WO2002066513A2 - Humane zirkulierende lekti fragmente hf7072, hf7638 und hf14448 sowie ihre verwendung - Google Patents

Humane zirkulierende lekti fragmente hf7072, hf7638 und hf14448 sowie ihre verwendung Download PDF

Info

Publication number
WO2002066513A2
WO2002066513A2 PCT/EP2002/001720 EP0201720W WO02066513A2 WO 2002066513 A2 WO2002066513 A2 WO 2002066513A2 EP 0201720 W EP0201720 W EP 0201720W WO 02066513 A2 WO02066513 A2 WO 02066513A2
Authority
WO
WIPO (PCT)
Prior art keywords
peptides
nucleic acids
chromatography
buffer
column
Prior art date
Application number
PCT/EP2002/001720
Other languages
English (en)
French (fr)
Other versions
WO2002066513A3 (de
Inventor
Michael Walden
Hans-Jürgen MÄGERT
Peter Kreutzmann
Harald John
Ludger STÄNDKER
Wolf-Georg Forssmann
Original Assignee
Ipf Pharmaceuticals Gmbh
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Ipf Pharmaceuticals Gmbh filed Critical Ipf Pharmaceuticals Gmbh
Publication of WO2002066513A2 publication Critical patent/WO2002066513A2/de
Publication of WO2002066513A3 publication Critical patent/WO2002066513A3/de

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/81—Protease inhibitors
    • C07K14/8107—Endopeptidase (E.C. 3.4.21-99) inhibitors
    • C07K14/811—Serine protease (E.C. 3.4.21) inhibitors
    • C07K14/8135—Kazal type inhibitors, e.g. pancreatic secretory inhibitor, ovomucoid
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Definitions

  • the present invention relates to polypeptides (protein substances) with serine proteinase inhibitory properties: human circulating LEKTI fragments HF7072, HF7638 and HF14448 and their use.
  • the peptides HF7072, HF7638 and HF14448 were isolated from human hemofiltrate using a biological assay. These polypeptides have a molecular mass of 7072 Da, 7638 Da and 14448 Da, respectively.
  • the amino acid sequences found correspond to fragments of the LEKTI protein (WO 00/78963 AI) containing 62, 68 and 133 amino acids.
  • the present invention describes the isolation and analysis of the LEKTI peptide fragments occurring in the circulation from blood filtrate.
  • a complete sequence analysis of the entire LEKTI protein was carried out by sequencing the associated cDNA [Magert, HJ. et al, J. Biol. Chem. 1999 Jul 30; 274 (31), 21499-502].
  • Serine proteinase inhibitors have been extensively described in terms of their structure at the protein and DNA sequence level and with regard to their biological function (for a review see: Roberts, RM et al. (1995), Crit. Rev. Eukaryot. Gene Expr. , 5, 385-436).
  • the peptides claimed here can be obtained by a purification process based on human hemofiltrate. This hemofiltrate was obtained in large quantities by ultrafiltration of the blood of patients with chronic kidney disease. These are naturally occurring fragments of the LEKTI protein.
  • the human hemofiltrate is diluted with water and acidified.
  • the pH is preferably 1.5 to 3.5.
  • the hemofiltrate is then passed over a cation exchanger, for example a carrier material which modifies with sulfonic acid groups (Fraktogel SP - 650 (M), Merck, Darmstadt).
  • the peptides bound to the cation exchanger are eluted with a relatively highly concentrated salt solution.
  • the ionic strength of the elution solution corresponds approximately to a 0.5 to 1 molar ammonium acetate solution.
  • the eluate collected is subjected to a further cation exchange chromatography.
  • This chromatography is preferably a step elution with buffers of increasing pH values.
  • fractions containing the claimed peptides are further purified by means of preparative reverse phase chromatography and subsequent semi-preparative reverse phase chromatography, for example on support materials modified with C18 and cation exchanger chromatography.
