03-07 | Zymogenetics, Inc. | IL-21 antagonists |
| GB2433591A (en) * | 2005-12-20 | 2007-06-27 | Sharp Kk | Method for functionalising a hydrophobic substrate |
| GB2433506A (en) * | 2005-12-20 | 2007-06-27 | Sharp Kk | A method of producing a multimeric capture agent |
| GB2433505A (en) * | 2005-12-20 | 2007-06-27 | Sharp Kk | Capture agents for binding a ligand |
| MX2009002418A (es) | 2006-09-05 | 2009-04-23 | Medarex Inc | Anticuerpos para las proteinas morfogenicas oseas y receptores de estas y metodos para su uso. |
| KR101722261B1 (ko) | 2006-10-02 | 2017-04-03 | 메다렉스, 엘.엘.시. | Cxcr4에 결합하는 인간 항체 및 이의 용도 |
| KR101552735B1 (ko) | 2006-12-01 | 2015-09-14 | 메다렉스, 엘.엘.시. | 씨디22에 결합하는 인간 항체 및 이의 용도 |
| CL2007003622A1 (es) | 2006-12-13 | 2009-08-07 | Medarex Inc | Anticuerpo monoclonal humano anti-cd19; composicion que lo comprende; y metodo de inhibicion del crecimiento de celulas tumorales. |
| US8846005B2 (en) | 2007-03-14 | 2014-09-30 | Novartis Ag | APCDD1 inhibitors for treating, diagnosing or detecting cancer |
| CN101801407B (zh) | 2007-06-05 | 2013-12-18 | 耶鲁大学 | 受体酪氨酸激酶抑制剂及其使用方法 |
| TWI489993B (zh) | 2007-10-12 | 2015-07-01 | Novartis Ag | 骨硬化素(sclerostin)抗體組合物及使用方法 |
| EP3103813A1 (en) | 2007-12-07 | 2016-12-14 | ZymoGenetics, Inc. | Anti-human il-21 monoclonal antibodies |
| US8937047B2 (en) | 2007-12-19 | 2015-01-20 | General Electric Company | Biokinetics of fast-clearing polypeptides |
| US8124725B2 (en) * | 2007-12-19 | 2012-02-28 | General Electric Company | PDGF-Rβ binders |
| IL198545A0 (en) * | 2008-05-14 | 2011-07-31 | Metheresis Translational Res Sa | High affinity binding site of hgfr and methods for identification of antagonists thereof |
| EP3629022A1 (en) | 2008-07-25 | 2020-04-01 | Richard W. Wagner | Protein screening methods |
| PY09026846A (es) | 2008-08-05 | 2015-09-01 | Novartis Ag | Composiciones y métodos para anticuerpos que se dirigen a la proteína de complemento c5 |
| US20110275535A1 (en) | 2008-12-16 | 2011-11-10 | Novartis Ag | Yeast Display Systems |
| CA2750581A1 (en) | 2009-01-21 | 2010-07-29 | Oxford Biotherapeutics Ltd. | Pta089 protein |
| US8420084B2 (en) | 2009-03-05 | 2013-04-16 | Medarex, Inc. | Fully human antibodies specific to CADM1 |
| DK2421898T3 (en) | 2009-04-20 | 2016-05-30 | Oxford Biotherapeutics Ltd | Cadherin-17 SPECIFIC ANTIBODIES |
| JP5766179B2 (ja) | 2009-04-27 | 2015-08-19 | ノバルティス アーゲー | 筋肉増殖を増加させるための組成物および方法 |
| EP2464657B1 (en) | 2009-08-10 | 2015-04-01 | MorphoSys AG | Novel screening strategies for the identification of antibodies or fragments thereof which bind an antigen that has an enzymatic activity |
| EP2470569A1 (en) | 2009-10-13 | 2012-07-04 | Oxford Biotherapeutics Ltd. | Antibodies against epha10 |
| US20120282177A1 (en) | 2009-11-02 | 2012-11-08 | Christian Rohlff | ROR1 as Therapeutic and Diagnostic Target |
| EP2496944A2 (en) | 2009-11-05 | 2012-09-12 | Novartis AG | Biomarkers predictive of progression of fibrosis |
| WO2011080050A2 (en) | 2009-12-11 | 2011-07-07 | Novartis Ag | Binding molecules |
| JP2013519869A (ja) | 2010-02-10 | 2013-05-30 | ノバルティス アーゲー | 筋肉成長のための方法および化合物 |
| KR20130066631A (ko) | 2010-05-06 | 2013-06-20 | 노파르티스 아게 | 치료적 저밀도 지단백질-관련 단백질 6 (lrp6) 다가 항체에 대한 조성물 및 사용 방법 |
| EP4234698A3 (en) | 2010-05-06 | 2023-11-08 | Novartis AG | Compositions and methods of use for therapeutic low density lipoprotein-related protein 6 (lrp6) antibodies |
| NZ607337A (en) | 2010-08-20 | 2015-06-26 | Novartis Ag | Antibodies for epidermal growth factor receptor 3 (her3) |
| EP2625203A1 (en) | 2010-10-05 | 2013-08-14 | Novartis AG | Anti-il12rbeta1 antibodies and their use in treating autoimmune and inflammatory disorders |
| WO2012172495A1 (en) | 2011-06-14 | 2012-12-20 | Novartis Ag | Compositions and methods for antibodies targeting tem8 |
| US20140348819A1 (en) | 2011-06-24 | 2014-11-27 | Dana-Farber Cancer Institute, Inc. | Methods of Treating Cancer |
