WO2002088170A2 - Cripto blocking antibodies and uses thereof - Google Patents

Cripto blocking antibodies and uses thereof Download PDF

Info

Publication number
WO2002088170A2
WO2002088170A2 PCT/US2002/011950 US0211950W WO02088170A2 WO 2002088170 A2 WO2002088170 A2 WO 2002088170A2 US 0211950 W US0211950 W US 0211950W WO 02088170 A2 WO02088170 A2 WO 02088170A2
Authority
WO
WIPO (PCT)
Prior art keywords
cripto
antibody
antibodies
tumor
epitope
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2002/011950
Other languages
English (en)
French (fr)
Other versions
WO2002088170A3 (en
Inventor
Michele Sanicola-Nadel
Kevin Williams
Susan Schiffer
Paul Rayhorn
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biogen Inc
Original Assignee
Biogen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=27501437&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2002088170(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to DE60230868T priority Critical patent/DE60230868D1/de
Priority to DK02731384T priority patent/DK1390389T3/da
Priority to KR1020037014078A priority patent/KR100592357B1/ko
Priority to EA200301158A priority patent/EA007469B1/ru
Priority to EP02731384A priority patent/EP1390389B1/en
Priority to CA2443840A priority patent/CA2443840C/en
Priority to HK04101788.0A priority patent/HK1058935B/en
Application filed by Biogen Inc filed Critical Biogen Inc
Priority to SK1443-2003A priority patent/SK14432003A3/sk
Priority to BRPI0209254-9A priority patent/BR0209254A/pt
Priority to SI200230804T priority patent/SI1390389T1/sl
Priority to YU84903A priority patent/RS51635B/sr
Priority to JP2002585468A priority patent/JP4307845B2/ja
Priority to MXPA03009797A priority patent/MXPA03009797A/es
Priority to IL15857302A priority patent/IL158573A0/xx
Priority to HU0501113A priority patent/HUP0501113A3/hu
Priority to EEP200300528A priority patent/EE200300528A/xx
Priority to HK05105887.0A priority patent/HK1072381B/en
Priority to EP02807155A priority patent/EP1494693B1/en
Priority to JP2003580477A priority patent/JP2005520566A/ja
Priority to AU2002334799A priority patent/AU2002334799B2/en
Priority to DE60238559T priority patent/DE60238559D1/de
Priority to PCT/US2002/031462 priority patent/WO2003083041A2/en
Priority to PT02807155T priority patent/PT1494693E/pt
Priority to DK02807155.3T priority patent/DK1494693T3/da
Priority to CA2480119A priority patent/CA2480119C/en
Priority to AT02807155T priority patent/ATE490981T1/de
Publication of WO2002088170A2 publication Critical patent/WO2002088170A2/en
Priority to US10/693,538 priority patent/US7531174B2/en
Priority to IS6999A priority patent/IS2662B/is
Anticipated expiration legal-status Critical
Priority to NO20034805A priority patent/NO20034805L/no
Priority to BG108363A priority patent/BG108363A/bg
Publication of WO2002088170A3 publication Critical patent/WO2002088170A3/en
Priority to US10/945,853 priority patent/US7582299B2/en
Priority to US11/799,361 priority patent/US7674462B2/en
Priority to US12/317,476 priority patent/US8003763B2/en
Priority to US12/353,913 priority patent/US20090285818A1/en
Priority to JP2009020949A priority patent/JP2009161539A/ja
Priority to US12/415,659 priority patent/US7888052B2/en
Priority to US13/213,499 priority patent/US8673303B2/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • Cripto is a cell surface protein of 188 amino acid residues serendipitously isolated in a cDNA screen of a human embryonic carcinoma library (Ciccodicola et al., 1989, EMBO J., vol. 8, no. 7, pp. 1987-1991).
  • the Cripto protein has at least two notable domains: a cysteine-rich domain, and a domain first characterized as similar to the domain found in the epidermal growth factor (EGF) family.
  • EGF epidermal growth factor
  • the Cripto signaling pathway has remained elusive despite continued investigation, with the literature supporting activation of several different pathways, including a MAP kinase pathway (DeSantis et al., 1997, Cell Growth Differ., 8:1257- 1266; Kannan et al., 1997, J. Biol. Chem., 272:3330-3335), the TGF- ⁇ pathway (Gritsman et al., 1999, Development, 127:921-932; Schier et al., 2000, Nature, 403:385-389), possible interactions with the Wnt pathway (Salomon et al., Endocr Relat Cancer. 2000 Dec;7(4): 199-226; and cross talk with the EGF pathway (Bianco et al., 1999, J. Biol. Chem., 274:8624-8629).
  • Cripto protein overexpression is associated with many tumor types (including but not limited to breast, testicular, colon, lung, ovary, bladder, uterine, cervical, pancreatic, and stomach), as demonstrated by immunostaining of human tissue with rabbit polyclonal antibodies raised against small cripto peptides. Panico et al ., 1996, Int. J. Cancer, 65: 51-56; Byrne et al., 1998, J Pathology, 185:108-111; De Angelis et al., 1999, Int J Oncology, 14:437-440. The art is therefore in need of means of controlling, restricting, and or preventing such overexpression, modulating Cripto signaling, and modulating the consequences of Cripto expression (i.e., promotion and/or maintenance of cell transformation).
  • the antibody of the present invention specifically binds to an epitope in the ligand/receptor binding domain of Cripto.
  • Cripto can be selected from CR-1 (SEQ ID NO:l) or CR-3 (SEQ ID NO:2).
  • antibodies that specifically binds to the epitope in the ligand/receptor binding domain include for example A6C12.11, A6F8.6 (ATCC ACCESSION NO. PTA-3318), A8G3.5 (ATCC ACCESSION NO. PTA-3317), A19A10.30, A8H3.1 (ATCC ACCESSION NO. PTA-3315), A27F6.1 (ATCC ACCESSION NO.
  • the epitope to which the antibodies of the present invention bind is in an EGF-like domain.
  • Antibodies that specifically bind to the epitope in the EGF-like domain include but are not limited to A40G12.8 (ATCC ACCESSION NO. PTA-3316), A8H3.1 (ATCC ACCESSION NO. PTA-3315), A27F6.1 (ATCC ACCESSION NO. PTA-3310), B6G7.10 (ATCC ACCESSION NO. PTA-3313), A17G12.1 (ATCC ACCESSION NO. PTA-3314) and A18B3.11 (ATCC ACCESSION NO. PTA-3312).
  • the epitope to which the antibodies of the present invention bind is in a cys-rich domain.
  • Antibodies that specifically bind to the epitope in the cys-rich domain include but are not limited to A19A10.30, A8G3.5 (ATCC ACCESSION NO. PTA-3317), A6F8.6 (ATCC ACCESSION NO. PTA-3318) and A6C12.11.
  • the epitope to which the antibodies of the present invention bind is in the domain spanning amino acid residues 46-62 of Cripto.
  • Antibodies that specifically bind to the epitope in the domain spanning amino acid residues 46-62 of Cripto include but are not limited to A10B2.18 (ATCC ACCESSION NO. PTA-3311), B3F6.17 (ATCC ACCESSION NO. PTA-3319) and A17A2.16.
  • the present inventions also comtemplate antibodies which binds specifically to
  • Antibodies that bind specifically to Cripto and are capable of modulating Cripto signaling include but are not limited to, A40G12.8 (ATCC ACCESSION NO. PTA-3316), A8H3.1 (ATCC ACCESSION NO. PTA-3315), A27F6.1 (ATCC ACCESSION NO. PTA-3310), and A6C12.11.
  • the antibodies of the present invention which binds specifically to Cripto and are capable of modulating Cripto signaling bind to an epitope in an EGF-like domain or a cys-rich domain of Cripto.
  • the present inventions also comtemplate antibodies which binds specifically to Cripto and blocks the interaction between Cripto and ALK4.
  • Antibodies that bind specifically to Cripto and are capable of blocking the interaction between Cripto and AL 4 include but are not limited to, A8G3.5 (ATCC ACCESSION NO. PTA-3317), A6F8.6 (ATCC ACCESSION NO. PTA-3318) and A6C12.11.
  • the antibodies of the present invention which binds specifically to Cripto and are capable of blocking the interaction between Cripto and ALK4 bind to an epitope in an EGF-like domain or a cys-rich domain of Cripto.
  • the present invention comtemplates antibodies which bind specifically to Cripto and are capable of modulating tumor growth.
  • Antibodies that specifically bind to Cripto and are capable of modulating tumor growth include but are not limited to, A27F6.1 (ATCC ACCESSION NO. PTA-3310), B6G7.10 (ATCC ACCESSION NO. PTA-3313) and A8G3.5 (ATCC ACCESSION NO. PTA-3317).
  • the antibodies of the present invention which bind specifically to Cripto and are capable of modulating tumor growth bind to an epitope in an EGF-like domain or a cys-rich domain of Cripto.
  • the antibodies of the present invention which bind specifically to Cripto, which are capable of modulating Cripto signaling, and which are capable of modulating tumor growth bind to an epitope in an EGF-like domain or a cys-rich domain of Cripto.
  • the present invention comtemplates antibodies which bind specifically to Cripto, which are capable of blocking the interaction between Cripto and ALK4, and which are capable of modulating tumor growth.
  • Antibodies that specifically bind to Cripto, which are capable of blocking the interaction between Cripto and AL 4, and which are capable of modulating tumor growth include but are not limited to A8G3.5 (ATCC ACCESSION NO. PTA-3317).
  • the antibodies of the present invention include but are not limited to monoclonal, polyclonal, humanized, chimeric and human antibodies.
  • the present invention also provides for a composition for administration to a subject having a tumor that expresses Cripto comprising at least one of the antibodies described above.
  • the subject is human.
  • the composition may include a pharmaceutically acceptable excipient.
  • the antibodies described above can be conjugated to a chemotherapeutic agent or be provided in combination with a nonconjugated chemotherapeutic.
  • Contemplated in another aspect of the invention are methods of modulating growth of tumor cells in vitro in a sample comprising the step of adding to the sample the compositions described above.
  • the methods of the present invention are particularly useful in modulating growth of tumor cells and/or treating a subject (i.e. a human) having a tumor where the tumor cell is selected from breast, testicular, colon, lung, ovary, bladder, uterine, cervical, pancreatic, and stomach tumor cells.
  • the present invention contemplates methods of determining whether a tissue expresses Cripto, comprising the step of analyzing tissue from the subject in an immunoassay using any of the antibodies described above. Also contemplated are methods of determining whether a cell line overexpresses Cripto, comprising the step of analyzing the cell line in an immunoassay using any of the antibodies described above.
  • antibodies that specifically bind to Cripto include, for example, antibodies that specifically bind to an epitope in the ligand/receptor binding domain of either a native Cripto protein or a denatured form of Cripto; antibodies that bind an EGF-like domain, a cys-rich domain, or a peptide (e.g., from about 3 to about 20 amino acids) from the region comprising amino acid residues 46 to 150; antibodies that bind Cripto and modulate Cripto signalling; antibodies that bind Cripto and modulate tumor cell growth; and antibodies that bind to Cripto, modulate Cripto signaling, and modulate tumor cell growth. These antibodies are selected using conventional in vitro assays for selecting antibodies which bind the ligand/receptor binding domain, modulate Cripto signaling, or modulate tumor cell growth.
  • chimeric antibodies may be constructed, in which the antigen binding domain from an animal antibody is linked to a human constant domain (an antibody derived initially from a nonhuman mammal in which recombinant DNA technology has been used to replace all or part of the hinge and constant regions of the heavy chain and/or the constant region of the light chain, with corresponding regions from a human immunoglobulin light chain or heavy chain) (see, e.g., Cabilly et al., United States patent 4,816,567; Morrison et al., Proc. Natl. Acad. Sci. 81: 6851-55, 1984). Chimeric antibodies reduce the immunogenic responses elicited by animal antibodies when used in human clinical treatments.
  • Humanized antibodies minimize the use of heterologous (inter-species) sequences in antibodies for use in human therapies, and are less likely to elicit unwanted immune responses. Primatized antibodies can be produced similarly.
  • the term “compound” means any identifiable chemical or molecule, including, but not limited to, ion, atom, small molecule, peptide, protein, sugar, nucleotide, or nucleic acid, and such compound can be natural or synthetic.
  • the terms “modulates” or “modifies” means an increase or decreas'e in the amount, quality, or effect of a particular activity or protein.
  • blocking the interaction between Cripto and ALK 4" means an increase or decrease in the interaction, i.e. binding, between Cripto and ALK4, by about 5%, preferably 10%, more preferably 20%, more preferably 30%, more preferably 40%, more preferably 50%, more preferably 60%, more preferably 70%, more preferably 80%, more preferably 90%, and most preferably 100%,.
  • Activity may be measured by assays known in the art, such as the binding assay shown in Example 8.