  • the purity is preferably checked by means of analytical reverse phase chromatography and capillary zone electrophoresis.
  • the structure of the purified substances HF7072, HF7638 and HF14448 has been elucidated.
  • the molecular masses of the native peptides were determined using an ESI mass spectrometer.
  • the sequence analysis was carried out via automated Edman degradation of the peptides using an ABI 473 A sequencer.
  • the invention therefore also relates to their biologically active fragments.
  • Biologically active means that the fragments according to the measurement method given in the examples have a maximum IC 50 value that is twice as high as the underlying complete peptides.
  • These are preferably derivatives in which the N or C terminal lacks one or more amino acids.
  • Such fragments preferably have no more than 10% deleted amino acids.
  • the invention further relates to those peptides in which individual amino acids are exchanged. These are preferably conservative exchanges, i.e. Amino acids with similar properties are replaced, for example alanine for serine, leucine for isoleucine, etc. Here too it is preferred that no more than 10% of the amino acids in the peptides are replaced.
  • individual amino acids can also be replaced by non-natural amino acids, i.e. by amino acids which carry further functional groups, for example hydroxyprolines, methylthreonines, homocysteine, etc. In this case too, preferably no more than 10% of the amino acids are modified accordingly.
  • the peptides can also carry derivatizations, for example glycosylated, amidated, acetylated, sulfated or phosphorylated.
  • the invention also relates to nucleic acids which code for the peptides according to the invention.
  • nucleic acids can be constructed from DNA, RNA, genomic DNA or PNA.
  • the invention further relates to a vector containing the nucleic acids and a genetically engineered host cells containing the vector according to the invention.
  • the invention also relates to nucleic acids which are complementary to the nucleic acids according to the invention. Fragments with a length of approximately 15 to 30 nucleic acids are particularly suitable as antisense molecules.
  • the invention further relates to antibodies which are directed against the peptides according to the invention and medicaments which contain peptides or nucleic acids.
  • the invention further comprises diagnostic agents which contain the antibodies according to the invention or the nucleic acids.
  • HF7072, HF7638 and HF14448 regulate the hydrolytic activity of serine proteinases such as e.g. Trypsin, and thus represent important human endogenous regulators of serine proteinases.
  • the claimed peptides can be administered parenterally, intravenously, intramuscularly, intranasally, locally topically or buccally in the manner customary for peptides. It can make sense to administer the claimed peptides bound to a suitable carrier.
  • the amount of peptide to be administered is 1 ⁇ g to 1 g per administration unit per day.
  • the claimed diagnostic agents contain poly- or monoclonal antibodies against the claimed peptides, optionally in a labeled form, for use in an ELISA or RIA.
  • the claimed diagnostic agents contain DNA, RNA and / or PNA, optionally in modified and / or labeled form for use in test systems known to those skilled in the art, such as e.g. PCR.
  • the diagnostic agents according to the invention are suitable for test systems for checking tissue, plasma, urine and cerebrospinal fluid levels of these substances, as markers for functional disorders of the muscles, the skin, the nervous system, the lymphatic organs, the gastrointestinal tract, the immune system and inflammatory and neoplastic processes as well as a marker in cancer.
  • the medicaments according to the invention are suitable for the treatment of acute or chronic skin diseases, cervical inflammation, inflammation of the Bartholin glands and other vaginal areas, tonsillitis, pharyngitis and laryngitis, acute or chronic inflammatory processes associated with excessive formation of mucus and resulting acute emergency situations, postoperative bleeding due to hyperfibrinolysis, for the prophylaxis of pulmonary emphysema in the absence of ⁇ l proteinase inhibitors, and for the therapy of asthma, AIDS, pneumonia, tumor disease and leukemia
  • the peptides according to the invention can be obtained in various ways, in particular by
  • the HF 7072 peptide has the amino acid sequence:
  • the HF7638 peptide has the amino acid sequence:
  • the HF 14448 peptide has the amino acid sequence:
  • Figure 1 shows the trypsin activity under the influence of different concentrations of the LEKTI domains.