| RS55716B1 (sr) | 2011-06-28 | 2017-07-31 | Oxford Biotherapeutics Ltd | Terapeutski i dijagnostički cilj |
| UA114478C2 (uk) | 2011-06-28 | 2017-06-26 | Берлін-Хемі Аг | Антитіло, яке специфічно зв'язується з bst1 |
| HUE040276T2 (hu) | 2011-07-01 | 2019-02-28 | Novartis Ag | Eljárás metabolikus rendellenességek kezelésére |
| US9238689B2 (en) | 2011-07-15 | 2016-01-19 | Morpho Sys AG | Antibodies that are cross-reactive for macrophage migration inhibitory factor (MIF) and D-dopachrome tautomerase (D-DT) |
| CN109111523B (zh) | 2011-10-14 | 2022-06-07 | 诺华股份有限公司 | 用于Wnt途径相关疾病的抗体和方法 |
| US20130156766A1 (en) | 2011-11-15 | 2013-06-20 | Allergan, Inc. | Treatment of dry age related macular degeneration |
| AU2012349735B2 (en) | 2011-12-05 | 2016-05-19 | Novartis Ag | Antibodies for epidermal growth factor receptor 3 (HER3) |
| KR20140103135A (ko) | 2011-12-05 | 2014-08-25 | 노파르티스 아게 | Her3의 도메인 ii에 대해 지시된 표피 성장 인자 수용체 3 (her3)에 대한 항체 |
| PE20150159A1 (es) | 2011-12-21 | 2015-02-08 | Novartis Ag | Composiciones y metodos para anticuerpos que actuan sobre el factor p |
| GB201213652D0 (en) | 2012-08-01 | 2012-09-12 | Oxford Biotherapeutics Ltd | Therapeutic and diagnostic target |
| US9376489B2 (en) | 2012-09-07 | 2016-06-28 | Novartis Ag | IL-18 binding molecules |
| WO2014084859A1 (en) | 2012-11-30 | 2014-06-05 | Novartis Ag | Molecules and methods for modulating tmem16a activities |
| HUE053669T2 (hu) | 2012-12-05 | 2021-07-28 | Novartis Ag | Készítmények és eljárások EPO-t célzó antitestekre |
| LT2953969T (lt) | 2013-02-08 | 2019-12-10 | Novartis Ag | Anti-il-17a antikūnai ir jų panaudojimas autoimuninių ir uždegiminių ligų gydymui |
| GB201302447D0 (en) | 2013-02-12 | 2013-03-27 | Oxford Biotherapeutics Ltd | Therapeutic and diagnostic target |
| CA2902068C (en) | 2013-02-28 | 2023-10-03 | Caprion Proteomics Inc. | Tuberculosis biomarkers and uses thereof |
| US9944700B2 (en) | 2013-03-13 | 2018-04-17 | Novartis Ag | Notch2 binding molecules for treating respiratory diseases |
| EP2970479B1 (en) | 2013-03-14 | 2019-04-24 | Novartis AG | Antibodies against notch 3 |
| EP2970426B1 (en) | 2013-03-15 | 2019-08-28 | Michael C. Milone | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
| AR096601A1 (es) | 2013-06-21 | 2016-01-20 | Novartis Ag | Anticuerpos del receptor 1 de ldl oxidado similar a lectina y métodos de uso |
| US9562101B2 (en) | 2013-06-21 | 2017-02-07 | Novartis Ag | Lectin-like oxidized LDL receptor 1 antibodies and methods of use |
| US10208125B2 (en) | 2013-07-15 | 2019-02-19 | University of Pittsburgh—of the Commonwealth System of Higher Education | Anti-mucin 1 binding agents and uses thereof |
| PE20160671A1 (es) | 2013-08-02 | 2016-07-09 | Pfizer | Anticuerpos anti-cxcr4 y conjugados de anticuerpo y farmaco |
| KR20160042987A (ko) | 2013-08-14 | 2016-04-20 | 노파르티스 아게 | 산발성 봉입체 근염을 치료하는 방법 |
| US10203327B2 (en) | 2013-11-05 | 2019-02-12 | Novartis Ag | Organic compounds |
| US10287354B2 (en) | 2013-12-20 | 2019-05-14 | Novartis Ag | Regulatable chimeric antigen receptor |
| KR102291465B1 (ko) * | 2014-01-24 | 2021-08-18 | 삼성전자주식회사 | c-Met 저해제의 효능 예측을 위한 바이오마커 TFF1 |
| US20170081411A1 (en) | 2014-03-15 | 2017-03-23 | Novartis Ag | Regulatable chimeric antigen receptor |
| TW201622746A (zh) | 2014-04-24 | 2016-07-01 | 諾華公司 | 改善或加速髖部骨折術後身體復原之方法 |
| US20170291939A1 (en) | 2014-06-25 | 2017-10-12 | Novartis Ag | Antibodies specific for il-17a fused to hyaluronan binding peptide tags |
| US11542488B2 (en) | 2014-07-21 | 2023-01-03 | Novartis Ag | Sortase synthesized chimeric antigen receptors |
| ES2781175T3 (es) | 2014-07-31 | 2020-08-31 | Novartis Ag | Subconjunto optimizado de células T que contienen un receptor de antígeno quimérico |
| WO2016020882A2 (en) | 2014-08-07 | 2016-02-11 | Novartis Ag | Angiopoetin-like 4 (angptl4) antibodies and methods of use |
| WO2016020880A2 (en) | 2014-08-07 | 2016-02-11 | Novartis Ag | Angiopoietin-like 4 antibodies and methods of use |