  • treating refers to having a therapeutic effect and at least partially alleviating or abrogating an abnormal condition in the organism. Treating includes maintenance of inhibited tumor growth, and induction of remission.
  • therapeutic effect refers to the inhibition of an abnormal condition.
  • administering relates to a method of incorporating a compound into cells or tissues of an organism.
  • the abnormal condition can be prevented or treated when the cells or tissues of the organism exist within the organism or outside of the organism.
  • Cells existing outside the organism can be maintained or grown in cell culture dishes, or in another organism.
  • many techniques exist in the art to administer compounds including (but not limited to) oral, parenteral, dermal, injection, and aerosol applications.
  • multiple techniques exist in the art to administer the compounds including (but not limited to) cell microinjection techniques, transformation techniques and carrier techniques.
  • Administration may be accomplished by the many modes known in the art, e.g., oral, intravenous, intraperitoneal, intramuscular, and the like.
  • an "effective amount" is an amount sufficient to effect beneficial or desired clinical results (i.e., amounts that eliminate or reduce the patient's tumor burden).
  • An effective amount can be administered in one or more administrations.
  • an effective amount of the antibodies of the present invention is an amount of the antibodies that is sufficient to ameliorate, stabilize, or delay the development of the Cripto-associated disease state, particularly Cripto-associated tumors. Detection and measurement of these indicators of efficacy are discussed below.
  • An example of a typical treatment regime includes administering by intravenous infusion to the subject antibodies of the invention on a weekly schedule, at a dose of about 2-5 mg/kg.
  • the antibodies are administered in an outpatient chemoinfusion unit, unless the patient requires hospitalization.
  • Other administration regimes known in the art are also contemplated.
  • “Cripto overexpression” is intended to mean the expression of Cripto by a tissue which expression is greater than the Cripto expression of adjacent normal tissue in a statistically significant amount.
  • “Chemotherapeutics” refers to any agents identified in the art as having therapeutic effect on the inhibition of tumor growth, maintenace of inhibited tumor growth, and/or induction of remission, such as natural compounds, synthetic compounds, proteins, modified proteins, and radioactive compounds. Chemotherapeutic agents contemplated herewith include agents that can be conjugated to the antibodies of the present invention or alternatively agents that can be used in combination with the antibodies of the present invention without being conjugated to the antibody.
  • chemotherapeutics that can be conjugated to the antibodies of the present invention include, but are not limited to radioconjugates (90 Y, 1311, 99mTc, lllln, 186Rh, et al.), tumor-activated prodrugs (maytansinoids, CC-1065 analogs, clicheamicin derivatives, anthracyclines, vinca alkaloids, et al.), ricin, diptheria toxin, pseudomonas exotoxin.
  • radioconjugates 90 Y, 1311, 99mTc, lllln, 186Rh, et al.
  • tumor-activated prodrugs maytansinoids, CC-1065 analogs, clicheamicin derivatives, anthracyclines, vinca alkaloids, et al.
  • ricin diptheria toxin
  • pseudomonas exotoxin pseudomonas exotoxin.
  • a “subject” refers to vertebrates, particularly members of a mammalian species, and includes but is not limited to domestic animals, sports animals, and primates, including humans.
  • Antibodies of the Invention The antibodies of the invention specifically bind to Cripto: As used herein,
  • Cripto includes the CR-1 Cripto protein, the CR-3 Cripto protein, and fragments thereof. Such fragments may be entire domains, such as the extracellular or intracellular domains, the EGF-like domain, the cys-rich domain, the receptor binding domain, and the like. Such fragments may also include contiguous and noncontiguous epitopes in any domain of the Cripto protein.
  • the 188 amino acid sequence for CR-1 is as follows [SEQ ID NO: 1]: DCRK ARFSYSVI IMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDS IWPQEEPAIRPRSSQ VPPMGIQHSKELNRTCCLNGGTCM GSFCACPPS FYGRNCEHDVRK ⁇ NCGSVPHDT LPKKCSLCKC HGQLRCFPQAF PGCD GLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYYY
  • the 188 amino acid sequence for CR-3 is as follows [SEQ ID NO: 2]:
  • the antibodies of the invention bind to an epitope in the EGF-like domain of Cripto.
  • the EGF-like domain spans from about amino acid residue 75 to about amino acid residue 112 of the mature Cripto protein.
  • Epitopes in the EGF-like domain may comprise linear or nonlinear spans of amino acid residues.
  • Example of linear epitopes contemplated include but are not limited to about residues 75-85, 80-90, 85-95, 90-100, 95-105, 100-110, or 105-112.
  • the epitope in the EGF domain is an epitope formed in the conformational native Cripto protein versus a denatured Cripto protein.
  • the antibodies of the invention bind to an epitope in the cys-rich domain of Cripto.
  • the cys-rich domain spans from about amino acid residue 114 to about amino acid residue 150 of the mature Cripto protein.
  • Epitopes in the cys- rich domain may comprise linear or nonlinear spans of amino acid residues.
  • Example of linear epitopes contemplated include but are not limited to about residues 114-125, 120-130, 125-135, 130-140, 135-145, or 140-150.
  • the epitope in the cys-rich domain is an epitope formed in the conformational native Cripto protein versus a denatured Cripto protein
  • the present invention provides antibodies (e.g., monoclonal and polyclonal antibodies, single chain antibodies, chimeric antibodies, bifunctional/bispecific antibodies, humanized antibodies, human antibodies, and complementary determining region (CDR)-grafted antibodies, including compounds which include CDR sequences which specifically recognize a polypeptide of the invention) specific for Cripto or fragments thereof.
  • Antibody fragments including Fab, Fab', F(ab') 2 , and F v , are also provided by the invention.
  • the terms "specific " and "selective,” when used to describe binding of the antibodies of the invention, indicates that the variable regions of the antibodies of the invention recognize and bind Cripto polypeptides.
  • Hybridomas that produce such antibodies are also intended as aspects of the invention.
  • the invention provides an anti-idiotypic antibody specific for an antibody that is specific for Cripto.
  • anti-idiotypic antibodies see, e.g., U.S. Patents 6,063,379 and 5,780,029.
  • antibodies contain relatively small antigen binding domains that can be isolated chemically or by recombinant techniques. Such domains are useful Cripto binding molecules themselves, and also may be reintroduced into human antibodies, or fused to a chemotherapeutic or polypeptide.
  • the invention provides a polypeptide comprising a fragment of a Cripto- specific antibody, wherein the fragment and associated molecule, if any, bind to the Cripto.
  • the invention provides polypeptides that are single chain antibodies and CDR-grafted antibodies. For a more detailed discussion of CDR-grafted antibodies, see, e.g., U.S. Patent5,859,205.
  • non-human antibodies may be humanized by any of the methods known in the art. Humanized antibodies are useful for in vivo therapeutic applications.
  • recombinant "humanized" antibodies may be synthesized. Humanized antibodies are antibodies initially derived from a nonhuman mammal in which recombinant DNA technology has been used to substitute some or all of the amino acids not required for antigen binding with amino acids from corresponding regions of a human immunoglobulin light or heavy chain. That is, they are chimeras comprising mostly human immunoglobulin sequences into which the regions responsible for specific antigen-binding have been inserted (see, e.g., PCT patent application WO 94/04679).
  • Another embodiment of the invention includes the use of human antibodies, which can be produced in nonhuman animals, such as transgenic animals harboring one or more human immunoglobulin transgenes. Such animals may be used as a source for splenocytes for producing hybridomas, as is described in United States patent 5,569,825, WO00076310, WO00058499 and WO00037504 and incorporated by reference herein.
  • Signal Modulation is described in United States patent 5,569,825, WO00076310, WO00058499 and WO00037504 and incorporated by reference herein.
  • Also contemplated are methods of treating a subject suffering from a disorder associated with abnormal levels (i.e. elevated or depleted) of Cripto wherein the method comprises administering to the subject an effective amount of an antibody which specifically forms a complex with Cripto and is directed to the epitope to which an antibody selected from the group consisting of A6C12.11, A6F8.6 (ATCC ACCESSION NO. PTA-3318), A7H1.19, A8F1.30, A8G3.5 (ATCC ACCESSION NO. PTA-3317), A8H3.1 (ATCC ACCESSION NO. PTA-3315), A8H3.2, A19A10.30, A10B2.18 (ATCC ACCESSION NO.
  • the vector pEAGl 100 is a derivative of GEBCO-BRL Life Technologies plasmid pCMV-Sport- betagal, the use of which in CHO transient transfections was described by Schifferli et al., 1999, Focus 21: 16. It was made by removing the reporter gene beta-galactosidase Notl fragment from the plasmid pCMV-Sport-Betagal (catalog number 10586-014) as follows: The plasmid was digested with Notl and EcoRV, the 4.38 kb Notl vector backbone fragment was gel-purified and ligated. Ligated DNA was transformed into competent E. coli DH5alpha.
  • the eluted CR(del C)-Fc protein is injected into mice, and standard hybridoma techniques known to those of skill in the art are used to generate monoclonal antibodies.
  • the mouse was boosted intravenously with 50 ⁇ g CR del C-Fc the day before fusion.
  • the mouse spleen cells were fused with FL653 myeloma cell at a 1 spleen :6 myeloma ratio and were plated at 100,000, 33,000and 11,000 cells per well into 96 well tissue culture plates in selection media. Wells positive for growth were screened by FACS and ELIS A a week later. Two fusions were performed.
  • B. Screening of Antibodies Supernatants resulting from the first or second fusion were screened first on
  • Cripto positive cell lines may be used to assay the monoclonal antibodies for binding to Cripto using cell surface staining and flow cytometry as follows: Release cells from T162 flasks with 2 ml PBS " with 5 mM EDTA, 10 min., 37°C. Bring up to 20 ml with media with serum, pipetting up and down several times to unclump cells. Spin at 1200 rpm for 5 minutes. Wash cells with 5-10 ml 4° C PBS with 0.1% BSA (wash buffer). Spin at 1200 rpm for 5 minutes. Resuspend at 4xl0 6 - 10 7 /ml in wash buffer. Keep on ice.
  • Purified antibodies are diluted to 1-10 ⁇ g/ml in wash buffer. Add 50 ⁇ l of cells to a 96-well Linbro V bottomed plate (ICN 7632105). Plate one well of cells for each control for each cell line to be analyzed, including cells for no antibody, 2° antibody only, hybridoma media, positive control antibody supernatant, if available, or purified, and an IgG subclass control (if using purified antibodies).
  • the following describes an F9 Cripto null cell signaling assay used to assess inhibition of Cripto signaling.
  • Sample 1 0.5 ⁇ g (N 2 ) 7 luciferase FAST reporter cDNA plus 1.5 ⁇ g empty vector cDNA.
  • Sample 2 0.5 ⁇ g (N ) 7 luciferase, 0.5 ⁇ g FAST, and 1 ⁇ g empty vector cDNAs.
  • Sample 3 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto ADD 0.5 FAST, and -0.5 ⁇ g empty vector cDNAs.
  • Sample 4 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs
  • Sample 5 0.5 ⁇ g (N 2 ) luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs.
  • Sample 6 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs.
  • Sample 7 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs.
  • Sample 8 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs.
  • Sample 9 0.5 ⁇ g (N 2 ) 7 luciferase, 0.5 ⁇ g Cripto, 0.5 FAST, and 0.5 ⁇ g empty vector cDNAs.
  • Solution B comprises 30 ⁇ l of Lipofectamine plus 270 ⁇ l of OptiMeml.
  • Sample 6 wells A40G12.8; lO ⁇ g/ml, Sample 7 wells: A40G12.8 2 ⁇ g/ml; Sample 8 wells: A10B2.18, lO ⁇ g/ml; Sample 9 wells: A10B2.18, 2 ⁇ g/ml.
  • Day 2 Remove media, wash cells with PBS, 2ml/well. Add DMEM+0.5% FCS, 2mM Gin, P/S with the same amounts of Cripto antibodies as the previous day, to the same wells.
  • Day 0 Implant tumor, record initial body weight of animals.
  • a human testicular carcinoma cell line was implanted subcutaneously with an antibody which binds to a cys-rich domain of Cripto.
  • Day -1 Randomized mice into control and treatments groups. Recorded initial body weight of animals. Administered first treatments to antibody groups. Dosing solutions were made. Treatments were blinded to the technicians until the assay was terminated.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/US2002/011950 2000-03-20 2002-04-17 Cripto blocking antibodies and uses thereof Ceased WO2002088170A2 (en)