  • Figure 2 shows the sequence of LEKTI.
  • hemofiltrate pH 2.7, conductivity 5.5 mS / cm
  • Elution buffer 0.5 M ammonium acetate
  • ammonium acetate eluates of the batch extraction are combined in amounts of 5,000 to 10,000 liters of hemofiltrate peptide.
  • the peptide extract is applied to the preparative cation exchanger with the addition of deionized water with a conductivity of 5.5 mS / cm.
  • the column is rinsed with 0.01 M HCl until the conductivity is below 1 mS / cm.
  • the elution is carried out in several stages using the buffers specified below: Buffer pH value buffer substances conductivity (mS / cm)
  • Elution buffer 2 4.5 0.1 M acetic acid + 0.1 M sodium acetate 4.0
  • Eluates 1-7 are referred to as pH pool I-VII. Elution takes place until a new baseline is reached, elution volumes of 10 to 25 L being achieved for the individual pH pools I to VII.
  • Step 3 Second preparative separation:
  • the individual pH pools are separated for fractionation and simultaneous desalination using a reverse phase chromatography
  • Pillar FineLine 100 (Pharmacia, Freiburg)
  • Buffer B 80% acetonitrile in 10 mM HCl
  • the column is rinsed with buffer A. Fractions of 200 ml are collected during the elution. The fractions are freeze-dried and stored at -20 ° C. Aliquots of the fractions are tested in the trypsin inhibitor bioassay. Fraction 18 from pH pool III received the claimed substances.
  • Step 4 Semi-preparative reverse phase C18 chromatography:
  • Buffer B 10 mM HCl, 80% acetonitrile
  • Step 5 Semi-preparative reverse phase C18 chromatography
  • Fractions 11-12 contained the substances according to the invention.
  • Chroma topography conditions are Chroma topography conditions
  • Buffer B 10 mM HCl, 100% MeOH
  • Step 6 Semi-preparative reversal phase C18 chromatography
  • Fraction 30 contained the substances according to the invention.
  • Buffer B 0.1% TFA, 80% acetonitrile
  • Fraction 24 contained the substance according to the invention.
  • Fraction 40 contained the substance according to the invention in highly pure form.
  • Buffer A 0.1% TFA
  • Buffer B 0.1% TFA, 80% acetonitrile
  • Buffer A 50 mM NaH 2 PO 4 , pH: 3.5
  • Buffer B 50 mM NaH 2 PO 4 + 1.5 M NaCl, pH: 3.5
  • Fractions 33 and 34 contained the substance HF7638 according to the invention in highly pure form.
  • Buffer B 0.1% TFA, 80% acetonitrile
  • Fraction 36 contained the substance HF14448 in highly pure form.
  • Buffer A 0.1% TFA
  • Buffer B 0.1% TFA, 80% acetonitrile
  • the purified native peptides and fragments obtained by cleavage with GLU-C were analyzed by Edman degradation on an ABI 473 A sequencer.
  • the samples are applied to a BioPren membrane in amounts between 10 and 100 prol.
  • the following N-terminal sequences resulted:
  • the peptides were isolated on the basis of their biological activity, namely the inhibition of the serine proteinase trypsin. For this purpose, fraction aliquots of the individual chromatography steps described were freeze-dried and then fed to the enzyme substrate assay. The assay measures that Activity or the inhibition of trypsin in reaction with a substrate which releases a dye (p-nitroanilide) when trypsin is hydrolysed. This dye is detected photometrically at 405 nm.
  • the IC 50 values were determined to characterize the trypsin inhibitory activity of the LEKTI domains.
  • the determination of the IC 50 values of the inhibitors and the analysis of their effect on other proteinases were carried out in a single measurement in a cuvette.
  • the IC 50 value denotes the concentration of an inhibitor at which the activity of an enzyme is 50% inhibited.