| KR20250067191A (ko) | 2014-09-17 | 2025-05-14 | 노파르티스 아게 | 입양 면역요법을 위한 키메라 수용체에 의한 세포독성 세포의 표적화 |
| MA41044A (fr) | 2014-10-08 | 2017-08-15 | Novartis Ag | Compositions et procédés d'utilisation pour une réponse immunitaire accrue et traitement contre le cancer |
| UY36449A (es) | 2014-12-19 | 2016-07-29 | Novartis Ag | Composiciones y métodos para anticuerpos dirigidos a bmp6 |
| SG11201705064XA (en) | 2014-12-24 | 2017-07-28 | Neximmune Inc | Nanoparticle compositions and methods for immunotherapy |
| MX2017012939A (es) | 2015-04-08 | 2018-05-22 | Novartis Ag | Terapias cd20, terapias cd22 y terapias de combinacion con una celula que expresa un receptor quimerico de antigeno (car) de cd19. |
| CA2982237A1 (en) | 2015-06-05 | 2016-12-08 | Novartis Ag | Antibodies targeting bone morphogenetic protein 9 (bmp9) and methods therefor |
| UY36751A (es) | 2015-06-26 | 2017-01-31 | Novartis Ag | Anticuerpos de factor xi y métodos de uso |
| CA3185706C (en) | 2015-08-03 | 2025-11-18 | Novartis Ag | METHOD FOR TREATMENT OF DISORDERS ASSOCIATED WITH FGF21 |
| JP6516925B2 (ja) | 2015-09-09 | 2019-05-22 | ノバルティス アーゲー | 胸腺間質性リンパ球新生因子(tslp)結合性抗体および抗体を使用する方法 |
| AU2016320748B2 (en) | 2015-09-09 | 2019-05-02 | Novartis Ag | Thymic stromal lymphopoietin (TSLP)-binding antibodies and methods of using the antibodies |
| US11702477B2 (en) | 2015-11-06 | 2023-07-18 | Orionis Biosciences BV | Bi-functional chimeric proteins and uses thereof |
| MX2018006194A (es) | 2015-11-19 | 2018-12-06 | Asclepix Therapeutics Llc | Peptidos con propiedades antiangiogenicas, antilinfangiogenicas y antiedemicas y formulaciones de nanoparticulas. |
| GB201521894D0 (en) | 2015-12-11 | 2016-01-27 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against various cancers |
| PE20230343A1 (es) | 2015-12-11 | 2023-03-01 | Immatics Biotechnologies Gmbh | Peptidos que estimulan respuestas inmunitarias antitumorales |
| EP3389711A1 (en) | 2015-12-18 | 2018-10-24 | Novartis AG | Antibodies targeting cd32b and methods of use thereof |
| US11001631B2 (en) | 2016-02-05 | 2021-05-11 | Orionis Biosciences BV | Clec9A binding agents |
| US11248057B2 (en) | 2016-03-07 | 2022-02-15 | Vib Vzw | CD20 binding single domain antibodies |
| WO2017189724A1 (en) | 2016-04-27 | 2017-11-02 | Novartis Ag | Antibodies against growth differentiation factor 15 and uses thereof |
| WO2017194783A1 (en) | 2016-05-13 | 2017-11-16 | Orionis Biosciences Nv | Targeted mutant interferon-beta and uses thereof |
| CN109563141A (zh) | 2016-05-13 | 2019-04-02 | 奥里尼斯生物科学公司 | 对非细胞结构的治疗性靶向 |
| TW201802121A (zh) | 2016-05-25 | 2018-01-16 | 諾華公司 | 抗因子XI/XIa抗體之逆轉結合劑及其用途 |
| EP3471759A1 (en) | 2016-06-15 | 2019-04-24 | Novartis AG | Methods for treating disease using inhibitors of bone morphogenetic protein 6 (bmp6) |
| US20190264197A1 (en) * | 2016-07-27 | 2019-08-29 | Protagonist Therapeutics, Inc. | Disulfide-rich peptide libraries and methods of use thereof |
| MX2019003895A (es) | 2016-10-04 | 2019-10-07 | Asclepix Therapeutics Inc | Compuestos y metodos para activar la señalizacion tie2. |
| CA3040802A1 (en) | 2016-10-24 | 2018-05-03 | Orionis Biosciences Nv | Targeted mutant interferon-gamma and uses thereof |
| IL267538B2 (en) | 2016-12-23 | 2024-05-01 | Novartis Ag | Antibodies against factor XI and methods for use in preventing, treating, managing or reducing the risk of thromboembolic disorder or stroke in a patient |
| EP3577133A1 (en) | 2017-02-06 | 2019-12-11 | Orionis Biosciences NV | Targeted chimeric proteins and uses thereof |
| CN110573172A (zh) | 2017-02-06 | 2019-12-13 | 奥里尼斯生物科学有限公司 | 靶向的工程化干扰素及其用途 |
| EP3580230B1 (en) | 2017-02-07 | 2026-04-22 | Vib Vzw | Immune-cell targeted bispecific chimeric proteins and uses thereof |
| US10899844B2 (en) | 2017-02-08 | 2021-01-26 | Novartis Ag | FGF21 mimetic antibodies and uses thereof |
| US11274160B2 (en) | 2017-03-02 | 2022-03-15 | INSERM (Institut National de la Santé et de la Recherche Médicale | Antibodies having specificity to Nectin-4 and uses thereof |