Priority Applications (37)

Application Number Priority Date Filing Date Title
EEP200300528A EE200300528A (et) 2001-04-26 2002-04-17 Cripto valku blokeerivad antikehad ja nende kasutamine
SK1443-2003A SK14432003A3 (sk) 2001-04-26 2002-04-17 Protilátka špecifická pre Cripto, kompozícia obsahujúca takúto protilátku a jej použitie
KR1020037014078A KR100592357B1 (ko) 2001-04-26 2002-04-17 크립토 차단 항체 및 그 용도
EA200301158A EA007469B1 (ru) 2001-04-26 2002-04-17 Антитела, блокирующие cripto, и их применения
EP02731384A EP1390389B1 (en) 2001-04-26 2002-04-17 Cripto blocking antibodies and uses thereof
CA2443840A CA2443840C (en) 2001-04-26 2002-04-17 Cripto blocking antibodies and uses thereof
HK04101788.0A HK1058935B (en) 2001-04-26 2002-04-17 Cripto blocking antibodies and uses thereof
DE60230868T DE60230868D1 (de) 2001-04-26 2002-04-17 Criptoblockierende antikörper und deren verwendung
SI200230804T SI1390389T1 (sl) 2001-04-26 2002-04-17 Protitelesa, ki blokirajo cripto in uporabe le-teh
DK02731384T DK1390389T3 (da) 2001-04-26 2002-04-17 Cripto-blokerende antistoffer og anvendelser deraf
BRPI0209254-9A BR0209254A (pt) 2001-04-26 2002-04-17 anticorpos de bloqueio cripto e usos dos mesmos
YU84903A RS51635B (sr) 2001-04-26 2002-04-17 Antitela koja blokiraju cripto i njihova upotreba
JP2002585468A JP4307845B2 (ja) 2001-04-26 2002-04-17 Criptoをブロックする抗体およびその使用
MXPA03009797A MXPA03009797A (es) 2001-04-26 2002-04-17 ANTICUERPOS PARA BLOQUEO DE PROTEiNA CRIPTO Y USO DE LOS MISMOS.
IL15857302A IL158573A0 (en) 2000-03-20 2002-04-17 Cripto blocking antibodies and uses thereof
HU0501113A HUP0501113A3 (en) 2001-04-26 2002-04-17 Cripto blocking antibodies and uses thereof
AT02807155T ATE490981T1 (de) 2002-03-22 2002-10-01 Criptospezifische antikörper
JP2003580477A JP2005520566A (ja) 2002-03-22 2002-10-01 Cripto特異的抗体
EP02807155A EP1494693B1 (en) 2002-03-22 2002-10-01 Cripto-specific antibodies
HK05105887.0A HK1072381B (en) 2002-03-22 2002-10-01 Cripto-specific antibodies
AU2002334799A AU2002334799B2 (en) 2001-04-26 2002-10-01 Cripto-specific antibodies
DE60238559T DE60238559D1 (de) 2002-03-22 2002-10-01 Criptospezifische antikörper
PCT/US2002/031462 WO2003083041A2 (en) 2002-03-22 2002-10-01 Cripto-specific antibodies
PT02807155T PT1494693E (pt) 2002-03-22 2002-10-01 Cripto ¿ anticorpos especificos
DK02807155.3T DK1494693T3 (da) 2002-03-22 2002-10-01 Cripto-specifikke antistoffer
CA2480119A CA2480119C (en) 2002-03-22 2002-10-01 Cripto-specific antibodies
US10/693,538 US7531174B2 (en) 2001-04-26 2003-10-23 Cripto blocking antibodies and uses thereof
IS6999A IS2662B (is) 2001-04-26 2003-10-24 Mótefni sem blokka prótínið Cripto og notkun þeirra
NO20034805A NO20034805L (no) 2001-04-26 2003-10-27 CRIPTO-blokkerende antistoff samt anvendelse derav
BG108363A BG108363A (bg) 2001-04-26 2003-11-14 Крипто блокиращи антитела и тяхното използване
US10/945,853 US7582299B2 (en) 2001-04-26 2004-09-20 Cripto-specific antibodies
US11/799,361 US7674462B2 (en) 2001-04-26 2007-04-30 Cripto blocking antibodies and uses thereof
US12/317,476 US8003763B2 (en) 2001-04-26 2008-12-22 Cripto blocking antibodies and uses thereof
US12/353,913 US20090285818A1 (en) 2001-04-26 2009-01-14 Cripto Blocking Antibodies and Uses Thereof
JP2009020949A JP2009161539A (ja) 2002-03-22 2009-01-30 Cripto特異的抗体
US12/415,659 US7888052B2 (en) 2001-04-26 2009-03-31 Cripto blocking antibodies and uses thereof
US13/213,499 US8673303B2 (en) 2001-04-26 2011-08-19 Cripto blocking antibodies and uses thereof