  • the measurements were carried out in a total volume of 100 ⁇ l in a micro quartz cuvette (type 104F-QS, 10 mm layer thickness, Hellma, Müllheim, D).
  • a "DU 640" from Beckman (Munich, D) with a temperature-controlled cuvette holder in conjunction with a "MultiTempII” thermostat from Pharmacia (Freiburg, D) served as the spectrophotometer. All activity determinations were carried out at 405 nm and 25 ° C.
  • the concentrations of trypsin (2 ⁇ g / ml) and substrate (N ⁇ -benzoyl-L-arginine p-nitroanilide (L-BAPNA), 200 ⁇ g / ml) were kept constant while the concentrations of the LEKTI domains varied.
  • the reaction was started by adding the enzyme. The absorption was measured over 3-10 min with different proteinase and inhibitor concentrations. The increase in extinction per unit of time ( ⁇ E / ⁇ t) for the individual measurements was then calculated from these values. For the graphic representation, ⁇ E / ⁇ t was given as the percentage enzyme activity, the quotient of the measurements without addition of inhibitor representing an activity of 100% (FIG. 1).

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Peptide HF7072, HF7638 oder HF14448 sowie deren biologisch aktive Fragmente, Analoga und/oder Derivate.

Description

Humane zirkulierende LEKTI Fragmente HF7072, HF7638 und HF14448 sowie ihre Verwendung
Gegenstand der vorliegenden Erfindung sind Polypeptide (Eiweißstoffe) mit Serin-Proteinase-inhibitorischen Eigenschaften: Humane zirkulierende LEKTI Fragmente HF7072, HF7638 und HF14448 sowie ihre Verwendung.
Die Peptide HF7072, HF7638 und HF14448 konnten mit Hilfe eines biologischen Assays aus humanem Hämofiltrat isoliert werden. Diese Polypeptide besitzen eine Molekularmasse von 7072 Da, 7638 Da bzw. 14448 Da. Die gefundenen Aminosäuresequenzen entsprechen Fragmenten des LEKTI Proteins (WO 00/78963 AI) enthaltend 62, 68 bzw. 133 Aminosäuren.
Die vorliegende Erfindung beschreibt die Isolierung und Analyse der in der Zirkulation vorkommenden LEKTI Peptid-Fragmente aus Blutfiltrat. Eine vollständige Sequenzanalyse des gesamten LEKTI Proteins erfolgte durch Sequenzierung der dazugehörigen cDNA [Magert, HJ. et al, J. Biol. Chem. 1999 Jul 30; 274(31), 21499-502].
Serin-Proteinase-Inhibitoren wurden in ihrer Struktur auf Protein- und DNA- Sequenzebene und bezüglich ihrer biologischen Funktion schon umfangreich beschrieben (als Review siehe: Roberts, R.M. et al. (1995), Crit. Rev. Eukary- ot. Gene Expr., 5, 385-436).
Die hier beanspruchten Peptide sind durch ein Reinigungsverfahren ausgehend von humanem Hämofiltrat erhältlich. Dieses Hämofiltrat wurde durch Ultrafiltration des Blutes von chronisch nierenkranken Patienten in großen Mengen gewonnen. Es handelt sich um natürlich vorkommende Fragmente des LEKTI- Proteins.
Für die Präparation von Peptiden wird das humane Hämofiltrat dabei mit Wasser verdünnt und angesäuert. Der pH-Wert beträgt vorzugsweise 1,5 bis 3,5. Danach wird das Hämofiltrat über einen Kationenaustauscher geleitet, beispielsweise einem mit Sulfonsäuregruppen modifizierenden Trägermaterial (Fraktogel SP - 650 (M), Merck, Darmstadt). Die an den Kationenaustauscher gebundenen Peptide werden mit einer relativ hoch konzentrierten Salzlösung eluiert. Die Ionenstärke der Elutionslösung entspricht dabei ungefähr einer 0,5 bis 1 molaren Ammoniumacetatlösung.