| FI3600415T3 (fi) | 2017-03-24 | 2025-12-05 | Novartis Ag | Aktiviinireseptorin tyypin ii reseptorin vastainen vasta-aine käytettäväksi sydämen vajaatoiminnan hoidossa |
| WO2018229715A1 (en) | 2017-06-16 | 2018-12-20 | Novartis Ag | Compositions comprising anti-cd32b antibodies and methods of use thereof |
| EP3645564A1 (en) | 2017-06-28 | 2020-05-06 | Novartis AG | Methods for preventing and treating urinary incontinence |
| US11674959B2 (en) | 2017-08-03 | 2023-06-13 | The Johns Hopkins University | Methods for identifying and preparing pharmaceutical agents for activating Tie1 and/or Tie2 receptors |
| US12059476B2 (en) | 2017-10-10 | 2024-08-13 | The Johns Hopkins University | Biodegradable biomimetic particles |
| EP3700933A1 (en) | 2017-10-25 | 2020-09-02 | Novartis AG | Antibodies targeting cd32b and methods of use thereof |
| US20190231690A1 (en) | 2017-11-08 | 2019-08-01 | L.E.A.F. Holdings Group Llc | Platinum complexes and uses thereof |
| IL274677B2 (en) | 2017-11-14 | 2025-01-01 | Arcellx Inc | Therapies with multifunctional immune system cells |
| KR20200087236A (ko) | 2017-11-22 | 2020-07-20 | 노파르티스 아게 | 항-인자 XI/XIa 항체에 대한 반전 결합제 및 이의 용도 |
| EP3737692A4 (en) | 2018-01-09 | 2021-09-29 | Elstar Therapeutics, Inc. | CALRETICULIN AND MODIFIED T-LYMPHOCYTES BINDING CONSTRUCTIONS FOR THE TREATMENT OF DISEASES |
| US20200354424A1 (en) | 2018-01-26 | 2020-11-12 | Orionis Biosciences, Inc. | Xcr1 binding agents and uses thereof |
| JP2021513361A (ja) | 2018-02-05 | 2021-05-27 | オリオニス バイオサイエンシーズ,インコーポレイテッド | 線維芽細胞結合物質およびその使用 |
| WO2019157123A1 (en) | 2018-02-07 | 2019-08-15 | L.E.A.F. Holdings Group Llc | Alpha polyglutamated aminopterin and uses thereof |
| JP7491573B2 (ja) | 2018-02-07 | 2024-05-28 | エル.イー.エー.エフ. ホールディングス グループ エルエルシー | アルファポリグルタミン酸化メトトレキセートおよびその使用 |
| US12239734B2 (en) | 2018-02-07 | 2025-03-04 | L.E.A.F. Holdings Group Llc | Gamma polyglutamated raltitrexed and uses thereof |
| US12246015B2 (en) | 2018-02-07 | 2025-03-11 | L.E.A.F. Holdings Group Llc | Alpha polyglutamated raltitrexed and uses thereof |
| WO2019157129A1 (en) | 2018-02-07 | 2019-08-15 | L.E.A.F. Holdings Group Llc | Alpha polyglutamated pralatrexate and uses thereof |
| EP3752156A4 (en) | 2018-02-14 | 2021-10-27 | L.E.A.F Holdings Group LLC | GAMMA-POLYGLUTAMIZED PRALATREXATE AND USES THEREOF |
| WO2019160732A1 (en) | 2018-02-14 | 2019-08-22 | L.E.A.F. Holdings Group Llc | Gamma polyglutamated aminopterin and uses thereof |
| EP3752157A4 (en) | 2018-02-14 | 2022-07-06 | L.E.A.F Holdings Group LLC | GAMMA-POLYGLUTAMATED LOMETREXOLE AND USES THEREOF |
| CN111936145A (zh) | 2018-02-14 | 2020-11-13 | L.E.A.F.控股集团公司 | γ聚谷氨酸化氨甲蝶呤及其用途 |
| US12152073B2 (en) | 2018-03-14 | 2024-11-26 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
| AR126019A1 (es) | 2018-05-30 | 2023-09-06 | Novartis Ag | Anticuerpos frente a entpd2, terapias de combinación y métodos de uso de los anticuerpos y las terapias de combinación |
| EP3818083A2 (en) | 2018-07-03 | 2021-05-12 | Elstar Therapeutics, Inc. | Anti-tcr antibody molecules and uses thereof |
| WO2020069409A1 (en) | 2018-09-28 | 2020-04-02 | Novartis Ag | Cd19 chimeric antigen receptor (car) and cd22 car combination therapies |
| EP3856779A1 (en) | 2018-09-28 | 2021-08-04 | Novartis AG | Cd22 chimeric antigen receptor (car) therapies |
| US12410225B2 (en) | 2018-11-08 | 2025-09-09 | Orionis Biosciences, Inc | Modulation of dendritic cell lineages |
| JP2020080784A (ja) * | 2018-11-29 | 2020-06-04 | シスメックス株式会社 | 融合ポリペプチド、融合ポリペプチドの製造方法、及び融合ポリペプチドをコードするdna |
| EP3898700A1 (en) | 2018-12-18 | 2021-10-27 | Novartis AG | Reversal binding agents for anti-factor xi/xia antibodies and uses thereof |
| EP3924389A4 (en) | 2019-02-15 | 2023-06-14 | Integral Molecular, Inc. | CLAUDIN-6 ANTIBODIES AND THEIR USES |
| CN113661175A (zh) | 2019-02-15 | 2021-11-16 | 整体分子公司 | 包含共同轻链的抗体及其用途 |