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US28678201P 2001-04-26 2001-04-26
US60/286,782 2001-04-26
US29302001P 2001-05-17 2001-05-17
US60/293,020 2001-05-17
US30109101P 2001-06-26 2001-06-26
US60/301,091 2001-06-26
US36700202P 2002-03-22 2002-03-22
US60/367,002 2002-03-22

Related Child Applications (3)

Application Number Title Priority Date Filing Date
PCT/US2002/031462 Continuation WO2003083041A2 (en) 2001-04-26 2002-10-01 Cripto-specific antibodies
US10/693,538 Continuation US7531174B2 (en) 2001-04-26 2003-10-23 Cripto blocking antibodies and uses thereof
US10/945,853 Continuation US7582299B2 (en) 2001-04-26 2004-09-20 Cripto-specific antibodies

Publications (2)

Publication Number Publication Date
WO2002088170A2 true WO2002088170A2 (en) 2002-11-07
WO2002088170A3 WO2002088170A3 (en) 2003-12-24

Family

ID=27501437

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2002/011950 Ceased WO2002088170A2 (en) 2000-03-20 2002-04-17 Cripto blocking antibodies and uses thereof

Country Status (33)

Country Link
US (6) US7531174B2 (https=)
EP (3) EP1390389B1 (https=)
JP (4) JP4307845B2 (https=)
KR (1) KR100592357B1 (https=)
CN (1) CN100352501C (https=)
AR (3) AR037223A1 (https=)
AT (2) ATE420659T1 (https=)
BG (1) BG108363A (https=)
BR (1) BR0209254A (https=)
CA (2) CA2443840C (https=)
CL (1) CL2009002199A1 (https=)
CY (1) CY1108960T1 (https=)
CZ (1) CZ20033208A3 (https=)
DE (1) DE60230868D1 (https=)
DK (1) DK1390389T3 (https=)
EA (1) EA007469B1 (https=)
EE (1) EE200300528A (https=)
ES (1) ES2321065T3 (https=)
GE (1) GEP20074091B (https=)
HU (1) HUP0501113A3 (https=)
IS (1) IS2662B (https=)
MX (1) MXPA03009797A (https=)
MY (2) MY157382A (https=)
NO (1) NO20034805L (https=)
NZ (1) NZ566268A (https=)
PL (1) PL207087B1 (https=)
PT (1) PT1390389E (https=)
RS (2) RS51635B (https=)
SG (1) SG157951A1 (https=)
SI (1) SI1390389T1 (https=)
SK (1) SK14432003A3 (https=)
TR (1) TR200301846T2 (https=)
WO (1) WO2002088170A2 (https=)