Das aufgefangene Eluat wird einer weiteren Kationenaustauscher- Chromatographie unterzogen. Diese Chromatographie ist vorzugsweise eine Stufenelution mit Puffern von ansteigenden pH-Werten.
Die die beanspruchten Peptide enthaltenden Fraktionen werden mittels prä- parativer Umkehrphasen-Chromatographie und nachfolgender semipräparati- ver Umkehrphasen-Chromatographie beispielsweise an mit C18 modifizierten Trägermaterialien und Kationenaustauscher-Chromatographie weitergereinigt. Die Reinheit wird vorzugsweise mittels analytischer Umkehrphasen- Chromatographie und Kapillarzonen-Elektrophorese überprüft.
Die Struktur der gereinigten Substanzen HF7072, HF7638 und HF14448 wurde aufgeklärt. Die Bestimmung der Molekülmassen der nativen Peptide erfolgte mittels eines ESI-Massenspektrometers. Die Sequenzanalyse erfolgte über automatisierten Edman-Abbau der Peptide mit einem ABI 473 A Sequenzer.
Neben der gentechnischen Herstellung der Peptide ist auch die aufbauende Totalsynthese an üblichen Festphasen im Sinne der Merrifield-Synthese oder einer Flüssigphasensynthese möglich. Die Synthesestrategie und der Aufbau der Peptide und von ihnen abgeleiteten Derivaten mit den entsprechend geschützten Aminosäuren sind dem Fachmann bekannt.
Gegenstand der Erfindung sind daher neben den beschriebenen Peptiden auch deren biologisch aktive Fragmente. Biologisch aktiv bedeutet, dass die Frag- mente gemäß dem in den Beispielen angegebenen Messverfahren einen maximal doppelt so hohen IC50-Wert aufweisen wie die zugrundeliegenden kompletten Peptide. Bevorzugt handelt es sich um Derivate, bei dem N- oder C- Terminal ein oder mehrere Aminosäuren fehlen. Es können jedoch auch Ami- nosäuren aus der Sequenz deletiert sein. Solche Fragmente weisen bevorzugt nicht mehr als 10% deletierte Aminosäuren auf.
Gegenstand der Erfindung sind weiterhin solche Peptide, bei denen einzelne Aminosäuren ausgetauscht sind. Bevorzugt handelt es sich dabei um konser- vative Austausche, d.h. Aminosäuren mit ähnlichen Eigenschaften werden ersetzt, beispielweise Alanin gegen Serin, Leucin gegen Isoleucin, etc. Auch hier sind bevorzugt, dass nicht mehr als 10% der Aminosäuren in den Peptiden ersetzt werden.
Darüber hinaus können auch einzelne Aminosäuren durch nicht-natürliche Aminosäuren ersetzt sein, d.h. durch Aminosäuren, die weitere funktionelle Gruppen tragen, beispielsweise Hydroxyproline, Methylthreonine, Homocystei- ne, etc. Auch in diesem Fall sind bevorzugt nicht mehr als 10% der Aminosäuren entsprechend modifiziert. Weiterhin können die Peptide Derivatisierun- gen tragen, beispielsweise glycosiliert, amidiert, acetyliert, sulfatiert oder phosphoryliert sein.
Gegenstand der Erfindung sind auch Nukleinsäuren, die für die erfindungsgemäßen Peptide kodieren. Diese Nukleinsäuren können aus DNA, RNA, genomischer DNA oder PNA aufgebaut sein.
Gegenstand der Erfindung ist weiterhin ein Vektor enthaltend die Nukleinsäu- ren sowie eine gentechnisch manipulierte Wirtszellen enthaltend den erfindungsgemäßen Vektor.
Auch Nukleinsäuren, die komplementär zur erfindungsgemäßen Nukleinsäuren sind, sind Gegenstand der Erfindung. Insbesondere Fragmente mit einer Länge von etwa 15 bis 30 Nukleinsäuren eignen sich als antisense Moleküle.