| AU2020224681A1 (en) | 2019-02-21 | 2021-09-16 | Marengo Therapeutics, Inc. | Antibody molecules that bind to NKp30 and uses thereof |
| JP7710373B2 (ja) | 2019-02-21 | 2025-07-18 | マレンゴ・セラピューティクス,インコーポレーテッド | T細胞関連のがん細胞に結合する多機能性分子およびその使用 |
| GB201903233D0 (en) | 2019-03-08 | 2019-04-24 | Oxford Genetics Ltd | Method of selecting for antibodies |
| CN113544509A (zh) | 2019-03-08 | 2021-10-22 | 牛津遗传学有限公司 | 选择抗体的方法 |
| CA3133648A1 (en) | 2019-03-28 | 2020-10-01 | Orionis Biosciences, Inc. | Fibroblast activation protein binding agents and use thereof |
| US20230174627A1 (en) * | 2019-05-14 | 2023-06-08 | Jeffrey W. FROUDE | Antibodies to sudan and ebola virus |
| CA3149914A1 (en) | 2019-08-06 | 2021-02-11 | L.E.A.F. Holdings Group Llc | Processes of preparing polyglutamated antifolates and uses of their compositions |
| US20220348651A1 (en) | 2019-09-18 | 2022-11-03 | Novartis Ag | Entpd2 antibodies, combination therapies, and methods of using the antibodies and combination therapies |
| TW202124446A (zh) | 2019-09-18 | 2021-07-01 | 瑞士商諾華公司 | 與entpd2抗體之組合療法 |
| US12577324B2 (en) | 2019-12-09 | 2026-03-17 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Antibodies having specificity to HER4 and uses thereof |
| CN116234829A (zh) | 2020-01-03 | 2023-06-06 | 马伦戈治疗公司 | 抗tcr抗体分子及其用途 |
| GB202004514D0 (en) | 2020-03-27 | 2020-05-13 | Inst De Medicina Molecular Joaeo Lobo Antunes | Treatment of Immunosuppressive Cancer |
| JP2023525053A (ja) | 2020-05-12 | 2023-06-14 | インサーム(インスティテュ ナシオナル ドゥ ラ サンテ エ ドゥ ラ ルシェルシェ メディカル) | 皮膚t細胞リンパ腫及びtfh由来リンパ腫を処置する新しい方法 |
| CN119792512A (zh) | 2020-10-14 | 2025-04-11 | 维里迪安治疗公司 | 用于治疗甲状腺眼病的组合物和方法 |
| WO2022190010A1 (en) | 2021-03-09 | 2022-09-15 | Molecular Partners Ag | Novel darpin based cd33 engagers |
| AU2022233791A1 (en) | 2021-03-09 | 2023-09-28 | Molecular Partners Ag | Novel darpin based cd123 engagers |
| CA3212948A1 (en) | 2021-03-26 | 2022-09-29 | David M. Hilbert | Multifunctional immune cell therapies |
| CA3214757A1 (en) | 2021-04-08 | 2022-10-13 | Andreas Loew | Multifuntional molecules binding to tcr and uses thereof |
| TW202320850A (zh) | 2021-08-10 | 2023-06-01 | 美商維里迪恩醫療股份有限公司 | 用於治療甲狀腺眼病之組合物、劑量及方法 |
| KR20240155353A (ko) | 2022-03-11 | 2024-10-28 | 인스티튜트 내셔널 드 라 싼테 에 드 라 리셰르셰 메디칼르 (인쎄름) | B 및 t 세포의 특이적 재프로그래밍을 위한 핵산 시스템 및 이의 용도 |
| WO2023217904A1 (en) | 2022-05-10 | 2023-11-16 | Institut National de la Santé et de la Recherche Médicale | Syncitin-1 fusion proteins and uses thereof for cargo delivery into target cells |
| JP2025523630A (ja) | 2022-07-04 | 2025-07-23 | ブイアイビー ブイゼットダブリュ | 血液-脳脊髄液関門通過抗体 |
| EP4584291A1 (en) | 2022-09-08 | 2025-07-16 | Institut National de la Santé et de la Recherche Médicale | Antibodies having specificity to ltbp2 and uses thereof |
| CA3267921A1 (en) | 2022-10-06 | 2024-04-11 | Bicara Therapeutics Inc. | MULTISPECIFIC PROTEINS AND ASSOCIATED PROCESSES |
| EP4626933A1 (en) | 2022-11-30 | 2025-10-08 | Integral Molecular, Inc. | Antibodies directed to claudin 6, including bispecific formats thereof |
| EP4673159A1 (en) | 2023-02-27 | 2026-01-07 | Molecular Partners AG | Darpins for use in reducing renal accumulation of drugs |
| WO2024208816A1 (en) | 2023-04-03 | 2024-10-10 | Vib Vzw | Blood-brain barrier crossing antibodies |
| WO2025014774A1 (en) | 2023-07-07 | 2025-01-16 | Viridian Therapeutics, Inc. | Methods of treating active and chronic thyroid eye disease |
| AU2024299328A1 (en) | 2023-07-21 | 2026-01-22 | Marrow Therapeutics, Inc. | Hematopoietic cell targeting conjugates and related methods |
| WO2025093683A1 (en) | 2023-11-03 | 2025-05-08 | Neuvasq Biotechnologies Sa | Wnt7 signaling agonists |
| WO2025136985A1 (en) | 2023-12-17 | 2025-06-26 | Viridian Therapeutics, Inc. | Compositions, doses, and methods for treatment of thyroid eye disease |
| WO2025151496A1 (en) | 2024-01-09 | 2025-07-17 | Viridian Therapeutics, Inc. | Compositions and methods for treatment of thyroid eye disease |
| WO2025151502A1 (en) | 2024-01-09 | 2025-07-17 | Viridian Therapeutics, Inc. | Modified antibodies |