Cited By (99)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005000899A2 (en) 2003-06-27 2005-01-06 Biogen Idec Ma Inc. Modified binding molecules comprising connecting peptides
EP1494693A4 (en) * 2002-03-22 2006-08-02 Biogen Idec Inc SPECIFIC ANTIBODIES TO CRIPTO
WO2006074397A3 (en) * 2005-01-05 2006-12-28 Biogen Idec Inc Cripto binding molecules
US7318924B2 (en) 2001-03-26 2008-01-15 The Austin Research Institute Antibodies against cancer
EP1670511A4 (en) * 2003-09-15 2008-03-26 Res Dev Foundation CRIPTO ANTAGONISM OF ACTIVIN AND TGF-B SIGNALING
WO2008150530A3 (en) * 2007-06-01 2009-02-19 Biogen Idec Inc Cripto binding molecules
US7531174B2 (en) 2001-04-26 2009-05-12 Biogen Idec Ma Inc. Cripto blocking antibodies and uses thereof
US7582299B2 (en) 2001-04-26 2009-09-01 Biogen Idec Ma Inc. Cripto-specific antibodies
EP2260858A2 (en) 2003-11-06 2010-12-15 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
EP2286844A2 (en) 2004-06-01 2011-02-23 Genentech, Inc. Antibody-drug conjugates and methods
WO2011031870A1 (en) 2009-09-09 2011-03-17 Centrose, Llc Extracellular targeted drug conjugates
WO2011056983A1 (en) 2009-11-05 2011-05-12 Genentech, Inc. Zirconium-radiolabeled, cysteine engineered antibody conjugates
WO2011130598A1 (en) 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines and conjugates thereof
EP2385069A2 (en) 2003-11-12 2011-11-09 Biogen Idec MA Inc. Neonatal Fc rReceptor (FcRn)- binding polypeptide variants, dimeric Fc binding proteins and methods related thereto
WO2011156328A1 (en) 2010-06-08 2011-12-15 Genentech, Inc. Cysteine engineered antibodies and conjugates
US8084026B2 (en) 2005-01-05 2011-12-27 Biogen Idec Ma Inc. Multispecific binding molecules comprising connecting peptides
WO2012074757A1 (en) 2010-11-17 2012-06-07 Genentech, Inc. Alaninyl maytansinol antibody conjugates
WO2012143496A2 (de) 2011-04-21 2012-10-26 Bayer Intellectual Property Gmbh Neue binder-wirkstoff konjugate (adcs) und ihre verwendung
WO2012155019A1 (en) 2011-05-12 2012-11-15 Genentech, Inc. Multiple reaction monitoring lc-ms/ms method to detect therapeutic antibodies in animal samples using framework signature pepides
WO2013012733A1 (en) 2011-07-15 2013-01-24 Biogen Idec Ma Inc. Heterodimeric fc regions, binding molecules comprising same, and methods relating thereto
WO2013130093A1 (en) 2012-03-02 2013-09-06 Genentech, Inc. Biomarkers for treatment with anti-tubulin chemotherapeutic compounds
WO2014057074A1 (en) 2012-10-12 2014-04-17 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
WO2014140174A1 (en) 2013-03-13 2014-09-18 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
WO2014140862A2 (en) 2013-03-13 2014-09-18 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2014159981A2 (en) 2013-03-13 2014-10-02 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2015023355A1 (en) 2013-08-12 2015-02-19 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
US8975037B2 (en) 2006-07-28 2015-03-10 Ann & Robert H. Lurie Children's Hospital of Chicago Methods of inhibiting tumor cell aggressiveness using the microenvironment of human embryonic stem cells
WO2015095223A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2015095227A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2015095212A1 (en) 2013-12-16 2015-06-25 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
WO2016037644A1 (en) 2014-09-10 2016-03-17 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2016040856A2 (en) 2014-09-12 2016-03-17 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2016040825A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anthracycline disulfide intermediates, antibody-drug conjugates and methods
WO2016090050A1 (en) 2014-12-03 2016-06-09 Genentech, Inc. Quaternary amine compounds and antibody-drug conjugates thereof
WO2016161477A1 (en) * 2015-04-07 2016-10-13 Prince Henry's Institute Of Medical Research (Acn 132 025 024) A method of treating neoplasias
EP3088004A1 (en) 2004-09-23 2016-11-02 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2016207089A1 (de) 2015-06-22 2016-12-29 Bayer Pharma Aktiengesellschaft Binder-wirkstoff-konjugate (adcs) und binder-prodrug-konjugate (apdcs) mit enzymatisch spaltbaren gruppen
WO2017059289A1 (en) 2015-10-02 2017-04-06 Genentech, Inc. Pyrrolobenzodiazepine antibody drug conjugates and methods of use
WO2017060322A2 (en) 2015-10-10 2017-04-13 Bayer Pharma Aktiengesellschaft Ptefb-inhibitor-adc
WO2017064675A1 (en) 2015-10-16 2017-04-20 Genentech, Inc. Hindered disulfide drug conjugates
WO2017068511A1 (en) 2015-10-20 2017-04-27 Genentech, Inc. Calicheamicin-antibody-drug conjugates and methods of use
WO2017165734A1 (en) 2016-03-25 2017-09-28 Genentech, Inc. Multiplexed total antibody and antibody-conjugated drug quantification assay
WO2017162663A1 (de) 2016-03-24 2017-09-28 Bayer Pharma Aktiengesellschaft Prodrugs von cytotoxischen wirkstoffen mit enzymatisch spaltbaren gruppen
EP3235820A1 (en) 2014-09-17 2017-10-25 Genentech, Inc. Pyrrolobenzodiazepines and antibody disulfide conjugates thereof
WO2017201449A1 (en) 2016-05-20 2017-11-23 Genentech, Inc. Protac antibody conjugates and methods of use
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
WO2017214024A1 (en) 2016-06-06 2017-12-14 Genentech, Inc. Silvestrol antibody-drug conjugates and methods of use
WO2018031662A1 (en) 2016-08-11 2018-02-15 Genentech, Inc. Pyrrolobenzodiazepine prodrugs and antibody conjugates thereof
US9919056B2 (en) 2012-10-12 2018-03-20 Adc Therapeutics S.A. Pyrrolobenzodiazepine-anti-CD22 antibody conjugates
US9931414B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9931415B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
WO2018065501A1 (en) 2016-10-05 2018-04-12 F. Hoffmann-La Roche Ag Methods for preparing antibody drug conjugates
US9950078B2 (en) 2013-10-11 2018-04-24 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9956299B2 (en) 2013-10-11 2018-05-01 Medimmune Limited Pyrrolobenzodiazepine—antibody conjugates
WO2018114798A1 (de) 2016-12-21 2018-06-28 Bayer Aktiengesellschaft Prodrugs von cytotoxischen wirkstoffen mit enzymatisch spaltbaren gruppen
WO2018114578A1 (de) 2016-12-21 2018-06-28 Bayer Pharma Aktiengesellschaft Binder-wirkstoff-konjugate (adcs) mit enzymatisch spaltbaren gruppen
US10010624B2 (en) 2013-10-11 2018-07-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US10022453B2 (en) 2013-12-23 2018-07-17 Bayer Pharma Aktiengesellschaft Antibody drug conjugates (ADCs) with kinesin spindel protein (KSP)
US10029018B2 (en) 2013-10-11 2018-07-24 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2019060398A1 (en) 2017-09-20 2019-03-28 Ph Pharma Co., Ltd. ANALOGUES OF THAILANSTATINE
US10392393B2 (en) 2016-01-26 2019-08-27 Medimmune Limited Pyrrolobenzodiazepines
US10420777B2 (en) 2014-09-12 2019-09-24 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2019232449A1 (en) 2018-06-01 2019-12-05 Eisai R&D Management Co., Ltd. Splicing modulator antibody-drug conjugates and methods of use
US10544223B2 (en) 2017-04-20 2020-01-28 Adc Therapeutics Sa Combination therapy with an anti-axl antibody-drug conjugate
US10543279B2 (en) 2016-04-29 2020-01-28 Medimmune Limited Pyrrolobenzodiazepine conjugates and their use for the treatment of cancer
WO2020049286A1 (en) 2018-09-03 2020-03-12 Femtogenix Limited Polycyclic amides as cytotoxic agents
WO2020086858A1 (en) 2018-10-24 2020-04-30 Genentech, Inc. Conjugated chemical inducers of degradation and methods of use
WO2020123275A1 (en) 2018-12-10 2020-06-18 Genentech, Inc. Photocrosslinking peptides for site specific conjugation to fc-containing proteins
WO2020123836A2 (en) 2018-12-13 2020-06-18 Eisai R&D Management Co., Ltd. Herboxidiene splicing modulator antibody-drug conjugates and methods of use
US10695439B2 (en) 2016-02-10 2020-06-30 Medimmune Limited Pyrrolobenzodiazepine conjugates
US10695433B2 (en) 2012-10-12 2020-06-30 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
WO2020157491A1 (en) 2019-01-29 2020-08-06 Femtogenix Limited G-a crosslinking cytotoxic agents
US10736903B2 (en) 2012-10-12 2020-08-11 Medimmune Limited Pyrrolobenzodiazepine-anti-PSMA antibody conjugates
US10751346B2 (en) 2012-10-12 2020-08-25 Medimmune Limited Pyrrolobenzodiazepine—anti-PSMA antibody conjugates
US10780096B2 (en) 2014-11-25 2020-09-22 Adc Therapeutics Sa Pyrrolobenzodiazepine-antibody conjugates
US10799595B2 (en) 2016-10-14 2020-10-13 Medimmune Limited Pyrrolobenzodiazepine conjugates
US11001636B2 (en) 2016-06-15 2021-05-11 Bayer Pharma Aktiengesellschaft Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies
US11059893B2 (en) 2015-04-15 2021-07-13 Bergenbio Asa Humanized anti-AXL antibodies
US11135303B2 (en) 2011-10-14 2021-10-05 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US11160872B2 (en) 2017-02-08 2021-11-02 Adc Therapeutics Sa Pyrrolobenzodiazepine-antibody conjugates
WO2022023735A1 (en) 2020-07-28 2022-02-03 Femtogenix Limited Cytotoxic agents
US11318211B2 (en) 2017-06-14 2022-05-03 Adc Therapeutics Sa Dosage regimes for the administration of an anti-CD19 ADC
US11352324B2 (en) 2018-03-01 2022-06-07 Medimmune Limited Methods
US11370801B2 (en) 2017-04-18 2022-06-28 Medimmune Limited Pyrrolobenzodiazepine conjugates
US11433140B2 (en) 2016-12-21 2022-09-06 Bayer Pharma Aktiengesellschaft Specific antibody drug conjugates (ADCs) having KSP inhibitors
US11517626B2 (en) 2016-02-10 2022-12-06 Medimmune Limited Pyrrolobenzodiazepine antibody conjugates
US11524969B2 (en) 2018-04-12 2022-12-13 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof as antitumour agents
US11612665B2 (en) 2017-02-08 2023-03-28 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
WO2023078273A1 (en) 2021-11-03 2023-05-11 Hangzhou Dac Biotech Co., Ltd. Specific conjugation for an antibody-drug conjugate
US11649250B2 (en) 2017-08-18 2023-05-16 Medimmune Limited Pyrrolobenzodiazepine conjugates
US11702473B2 (en) 2015-04-15 2023-07-18 Medimmune Limited Site-specific antibody-drug conjugates
WO2024138128A2 (en) 2022-12-23 2024-06-27 Genentech, Inc. Cereblon degrader conjugates, and uses thereof
WO2024220546A2 (en) 2023-04-17 2024-10-24 Peak Bio, Inc. Antibodies and antibody-drug conjugates and methods of use and synthetic processes and intermediates
US12209099B2 (en) 2019-03-15 2025-01-28 Medimmune Limited Azetidobenzodiazepine dimers and conjugates comprising them for use in the treatment of cancer
US12269859B2 (en) 2016-12-02 2025-04-08 Angeles Therapeutics, Inc. Synthetic immune receptors and methods of use thereof
WO2025132978A1 (en) * 2023-12-19 2025-06-26 BioNTech SE Cfc1 binding molecule
WO2025132976A1 (en) * 2023-12-19 2025-06-26 BioNTech SE Cfc1 binding molecule
WO2026006689A2 (en) 2024-06-28 2026-01-02 Firefly Bio, Inc. Bcl-xl degrader antibody conjugates and uses thereof
WO2026006688A2 (en) 2024-06-28 2026-01-02 Firefly Bio, Inc. Degrader antibody conjugates and uses thereof

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090123470A1 (en) * 2001-03-26 2009-05-14 The Macfarlane Burnet Istitute For Medical Research And Public Health Ltd. Antibodies Against Cancer
JP2011522224A (ja) * 2008-04-21 2011-07-28 メルク・シャープ・エンド・ドーム・コーポレイション 膵ベータ細胞質量生物マーカー
US20100135904A1 (en) * 2008-11-07 2010-06-03 Research Development Foundation Compositions and methods for the inhibition of cripto / grp78 complex formation and signaling
JP6130307B2 (ja) 2011-03-17 2017-05-17 ザ ユニバーシティ オブ バーミンガム 再指向性免疫療法
CN105246894A (zh) 2012-12-21 2016-01-13 斯皮罗根有限公司 用于治疗增殖性和自身免疫疾病的非对称吡咯并苯并二氮杂卓二聚物
CN105189507A (zh) 2012-12-21 2015-12-23 斯皮罗根有限公司 吡咯并苯并二氮杂卓及其结合物
CA3120800A1 (en) 2018-12-17 2020-06-25 Revitope Limited Twin immune cell engager