Gegenstand der Erfindung sind weiterhin Antikörper, die gegen die erfindungsgemäßen Peptide gerichtet sind sowie Arzneimittel, die Peptide oder Nukleinsäuren enthalten. Weiterhin umfasst die Erfindung Diagnostikmittel, die die erfindungsgemäßen Antikörper oder die Nukleinsäuren enthalten.
Die beanspruchten Peptide allein, sowie ihre cDNA, ihr Gen und Analoga, Fragmente und Derivate der Peptide, der cDNA und dem Gen sowie Antikör- per, welche die Wirkung von HF7072, HF7638 oder HF14448 verstärken oder aufheben, können als Arzneimittel Verwendung finden. Ihre biologischen Aktivitäten entsprechen der anderer Serin-Proteinase-Inhibitoren, ähnlich der Kazal-Typ Inhibitoren [Kazal, LA. et al., (1948) 3. Am. Chem. Soc, 7O; 3034- 3040]. HF7072, HF7638 und HF14448 regulieren die hydrolytische Aktivität von Serin-Proteinasen wie z.B. Trypsin, und stellen somit wichtige humane endogene Regulatoren von Serin-Proteinasen dar.
Die beanspruchten Peptide können dabei in für Peptide üblicher Weise paren- teral, intravenös, intramuskulär, intranasal, lokal-topisch oder bukal verabreicht werden. Dabei kann es sinnvoll sein, die beanspruchten Peptide gebun- den an einen geeigneten Carrier zu verabreichen. Die Menge an zu verabreichendem Peptid beträgt lμg bis 1 g pro Darreichungseinheit pro Tag.
Die beanspruchten Diagnostikmittel enthalten poly- oder monoklonale Antikörper gegen die beanspruchten Peptide gegebenenfalls markierter Form, um in einem ELISA oder RIA eingesetzt zu werden. Die beanspruchten Diagnostik- mittel enthalten DNA, RNA und/oder PNA gegebenenfalls in modifizierter und/oder markierter Form zum Einsatz in dem Fachmann bekannten Testsystemen wie z.B. PCR.
Die erfindungsgemäßen Diagnostikmittel eignen sich für Testsysteme zur Kontrolle von Gewebe-, Plasma-, Urin- und Liquor cerebrospinalis-Spiegeln dieser Substanzen, als Marker für Funktionsstörungen der Muskeln, der Haut, des Nervensystems, der Lymphorgane, des Magen-Darmtraktes, des Immunsystems sowie inflammatorischen und neoplastischen Prozessen sowie als Marker bei Krebs. Die erfindungsgemäßen Arzneimitteln eignen sich zur Behandlung von akuten oder chronischen Hautkrankheiten, Cervixentzündungen, Entzündungen der Bartholinischen Drüsen und anderer vaginaler Bereiche, Tonsillitis, Pharyngitis und Laryngitis, mit exzessiver Schleimbildung verbundener akut oder chro- nisch entzündlicher Prozesse und sich daraus ergebener akuter Notsituationen, postoperativen Blutungen aufgrund Hyperfibrinolyse, zur Prophylaxe der Lun- genemphysembildung bei αl-Proteinase-Inhibitormangel, sowie zur Therapie von Asthma, AIDS, Lungenentzündung, Tumorerkrankung und Leukämie
Die erfindungsgemäßen Peptide können auf verschiedenen Wegen erhalten werden, insbesondere durch
- Extraktion von Hämofiltrat durch Kationenaustauscher-Extraktion mit nachfolgender Elution der adsorbierten Substanzen, eine erneute Kationenaustauscher-Chromatographie des die Peptide enthaltenden Extraktes sowie mehrstufige Umkehrphasen-Chromatographie
oder
- durch Festphasensynthese im Sinne der Merrifield-Synthese sowie Flüssig- phasensynthese nach dem Fachmann bekannten Methoden mit geschützten Aminosäuren und deren Aufreinigung
oder
- durch heterologe Expression mittels gängiger biotechnologischer Vektoren.