| WO2025151492A1 (en) | 2024-01-09 | 2025-07-17 | Viridian Therapeutics, Inc. | Compositions and methods for treatment of thyroid eye disease |
| TW202545974A (zh) | 2024-01-26 | 2025-12-01 | 美商旗艦先鋒創新有限責任(Vii)公司 | 免疫受體抑制蛋白及相關方法 |
| WO2025224297A1 (en) | 2024-04-26 | 2025-10-30 | Institut National de la Santé et de la Recherche Médicale | Antibodies having specificity to tgfbi and uses thereof |
| WO2025240680A1 (en) | 2024-05-16 | 2025-11-20 | Flagship Pioneering Innovations Vii, Llc | Immunoreceptor inhibitory proteins and related methods |
| WO2025242732A1 (en) | 2024-05-21 | 2025-11-27 | Institut National de la Santé et de la Recherche Médicale | Pan antibodies against sars-cov-2 spike protein and uses thereof for therapeutical purposes |
| WO2025245111A1 (en) | 2024-05-22 | 2025-11-27 | Flagship Pioneering Innovations Vii, Llc | Immunoreceptor targeting proteins and related methods |
| WO2025257181A1 (en) | 2024-06-11 | 2025-12-18 | Institut National de la Santé et de la Recherche Médicale | Antibodies targeting trans-active response dna-binding protein-43 (tdp-43) |
| WO2026011013A1 (en) | 2024-07-02 | 2026-01-08 | Epibiologics, Inc. | Binding agents and uses thereof |
| WO2026019692A2 (en) | 2024-07-15 | 2026-01-22 | Flagship Pioneering Innovations Vii, Llc | Immunomodulatory fusion proteins and related methods |
| WO2026050572A2 (en) | 2024-08-29 | 2026-03-05 | Marengo Therapeutics, Inc. | Multifunctional molecules binding to tcr and uses thereof |
| WO2026052839A1 (en) | 2024-09-06 | 2026-03-12 | Hone Bio Limited | Targeting fusion proteins |
| WO2026068504A2 (en) | 2024-09-24 | 2026-04-02 | The University Of Bristol | Novel protein conjugates |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
Family Cites Families (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US6673559B1 (en) | 1989-12-27 | 2004-01-06 | The Government Of The United States Of America As Represented By The Department Of Health And Human Services | Met proto-oncogene and a method for predicting breast cancer progression |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| AU8081491A (en) | 1990-06-01 | 1991-12-31 | Cetus Corporation | Compositions and methods for identifying biologically active molecules |
| US5723286A (en) | 1990-06-20 | 1998-03-03 | Affymax Technologies N.V. | Peptide library and screening systems |
| US5843701A (en) | 1990-08-02 | 1998-12-01 | Nexstar Pharmaceticals, Inc. | Systematic polypeptide evolution by reverse translation |
| US5270170A (en) | 1991-10-16 | 1993-12-14 | Affymax Technologies N.V. | Peptide library and screening method |
| US5426039A (en) | 1993-09-08 | 1995-06-20 | Bio-Rad Laboratories, Inc. | Direct molecular cloning of primer extended DNA containing an alkane diol |
| US5605793A (en) | 1994-02-17 | 1997-02-25 | Affymax Technologies N.V. | Methods for in vitro recombination |
| DK1712623T3 (da) | 1997-01-21 | 2012-02-06 | Gen Hospital Corp | Udvælgelse af proteiner ved anvendelse af RNA-proteinfusioner |
| DE19742706B4 (de) | 1997-09-26 | 2013-07-25 | Pieris Proteolab Ag | Lipocalinmuteine |
| US6818418B1 (en) | 1998-12-10 | 2004-11-16 | Compound Therapeutics, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| US6436675B1 (en) | 1999-09-28 | 2002-08-20 | Maxygen, Inc. | Use of codon-varied oligonucleotide synthesis for synthetic shuffling |
| US6703491B1 (en) * | 1999-03-17 | 2004-03-09 | Exelixis, Inc. | Drosophila sequences |
| WO2000060070A1 (en) | 1999-04-01 | 2000-10-12 | Innogenetics N.V. | A polypeptide structure for use as a scaffold |
| EP1355921A2 (en) * | 2000-06-29 | 2003-10-29 | North Shore-Long Island Jewish Health System | Modulators of cellular proliferation and angiogenesis, methods for use and identification thereof |
| EP1332212A2 (en) * | 2000-08-25 | 2003-08-06 | Curagen Corporation | Proteins and nucleic acids encoding same |
| WO2002068649A2 (en) | 2001-01-31 | 2002-09-06 | Curagen Corporation | Proteins and nucleic acids encoding same |