Family Cites Families (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
NZ207394A (en) * 1983-03-08 1987-03-06 Commw Serum Lab Commission Detecting or determining sequence of amino acids
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
WO1989006692A1 (en) 1988-01-12 1989-07-27 Genentech, Inc. Method of treating tumor cells by inhibiting growth factor receptor function
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5208020A (en) * 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5780029A (en) 1989-11-14 1998-07-14 New York Medical College Antidiotypic monoclonal antibodies for treatment of melanoma
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US5256643A (en) 1990-05-29 1993-10-26 The Government Of The United States Human cripto protein
ATE300615T1 (de) 1990-08-29 2005-08-15 Genpharm Int Transgene mäuse fähig zur produktion heterologer antikörper
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
US5264557A (en) 1991-08-23 1993-11-23 The United States Of America As Represented By The Department Of Health And Human Services Polypeptide of a human cripto-related gene, CR-3
US6063379A (en) 1993-12-09 2000-05-16 Centro De Inmunologia Molecular Anti-idiotypic monoclonal antibodies and compositions including the anti-idiotypic monoclonal antibodies
US5981215A (en) * 1995-06-06 1999-11-09 Human Genome Sciences, Inc. Human criptin growth factor
DK0912738T3 (da) * 1996-05-22 2008-11-17 Viventia Biotech Inc Antigen-bindende-fragmenter der specifikt detekterer cancerceller, nukleotider der koder fragmenterne og anvendelse deraf til profylakse og detektion af cancere
IL125608A0 (en) 1998-07-30 1999-03-12 Yeda Res & Dev Tumor associated antigen peptides and use of same as anti-tumor vaccines
DK1141028T3 (da) 1998-12-23 2010-05-25 Pfizer Humane monoklonale antistoffer til CTLA-4
US6335170B1 (en) 1999-02-22 2002-01-01 Torben F. Orntoft Gene expression in bladder tumors
DK1167537T3 (da) 1999-03-30 2008-11-10 Japan Tobacco Inc Fremgangsmåde til fremstilling af et monoklonalt antistof
EP1179178A1 (en) * 1999-04-20 2002-02-13 William J. Kokolus Improved method of identifying and locating immunobiologically-active linear peptides
US6833268B1 (en) 1999-06-10 2004-12-21 Abgenix, Inc. Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions
JP2001046066A (ja) 1999-08-03 2001-02-20 Kyowa Hakko Kogyo Co Ltd 新規な相補性決定領域を有するヒトvegf受容体kdrに対する抗体
AU778199B2 (en) 1999-10-29 2004-11-25 Genentech Inc. Anti-prostate stem cell antigen (PSCA) antibody compositions and methods of use
US6663613B1 (en) 2000-01-25 2003-12-16 Bacchus Vascular, Inc. System and methods for clot dissolution
CN100455599C (zh) * 2000-03-03 2009-01-28 协和发酵工业株式会社 基因重组抗体及其抗体片段
US6333410B1 (en) * 2000-08-18 2001-12-25 Immunogen, Inc. Process for the preparation and purification of thiol-containing maytansinoids
GB0020953D0 (en) 2000-08-24 2000-10-11 Smithkline Beecham Biolog Vaccine
CA2422814A1 (en) 2000-09-18 2002-03-21 Biogen, Inc. Cripto mutant and uses thereof
ES2278899T3 (es) 2001-01-26 2007-08-16 The Government Of The United States Of America As Represented By The Secretary Of The Department Of Deteccion y cuantificacion de cripto-1.
BR0206985A (pt) 2001-01-29 2005-04-19 Idec Pharma Corp Anticorpos modificados e métodos de uso
AU2002327164A1 (en) 2001-01-29 2002-12-09 Idec Pharmaceuticals Corporation Engineered tetravalent antibodies and methods of use
AUPR395801A0 (en) 2001-03-26 2001-04-26 Austin Research Institute, The Antibodies against cancer
PT1390389E (pt) 2001-04-26 2009-04-03 Biogen Idec Inc Anticorpos que bloqueiam o cripto e as utilizações dos mesmos
US7582299B2 (en) * 2001-04-26 2009-09-01 Biogen Idec Ma Inc. Cripto-specific antibodies
EP1487877B1 (en) * 2001-09-18 2010-10-27 Genentech, Inc. Compositions and methods for the diagnosis of tumors
US20040014690A1 (en) 2002-02-13 2004-01-22 Zhenkun Ma Macrolides with activity against methicillin-resistant staphylococcus aureus
JP2005520566A (ja) * 2002-03-22 2005-07-14 バイオジェン・アイデック・エムエイ・インコーポレイテッド Cripto特異的抗体
CA2539116C (en) * 2003-09-15 2014-11-18 Research Development Foundation Cripto antagonism of activin and tgf-b signaling
ES2408704T3 (es) 2005-01-05 2013-06-21 Biogen Idec Ma Inc. Moléculas de unión a Cripto
AU2007243181A1 (en) 2006-04-28 2007-11-08 Biogen Idec Ma Inc. Composition and methods for the detection of Cripto-3

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
BALDASSARRE ET AL., INT. J. CANCER, vol. 66, 1996, pages 538 - 543
CIARDIELLO ET AL., ONCOGENE, vol. 9, 1994, pages 291 - 298
MINCHIOTTI, MECH. DEV., vol. 90, 2000, pages 133 - 142
SAIJOH ET AL., MOL. CELL, vol. 5, 2000, pages 35 - 47
SALOMON ET AL., BIOESSAYS, vol. 21, 1999, pages 61 - 70
SCHIFFERLI ET AL., FOCUS, vol. 21, 1999, pages 16