Sequenzen der isolierten Peptide:
Das Peptid HF 7072 hat die Aminosäuresequenz:
EIVKLCSQYQNQAKNGILFCTRENDPIRGPDGKMHGNLCSMCQAYFQAENEEKKKAEA RARN Das Peptid HF7638 hat die Aminosäuresequenz:
ESGKATSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEEE KKKKEGESRN
Das Peptid HF 14448 hat die Aminosäuresequenz:
HLARAPKATAPTELNCDDFKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKT GSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAM CAELFLKEAENAKREGET
Figur 1 zeigt die Trypsinaktivität unter Einfluss verschiedener Konzentrationen der LEKTI-Domänen.
Figur 2 zeigt die Sequenz von LEKTI.
Die Erfindung wird anhand der folgenden Beispiele näher beschrieben :
Beispiel 1
Chromatographische Isolierung
1. Schritt: Hämofiltrat-Batch-Extraktion
800 bis 1.000 L Hämofiltrat werden mit Salzsäure auf einen pH-Wert von 2,7 eingestellt und mit Wasser auf eine Leitfähigkeit von 5,5 mS/cm verdünnt und mit einer Flussrate von 3 L/min auf einen starken Kationenaustauscher aufgetragen.
Chromatographiebedingungen:
Säule: Vantage VA 250 (Amicon, Witten)
Säulenmaterial: Fractogel TSK SP 650 (M) , 25 cm x 20 cm
Fluss: 3 L/min
Detektion : 280 nm
Auftrag: Hämofiltrat (pH 2,7, Leitfähigkeit 5,5 mS/cm) Elutions-Puffer: 0,5 M Ammoniumacetat
Anlage: Autopilot Chromatographiesystem, (PerSeptive Biosystems)
Nach Auftrag der insgesamt 1.000 L Flüssigkeit wird mit mehreren Säulenvolumina 5 mM HCI gespült. Die Elution der gebundenen Peptide erfolgt als Batch-Elution mit 0,5 M Ammoniumacetat. Hierbei wird eine komplette Elution der Peptide über steigenden pH-Wert (6.8 - 7.2) und steigende Leitfähigkeit in etwa 5 L Eluat erreicht.
2. Schritt: Erste präparative Auftrennunq
Die Ammoniumacetat-Eluate der Batch-Extraktion werden in Mengen von 5.000 bis 10.000 L Hämofiltrat-Peptid vereinigt. Nach pH-Einstellung auf 2,7 wird das Peptidextrakt unter Zumischung von deionisiertem Wasser mit einer Leitfähigkeit von 5.5 mS/cm auf den präparativen Kationenaustauscher aufgetragen.
Chromatographiebedingungen:
Säule: Vantage 250 VA
Säulenmaterial: Fractogel TSK SP 650 (M) , 25 cm x 20 cm
Fluss: bis zu 3 L/min. während des Auftrages 0,5 bis 1 L/min während der Elution
Detektion: 280 nm, pH, Leitfähigkeit Probe: Hämofiltrat (pH 2,7, Leitfähigkeit 5,5 mS/cm)
Anlage: Autopilot Chromatographiesystem, (PerSeptive Biosystems)
Nach Auftrag des Rohextraktes über 240 min wird die Säule mit 0,01 M HCI gespült, bis die Leitfähigkeit unter 1 mS/cm ist. Die Elution erfolgt dabei in mehreren Stufen mit den im folgenden angegebenen Puffern: Puffer pH-Wert Puffersubstanzen Leitfähigkeit (mS/cm)
Waschpuffer 2,0 0,01 M HCI 1
Elutionspuffer 1 3,6 0,1 M Zitronensäure-1-Hydrat 2.9
Elutionspuffer 2 4,5 0,1 M Essigsäure + 0,1 M Natriumacetat 4.0
Elutionspuffer 3 5,0 0,1 M Äpfelsäure 6.2
Elutionspuffer 4 5,6 0,1 M Bernsteinsäure 6.1
Elutionspuffer 5' 6,6 0,1 M NaH2PO4 4.9
Elutionspuffer 6 7,4 0,1 M NaH2PO4 6.7
Elutionspuffer 7 9,0 0,1 M Ammoniumcarbonat 6.7
Waschschritt Wasser <1
Die Eluate 1-7 werden als pH-Pool I-VII bezeichnet. Die Elution erfolgt bis zum Erreichen einer neuen Basislinie, wobei für die einzelnen pH-Pools I bis VII Elutionsvolumina von 10 bis 25 L erreicht werden.