| US7083970B2 (en) * | 2001-04-19 | 2006-08-01 | The Scripps Research Institute | Methods and compositions for the production of orthogonal tRNA-aminoacyl tRNA synthetase pairs |
| DK1390535T3 (da) * | 2001-04-26 | 2010-12-06 | Amgen Mountain View Inc | Kombinatoriske biblioteker af monomer-domæner |
| US20050053973A1 (en) * | 2001-04-26 | 2005-03-10 | Avidia Research Institute | Novel proteins with targeted binding |
| US20030157561A1 (en) * | 2001-11-19 | 2003-08-21 | Kolkman Joost A. | Combinatorial libraries of monomer domains |
| US20040175756A1 (en) * | 2001-04-26 | 2004-09-09 | Avidia Research Institute | Methods for using combinatorial libraries of monomer domains |
| US20050089932A1 (en) * | 2001-04-26 | 2005-04-28 | Avidia Research Institute | Novel proteins with targeted binding |
| US6867005B2 (en) * | 2001-10-24 | 2005-03-15 | Beckman Coulter, Inc. | Method and apparatus for increasing the dynamic range and accuracy of binding assays |
| PT2949658T (pt) * | 2003-03-03 | 2018-10-18 | Bracco Suisse Sa | Péptidos que ligam especificamente o recetor de hgf (cmet) e utilizações dos mesmos |
| WO2005040229A2 (en) * | 2003-10-24 | 2005-05-06 | Avidia, Inc. | Ldl receptor class a and egf domain monomers and multimers |
| US20060008844A1 (en) * | 2004-06-17 | 2006-01-12 | Avidia Research Institute | c-Met kinase binding proteins |
| US11624505B2 (en) | 2020-03-17 | 2023-04-11 | Weber-Stephen Products Llc | Ignition-based protocols for pellet grills |
-
2004
- 2004-09-30 US US10/957,351 patent/US20060008844A1/en not_active Abandoned
-
2005
- 2005-06-17 AU AU2005265150A patent/AU2005265150B2/en not_active Ceased
- 2005-06-17 CA CA2569191A patent/CA2569191C/en not_active Expired - Fee Related
- 2005-06-17 JP JP2007516800A patent/JP2008503216A/ja active Pending
- 2005-06-17 US US11/155,989 patent/US7803907B2/en not_active Expired - Fee Related
- 2005-06-17 EP EP09176476A patent/EP2151453A1/en not_active Withdrawn
- 2005-06-17 WO PCT/US2005/021558 patent/WO2006009888A2/en not_active Ceased
- 2005-06-17 MX MXPA06014796A patent/MXPA06014796A/es active IP Right Grant
- 2005-06-17 EP EP05787547A patent/EP1776134A4/en not_active Withdrawn
- 2005-06-17 KR KR1020077001057A patent/KR101238074B1/ko not_active Expired - Fee Related
-
2010
- 2010-04-15 US US12/761,346 patent/US7968681B2/en not_active Expired - Fee Related
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050048512A1 (en) | 2001-04-26 | 2005-03-03 | Avidia Research Institute | Combinatorial libraries of monomer domains |
Non-Patent Citations (27)
| Title |
|---|
| BIRCHMEIER ET AL., MOL. CELL BIOL., vol. 4, 2003, pages 915 - 925 |
| BORK, FEBS LETT, vol. 327, 1993, pages 125 - 30 |
| CARR ET AL., PNAS USA, vol. 91, 1994, pages 2206 - 2210 |
| CHONG; SPEICHER, DW, vol. 276, 2001, pages 5804 - 5813 |
| CLONTECH CATALOG, 2000, pages 110 - 111 |
| DEA, PNAS USA, vol. 91, 1994, pages 1084 - 1088 |
| FRISHMAN, D.; ARGOS, P.: "Knowledge-based secondary structure assignment", PROTEINS, vol. 23, no. 4, 1995, pages 566 - 79 |
| GOLDSTEIN; BROWN: "The Cholesterol Quartet", SCIENCE, vol. 292, 2001, pages 1310 - 1312 |
| GUNCAR ET AL., EMBO J, vol. 18, 1999, pages 793 - 803 |
| HERZ, SUPRA, 2001 |
| HIGGINS ET AL., IMMUNOL., vol. 155, 1995, pages 5777 - 85 |
| HOFFMAN ET AL., TRENDS BIOCHEM SCI, vol. 18, 1993, pages 239 - 243 |
| HOWELL; HERTZ: "The LDL receptor gene family: signaling functions during development", CURRENT OPINION IN NEUROBIOLOGY, vol. 11, 2001, pages 74 - 81 |
| JONES, D.T.: "Protein secondary structure prediction based on position-specific scoring matrices", J. MOL. BIOL., vol. 292, 1999, pages 195 - 202 |
| KARLIN; ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787 |
| KRIEGER: "The "best" of cholesterols, the "worst" of cholesterols: A tale of two receptors", PNAS, vol. 95, 1998, pages 4077 - 4080 |
| LEUNG-HAGESTEIJN ET AL., CELL, vol. 71, 1992, pages 289 - 99 |