Cited By (145)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7318924B2 (en) 2001-03-26 2008-01-15 The Austin Research Institute Antibodies against cancer
US7531174B2 (en) 2001-04-26 2009-05-12 Biogen Idec Ma Inc. Cripto blocking antibodies and uses thereof
US7674462B2 (en) 2001-04-26 2010-03-09 Biogen Idec Ma Inc. Cripto blocking antibodies and uses thereof
US7888052B2 (en) 2001-04-26 2011-02-15 Biogen Idec Ma Inc. Cripto blocking antibodies and uses thereof
US7582299B2 (en) 2001-04-26 2009-09-01 Biogen Idec Ma Inc. Cripto-specific antibodies
US8673303B2 (en) 2001-04-26 2014-03-18 Biogen Idec Ma Inc. Cripto blocking antibodies and uses thereof
US8003763B2 (en) 2001-04-26 2011-08-23 Biogen Idec Ma Inc. Cripto blocking antibodies and uses thereof
EP1494693A4 (en) * 2002-03-22 2006-08-02 Biogen Idec Inc SPECIFIC ANTIBODIES TO CRIPTO
US7700097B2 (en) 2003-06-27 2010-04-20 Biogen Idec Ma Inc. Purification and preferential synthesis of binding molecules
US8603473B2 (en) 2003-06-27 2013-12-10 Biogen Idec Ma Inc. Modified binding molecules comprising connecting peptides
WO2005000899A2 (en) 2003-06-27 2005-01-06 Biogen Idec Ma Inc. Modified binding molecules comprising connecting peptides
EP1670511A4 (en) * 2003-09-15 2008-03-26 Res Dev Foundation CRIPTO ANTAGONISM OF ACTIVIN AND TGF-B SIGNALING
US9546210B2 (en) 2003-09-15 2017-01-17 Research Development Foundation Cripto antagonism of activin and TGF-b signaling
AU2004274433B2 (en) * 2003-09-15 2010-08-12 Research Development Foundation Cripto antagonism of activin and TGF-beta signaling
US7820620B2 (en) 2003-09-15 2010-10-26 Research Development Foundation Cripto antagonism of activin and TGF-b signaling
EP2489364A1 (en) 2003-11-06 2012-08-22 Seattle Genetics, Inc. Monomethylvaline compounds onjugated to antibodies
EP3434275A1 (en) 2003-11-06 2019-01-30 Seattle Genetics, Inc. Assay for cancer cells based on the use of auristatin conjugates with antibodies
EP3858387A1 (en) 2003-11-06 2021-08-04 Seagen Inc. Monomethylvaline compounds capable of conjugation to ligands
EP2260858A2 (en) 2003-11-06 2010-12-15 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
EP2486933A1 (en) 2003-11-06 2012-08-15 Seattle Genetics, Inc. Monomethylvaline compounds conjugated with antibodies
EP2478912A1 (en) 2003-11-06 2012-07-25 Seattle Genetics, Inc. Auristatin conjugates with anti-HER2 or anti-CD22 antibodies and their use in therapy
EP2385069A2 (en) 2003-11-12 2011-11-09 Biogen Idec MA Inc. Neonatal Fc rReceptor (FcRn)- binding polypeptide variants, dimeric Fc binding proteins and methods related thereto
EP2286844A2 (en) 2004-06-01 2011-02-23 Genentech, Inc. Antibody-drug conjugates and methods
EP3088004A1 (en) 2004-09-23 2016-11-02 Genentech, Inc. Cysteine engineered antibodies and conjugates
US8021661B2 (en) 2005-01-05 2011-09-20 Biogen Idec Ma Inc. Cripto binding molecules
EP2311880A3 (en) * 2005-01-05 2011-07-27 Biogen Idec MA Inc. Cripto binding molecules
US8084026B2 (en) 2005-01-05 2011-12-27 Biogen Idec Ma Inc. Multispecific binding molecules comprising connecting peptides
EP2311881A2 (en) 2005-01-05 2011-04-20 Biogen Idec MA Inc. Cripto binding molecules
WO2006074397A3 (en) * 2005-01-05 2006-12-28 Biogen Idec Inc Cripto binding molecules
EP2311880A2 (en) 2005-01-05 2011-04-20 Biogen Idec MA Inc. Cripto binding molecules
EP2311881A3 (en) * 2005-01-05 2011-07-27 Biogen Idec MA Inc. Cripto binding molecules
CN101137673B (zh) * 2005-01-05 2013-12-04 比奥根艾迪克Ma公司 Cripto结合分子
US8975037B2 (en) 2006-07-28 2015-03-10 Ann & Robert H. Lurie Children's Hospital of Chicago Methods of inhibiting tumor cell aggressiveness using the microenvironment of human embryonic stem cells
WO2008150530A3 (en) * 2007-06-01 2009-02-19 Biogen Idec Inc Cripto binding molecules
WO2011031870A1 (en) 2009-09-09 2011-03-17 Centrose, Llc Extracellular targeted drug conjugates
WO2011056983A1 (en) 2009-11-05 2011-05-12 Genentech, Inc. Zirconium-radiolabeled, cysteine engineered antibody conjugates
WO2011130598A1 (en) 2010-04-15 2011-10-20 Spirogen Limited Pyrrolobenzodiazepines and conjugates thereof
WO2011156328A1 (en) 2010-06-08 2011-12-15 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2012074757A1 (en) 2010-11-17 2012-06-07 Genentech, Inc. Alaninyl maytansinol antibody conjugates
WO2012143499A2 (de) 2011-04-21 2012-10-26 Bayer Intellectual Property Gmbh Neue binder-wirkstoff konjugate (adcs) und ihre verwendung
WO2012143496A2 (de) 2011-04-21 2012-10-26 Bayer Intellectual Property Gmbh Neue binder-wirkstoff konjugate (adcs) und ihre verwendung
WO2012155019A1 (en) 2011-05-12 2012-11-15 Genentech, Inc. Multiple reaction monitoring lc-ms/ms method to detect therapeutic antibodies in animal samples using framework signature pepides
WO2013012733A1 (en) 2011-07-15 2013-01-24 Biogen Idec Ma Inc. Heterodimeric fc regions, binding molecules comprising same, and methods relating thereto
US11135303B2 (en) 2011-10-14 2021-10-05 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2013130093A1 (en) 2012-03-02 2013-09-06 Genentech, Inc. Biomarkers for treatment with anti-tubulin chemotherapeutic compounds
US11771775B2 (en) 2012-10-12 2023-10-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9889207B2 (en) 2012-10-12 2018-02-13 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2014057074A1 (en) 2012-10-12 2014-04-17 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
US10799596B2 (en) 2012-10-12 2020-10-13 Adc Therapeutics S.A. Pyrrolobenzodiazepine-antibody conjugates
US10335497B2 (en) 2012-10-12 2019-07-02 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10736903B2 (en) 2012-10-12 2020-08-11 Medimmune Limited Pyrrolobenzodiazepine-anti-PSMA antibody conjugates
US11690918B2 (en) 2012-10-12 2023-07-04 Medimmune Limited Pyrrolobenzodiazepine-anti-CD22 antibody conjugates
US9931415B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9931414B2 (en) 2012-10-12 2018-04-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US9919056B2 (en) 2012-10-12 2018-03-20 Adc Therapeutics S.A. Pyrrolobenzodiazepine-anti-CD22 antibody conjugates
US10722594B2 (en) 2012-10-12 2020-07-28 Adc Therapeutics S.A. Pyrrolobenzodiazepine-anti-CD22 antibody conjugates
US11779650B2 (en) 2012-10-12 2023-10-10 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US10695433B2 (en) 2012-10-12 2020-06-30 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
EP2839860A1 (en) 2012-10-12 2015-02-25 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
US10751346B2 (en) 2012-10-12 2020-08-25 Medimmune Limited Pyrrolobenzodiazepine—anti-PSMA antibody conjugates
US11701430B2 (en) 2012-10-12 2023-07-18 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10646584B2 (en) 2012-10-12 2020-05-12 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10994023B2 (en) 2012-10-12 2021-05-04 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US12121590B2 (en) 2012-10-12 2024-10-22 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US10780181B2 (en) 2012-10-12 2020-09-22 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
WO2014140862A2 (en) 2013-03-13 2014-09-18 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2014159981A2 (en) 2013-03-13 2014-10-02 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
WO2014140174A1 (en) 2013-03-13 2014-09-18 Spirogen Sàrl Pyrrolobenzodiazepines and conjugates thereof
WO2015023355A1 (en) 2013-08-12 2015-02-19 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
US10010624B2 (en) 2013-10-11 2018-07-03 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US10029018B2 (en) 2013-10-11 2018-07-24 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US9956299B2 (en) 2013-10-11 2018-05-01 Medimmune Limited Pyrrolobenzodiazepine—antibody conjugates
US9950078B2 (en) 2013-10-11 2018-04-24 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
WO2015095227A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
WO2015095212A1 (en) 2013-12-16 2015-06-25 Genentech, Inc. 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment
WO2015095223A2 (en) 2013-12-16 2015-06-25 Genentech, Inc. Peptidomimetic compounds and antibody-drug conjugates thereof
US10022453B2 (en) 2013-12-23 2018-07-17 Bayer Pharma Aktiengesellschaft Antibody drug conjugates (ADCs) with kinesin spindel protein (KSP)
US10188746B2 (en) 2014-09-10 2019-01-29 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2016037644A1 (en) 2014-09-10 2016-03-17 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2016040856A2 (en) 2014-09-12 2016-03-17 Genentech, Inc. Cysteine engineered antibodies and conjugates
WO2016040825A1 (en) 2014-09-12 2016-03-17 Genentech, Inc. Anthracycline disulfide intermediates, antibody-drug conjugates and methods
US10420777B2 (en) 2014-09-12 2019-09-24 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
EP3235820A1 (en) 2014-09-17 2017-10-25 Genentech, Inc. Pyrrolobenzodiazepines and antibody disulfide conjugates thereof
US10780096B2 (en) 2014-11-25 2020-09-22 Adc Therapeutics Sa Pyrrolobenzodiazepine-antibody conjugates
WO2016090050A1 (en) 2014-12-03 2016-06-09 Genentech, Inc. Quaternary amine compounds and antibody-drug conjugates thereof
WO2016161477A1 (en) * 2015-04-07 2016-10-13 Prince Henry's Institute Of Medical Research (Acn 132 025 024) A method of treating neoplasias
US11702473B2 (en) 2015-04-15 2023-07-18 Medimmune Limited Site-specific antibody-drug conjugates
US11059893B2 (en) 2015-04-15 2021-07-13 Bergenbio Asa Humanized anti-AXL antibodies
US11123439B2 (en) 2015-06-22 2021-09-21 Bayer Pharma Aktiengesellschaft Antibody drug conjugates (ADCS) and antibody prodrug conjugates (APDCS) with enzymatically cleavable groups
EP4406606A2 (de) 2015-06-22 2024-07-31 Bayer Pharma Aktiengesellschaft Binder-wirkstoff-konjugate (adcs) und binder-prodrug-konjugate (apdcs) mit enzymatisch spaltbaren g
US12144865B2 (en) 2015-06-22 2024-11-19 Bayer Pharma Aktiengesellschaft Antibody drug conjugates with enzymatically cleavable groups
WO2016207089A1 (de) 2015-06-22 2016-12-29 Bayer Pharma Aktiengesellschaft Binder-wirkstoff-konjugate (adcs) und binder-prodrug-konjugate (apdcs) mit enzymatisch spaltbaren gruppen
WO2017059289A1 (en) 2015-10-02 2017-04-06 Genentech, Inc. Pyrrolobenzodiazepine antibody drug conjugates and methods of use
WO2017060322A2 (en) 2015-10-10 2017-04-13 Bayer Pharma Aktiengesellschaft Ptefb-inhibitor-adc
WO2017064675A1 (en) 2015-10-16 2017-04-20 Genentech, Inc. Hindered disulfide drug conjugates
WO2017068511A1 (en) 2015-10-20 2017-04-27 Genentech, Inc. Calicheamicin-antibody-drug conjugates and methods of use
US10392393B2 (en) 2016-01-26 2019-08-27 Medimmune Limited Pyrrolobenzodiazepines
US10695439B2 (en) 2016-02-10 2020-06-30 Medimmune Limited Pyrrolobenzodiazepine conjugates
US11517626B2 (en) 2016-02-10 2022-12-06 Medimmune Limited Pyrrolobenzodiazepine antibody conjugates
US11685714B2 (en) 2016-03-24 2023-06-27 Bayer Pharma Aktiengesellschaft Prodrugs of cytotoxic active agents having enzymatically cleavable groups
WO2017162663A1 (de) 2016-03-24 2017-09-28 Bayer Pharma Aktiengesellschaft Prodrugs von cytotoxischen wirkstoffen mit enzymatisch spaltbaren gruppen
WO2017165734A1 (en) 2016-03-25 2017-09-28 Genentech, Inc. Multiplexed total antibody and antibody-conjugated drug quantification assay
EP4273551A2 (en) 2016-03-25 2023-11-08 F. Hoffmann-La Roche AG Multiplexed total antibody and antibody-conjugated drug quantification assay
US10543279B2 (en) 2016-04-29 2020-01-28 Medimmune Limited Pyrrolobenzodiazepine conjugates and their use for the treatment of cancer
WO2017201449A1 (en) 2016-05-20 2017-11-23 Genentech, Inc. Protac antibody conjugates and methods of use
WO2017205741A1 (en) 2016-05-27 2017-11-30 Genentech, Inc. Bioanalytical method for the characterization of site-specific antibody-drug conjugates
WO2017214024A1 (en) 2016-06-06 2017-12-14 Genentech, Inc. Silvestrol antibody-drug conjugates and methods of use
US11001636B2 (en) 2016-06-15 2021-05-11 Bayer Pharma Aktiengesellschaft Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies
US11643469B2 (en) 2016-06-15 2023-05-09 Bayer Pharma Aktiengesellschaft Specific antibody-drug-conjugates (ADCs) with KSP inhibitors and anti-CD123-antibodies
WO2018031662A1 (en) 2016-08-11 2018-02-15 Genentech, Inc. Pyrrolobenzodiazepine prodrugs and antibody conjugates thereof
WO2018065501A1 (en) 2016-10-05 2018-04-12 F. Hoffmann-La Roche Ag Methods for preparing antibody drug conjugates
US10799595B2 (en) 2016-10-14 2020-10-13 Medimmune Limited Pyrrolobenzodiazepine conjugates
US12269859B2 (en) 2016-12-02 2025-04-08 Angeles Therapeutics, Inc. Synthetic immune receptors and methods of use thereof
WO2018114578A1 (de) 2016-12-21 2018-06-28 Bayer Pharma Aktiengesellschaft Binder-wirkstoff-konjugate (adcs) mit enzymatisch spaltbaren gruppen
US11660351B2 (en) 2016-12-21 2023-05-30 Bayer Aktiengesellschaft Antibody drug conjugates (ADCs) having enzymatically cleavable groups
US11433140B2 (en) 2016-12-21 2022-09-06 Bayer Pharma Aktiengesellschaft Specific antibody drug conjugates (ADCs) having KSP inhibitors
US11478554B2 (en) 2016-12-21 2022-10-25 Bayer Pharma Aktiengesellschaft Antibody drug conjugates (ADCS) having enzymatically cleavable groups
US12059472B2 (en) 2016-12-21 2024-08-13 Bayer Aktiengesellschaft Prodrugs of cytotoxic active agents having enzymatically cleavable groups
WO2018114798A1 (de) 2016-12-21 2018-06-28 Bayer Aktiengesellschaft Prodrugs von cytotoxischen wirkstoffen mit enzymatisch spaltbaren gruppen
US11612665B2 (en) 2017-02-08 2023-03-28 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US11813335B2 (en) 2017-02-08 2023-11-14 Medimmune Limited Pyrrolobenzodiazepine-antibody conjugates
US11160872B2 (en) 2017-02-08 2021-11-02 Adc Therapeutics Sa Pyrrolobenzodiazepine-antibody conjugates
US11370801B2 (en) 2017-04-18 2022-06-28 Medimmune Limited Pyrrolobenzodiazepine conjugates
US10544223B2 (en) 2017-04-20 2020-01-28 Adc Therapeutics Sa Combination therapy with an anti-axl antibody-drug conjugate
US11318211B2 (en) 2017-06-14 2022-05-03 Adc Therapeutics Sa Dosage regimes for the administration of an anti-CD19 ADC
US11938192B2 (en) 2017-06-14 2024-03-26 Medimmune Limited Dosage regimes for the administration of an anti-CD19 ADC
US11649250B2 (en) 2017-08-18 2023-05-16 Medimmune Limited Pyrrolobenzodiazepine conjugates
WO2019060398A1 (en) 2017-09-20 2019-03-28 Ph Pharma Co., Ltd. ANALOGUES OF THAILANSTATINE
US11352324B2 (en) 2018-03-01 2022-06-07 Medimmune Limited Methods
US11524969B2 (en) 2018-04-12 2022-12-13 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof as antitumour agents
WO2019232449A1 (en) 2018-06-01 2019-12-05 Eisai R&D Management Co., Ltd. Splicing modulator antibody-drug conjugates and methods of use
WO2020049286A1 (en) 2018-09-03 2020-03-12 Femtogenix Limited Polycyclic amides as cytotoxic agents
WO2020086858A1 (en) 2018-10-24 2020-04-30 Genentech, Inc. Conjugated chemical inducers of degradation and methods of use
WO2020123275A1 (en) 2018-12-10 2020-06-18 Genentech, Inc. Photocrosslinking peptides for site specific conjugation to fc-containing proteins
WO2020123836A2 (en) 2018-12-13 2020-06-18 Eisai R&D Management Co., Ltd. Herboxidiene splicing modulator antibody-drug conjugates and methods of use
WO2020157491A1 (en) 2019-01-29 2020-08-06 Femtogenix Limited G-a crosslinking cytotoxic agents
US12209099B2 (en) 2019-03-15 2025-01-28 Medimmune Limited Azetidobenzodiazepine dimers and conjugates comprising them for use in the treatment of cancer
WO2022023735A1 (en) 2020-07-28 2022-02-03 Femtogenix Limited Cytotoxic agents
WO2023078273A1 (en) 2021-11-03 2023-05-11 Hangzhou Dac Biotech Co., Ltd. Specific conjugation for an antibody-drug conjugate
WO2024138128A2 (en) 2022-12-23 2024-06-27 Genentech, Inc. Cereblon degrader conjugates, and uses thereof
WO2024220546A2 (en) 2023-04-17 2024-10-24 Peak Bio, Inc. Antibodies and antibody-drug conjugates and methods of use and synthetic processes and intermediates
WO2025132978A1 (en) * 2023-12-19 2025-06-26 BioNTech SE Cfc1 binding molecule
WO2025132976A1 (en) * 2023-12-19 2025-06-26 BioNTech SE Cfc1 binding molecule
WO2026006689A2 (en) 2024-06-28 2026-01-02 Firefly Bio, Inc. Bcl-xl degrader antibody conjugates and uses thereof
WO2026006688A2 (en) 2024-06-28 2026-01-02 Firefly Bio, Inc. Degrader antibody conjugates and uses thereof

Also Published As

Publication number Publication date
AR077759A2 (es) 2011-09-21
EP1390389A2 (en) 2004-02-25
EA007469B1 (ru) 2006-10-27
PT1390389E (pt) 2009-04-03
JP2004534020A (ja) 2004-11-11
PL373513A1 (en) 2005-09-05
ES2321065T3 (es) 2009-06-02
RS51635B (sr) 2011-08-31
CN100352501C (zh) 2007-12-05
JP4575983B2 (ja) 2010-11-04
EA200301158A1 (ru) 2005-06-30
US20090286265A1 (en) 2009-11-19
NO20034805D0 (no) 2003-10-27
US20100202962A1 (en) 2010-08-12
EP1390389A4 (en) 2004-09-22
BR0209254A (pt) 2006-10-03
EE200300528A (et) 2004-08-16
US8003763B2 (en) 2011-08-23
MY157382A (en) 2016-06-15
EP1974749A1 (en) 2008-10-01
MXPA03009797A (es) 2004-01-29
US20080166341A1 (en) 2008-07-10
TR200301846T2 (tr) 2006-10-26
AR072554A2 (es) 2010-09-08
EP1390389B1 (en) 2009-01-14
WO2002088170A3 (en) 2003-12-24
BG108363A (bg) 2004-09-30
RS20110024A (sr) 2011-08-31
DK1390389T3 (da) 2009-04-20
CN1606453A (zh) 2005-04-13
JP2005314436A (ja) 2005-11-10
US7888052B2 (en) 2011-02-15
JP2010163438A (ja) 2010-07-29
EP2316486A2 (en) 2011-05-04
PL207087B1 (pl) 2010-10-29
IS2662B (is) 2010-08-15
US7531174B2 (en) 2009-05-12
US20040146940A1 (en) 2004-07-29
GEP20074091B (en) 2007-04-25
US20120195912A1 (en) 2012-08-02
ATE533508T1 (de) 2011-12-15
HK1058935A1 (en) 2004-06-11
KR100592357B1 (ko) 2006-06-22
EP2316486A3 (en) 2011-09-07
JP2009108100A (ja) 2009-05-21
CY1108960T1 (el) 2014-07-02
CZ20033208A3 (en) 2004-03-17
CA2443840C (en) 2010-10-26
SK14432003A3 (sk) 2004-07-07
AR037223A1 (es) 2004-11-03
DE60230868D1 (de) 2009-03-05
CL2009002199A1 (es) 2010-05-07
US7674462B2 (en) 2010-03-09
SG157951A1 (en) 2010-01-29
KR20040028744A (ko) 2004-04-03
IS6999A (is) 2003-10-24
MY150237A (en) 2013-12-31
ATE420659T1 (de) 2009-01-15
HUP0501113A2 (en) 2007-05-02
US8673303B2 (en) 2014-03-18
HUP0501113A3 (en) 2007-12-28
SI1390389T1 (sl) 2009-06-30
JP4307845B2 (ja) 2009-08-05
CA2715570A1 (en) 2002-11-07
EP1974749B1 (en) 2011-11-16
YU84903A (sh) 2006-05-25
NO20034805L (no) 2003-12-23
CA2443840A1 (en) 2002-11-07
NZ566268A (en) 2009-09-25
US20090285818A1 (en) 2009-11-19

Similar Documents

Publication Publication Date Title
US7888052B2 (en) Cripto blocking antibodies and uses thereof
EP1494693B1 (en) Cripto-specific antibodies
US7582299B2 (en) Cripto-specific antibodies
AU2007200809B2 (en) Cripto Blocking Antibodies and Uses Thereof
AU2002303364A1 (en) Cripto blocking antibodies and uses thereof
CA2480119C (en) Cripto-specific antibodies
HK1058935B (en) Cripto blocking antibodies and uses thereof
HK1122509A (en) Cripto blocking antibodies and uses thereof
AU2010202840A1 (en) Cripto Blocking Antibodies and Uses Thereof
NZ578287A (en) Cripto blocking antibodies and uses thereof
HK1155081A (en) Cripto blocking antibodies and uses thereof
ZA200606338B (en) Cripto blocking antibodies and uses thereof
HK1072381B (en) Cripto-specific antibodies

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: P-849/03

Country of ref document: YU

AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SD SE SG SI SK SL TJ TM TN TR TT TZ UA UG US UZ VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 10693538

Country of ref document: US

Ref document number: 2443840

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: PA/a/2003/009797

Country of ref document: MX

Ref document number: 373513

Country of ref document: PL

Ref document number: 1-2003-501076

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 2002585468

Country of ref document: JP

Ref document number: 2003/01846

Country of ref document: TR

Ref document number: 1020037014078

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 01888/DELNP/2003

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 200308862

Country of ref document: ZA

ENP Entry into the national phase

Ref document number: 10836302

Country of ref document: BG

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 14432003

Country of ref document: SK

WWE Wipo information: entry into national phase

Ref document number: 529710

Country of ref document: NZ

Ref document number: 2002731384

Country of ref document: EP

Ref document number: PV2003-3208

Country of ref document: CZ

WWE Wipo information: entry into national phase

Ref document number: 2002303364

Country of ref document: AU

Ref document number: 200301158

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 7196

Country of ref document: GE

Ref document number: 5415

Country of ref document: GE

WWE Wipo information: entry into national phase

Ref document number: 028128877

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 2002731384

Country of ref document: EP

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

WWP Wipo information: published in national office

Ref document number: PV2003-3208

Country of ref document: CZ

DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
ENP Entry into the national phase

Ref document number: PI0209254

Country of ref document: BR