| MCGUFFIN, L.J.; BRYSON, K.; JONES, D.T., THE PSIPRED PROTEIN, 2000 |
| MOESTRUP; VERROUST: "Megalin-and Cubilin-Mediated Endocytosis of Protein-Bound Vitamins, Lipids, and Hormones in Polarized Epithelia", ANN. REV. NUTR., vol. 21, 2001, pages 407 - 28 |
| MOLINA ET AL., EUR. J BIOCHEM., vol. 240, 1996, pages 125 - 133 |
| PARK ET AL., PROC. NATL. ACAD. SCI. USA, vol. 84, no. 18, 1987, pages 6379 |
| ROSZMUSZ ET AL., BBRC, vol. 296, 2002, pages 156 |
| SANDS; PODOLSKY, ANNU. REV. PHYSIOL., vol. 58, 1996, pages 253 - 273 |
| SCHULTZ-CHERRY ET AL., J BIOL. CHEM., vol. 270, 1995, pages 7304 - 7310 |
| SCHULTZ-CHERRY ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 26783 - 8 |
| See also references of EP1776134A4 |
| STEMMER ET AL., GENE, vol. 164, 1995, pages 49 - 53 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7435562B2 (en) | 2000-07-21 | 2008-10-14 | Modular Genetics, Inc. | Modular vector systems |
| US7485423B2 (en) | 2004-11-11 | 2009-02-03 | Modular Genetics, Inc. | Ladder assembly and system for generating diversity |
| EP2016093A1 (en) * | 2006-05-05 | 2009-01-21 | Universiteit Maastricht / Carim | Peptides for use in diagnosing the presence of ruptured atherosclerotic lesions in an individual |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2008503216A (ja) | 2008-02-07 |
| CA2569191A1 (en) | 2006-01-26 |
| US7968681B2 (en) | 2011-06-28 |
| KR101238074B1 (ko) | 2013-07-15 |
| KR20070041721A (ko) | 2007-04-19 |
| EP1776134A2 (en) | 2007-04-25 |
| WO2006009888A3 (en) | 2006-07-06 |
| US20060177831A1 (en) | 2006-08-10 |
| EP2151453A1 (en) | 2010-02-10 |
| CA2569191C (en) | 2013-11-19 |
| EP1776134A4 (en) | 2009-08-26 |
| US20060008844A1 (en) | 2006-01-12 |
| US7803907B2 (en) | 2010-09-28 |
| AU2005265150B2 (en) | 2012-04-12 |
| MXPA06014796A (es) | 2007-04-23 |
| AU2005265150A1 (en) | 2006-01-26 |
| US20100292167A1 (en) | 2010-11-18 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA2569191C (en) | C-met kinase binding proteins | |
| JP2008503216A5 (https=) | ||
| US20050053973A1 (en) | Novel proteins with targeted binding | |
| US20050164301A1 (en) | LDL receptor class A and EGF domain monomers and multimers | |
| US20100204052A1 (en) | Protein scaffolds and uses thereof | |
| US20050089932A1 (en) | Novel proteins with targeted binding | |
| EP2198890A1 (en) | Combinatorial libraries of monomer domains | |
| US20060234299A1 (en) | Protein scaffolds and uses thereof | |
| US20050048512A1 (en) | Combinatorial libraries of monomer domains | |
| US20040175756A1 (en) | Methods for using combinatorial libraries of monomer domains | |
| US7820790B2 (en) | IL-6 binding proteins | |
| US7786262B2 (en) | IL-6 binding proteins | |
| CA2587463A1 (en) | Protein scaffolds and uses therof | |
| HK1140213A (en) | C-met kinase binding proteins | |
| CN101018559A (zh) | c-MET激酶结合蛋白 | |
| HK1144912B (en) | Combinatorial libraries of monomer domains |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KM KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NG NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SM SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): BW GH GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2569191 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2006/014796 Country of ref document: MX Ref document number: 2007516800 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2005265150 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2005787547 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020077001057 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 214/KOLNP/2007 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2005265150 Country of ref document: AU Date of ref document: 20050617 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005265150 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 200580028093.8 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 2005787547 Country of ref document: EP |