3. Schritt: Zweite präparative Auftrennung:
Die einzelnen pH-Pools werden zur Fraktionierung und gleichzeitigen Entsalzung über eine Umkehrphasen Chromatographie getrennt
Chromatographiebedingungen :
Säule: FineLine 100 (Pharmacia, Freiburg)
Säulenmaterial: Source RPC, 15 μm
10 cm x 12,5 cm
Fluss: 150 mL/min
Detektion : 280 nm, 214 nm
Puffer A: 10 mM HCI
Puffer B: 80% Acetonitril in 10 mM HCI
Gradient: 0-60% Puffer B in 5 Säulenvolumen
Chromatographieanlage: BioCad 250, (Perseptive Biosystems)
Nach Auftrag der pH-Pools wird die Säule mit Puffer A gespült. Während der Elution werden Fraktionen zu 200 ml gesammelt. Die Fraktionen werden ge- friergetrocknet und bei -20°C gelagert. Aliquots der Fraktionen werden im Trypsin-Inhibitor-Bioassay getestet. Die Fraktion 18 aus dem pH-Pool III erhielt die beanspruchten Substanzen.
4. Schritt: Semipräparative Umkehrphase C18-Chromatographie:
Die im Bioassay aktive Fraktion 18 aus pH-Pool III wurde über eine semipräparative Umkehrphase Säule aufgetrennt. Die Fraktionen 16-17 enthielten die erfindungsgemäßen Substanzen.
Chrom a tographiebedingungen :
Säule: 4,7 cm x 30 cm, Kartuschensystem Füllmaterial: Bakerbond-C18, 15-30 μm
Puffer A: 10 mM HCI
Puffer B: 10 mM HCI, 80% Acetonitril
Gradient: 5-45% B in 47.5 min
Fluss: 40 ml/min Detektion: 214 nm, 280 nm
Chromatographieanlage: BioCad 250, (Perseptive Biosystems)
Fraktionen : ä 50 ml ab Start des Gradienten
5. Schritt: Semipräparative Umkehrphase C18-Chromatographie
Die aktiven Fraktionen 16-17 aus der vorhergehenden Chromatographie wur- den über eine semipräparative Umkehrphase Säule aufgetrennt. Die Fraktionen 11-12 enthielten die erfindungsgemäßen Substanzen.
Chroma tographiebedingungen :
Säule: 4,7 cm x 30 cm Stahlsäule
Füllmaterial : Vγdac C-18, 15-30 μm Puffer A: 10 mM HCI, 30% MeOH
Puffer B: 10 mM HCI, 100% MeOH
Gradient: 5-50% B in 63,3 min Fluss: 30 ml/min
Detektion: 214 nm, 280 nm
Chromatographieanlage: BioCad 250, (Perseptive Biosystems) Fraktionen: ä 50 ml ab Start des Gradienten
6. Schritt: Semipräparative Umkehrphase C18-Chromatoqraphie
Die aktiven Fraktionen 11-12 aus der vorhergehenden Chromatographie wurden über eine semipräparative Umkehrphase Säule aufgetrennt. Die Fraktion 30 enthielt die erfindungsgemäßen Substanzen.
Chromatographiebedingungen :
Säule: 2 cm x 25 cm Stahlsäule
Füllmaterial: Biotek Silica C4, 5 μm, 100 A
Puffer A: 0,1% TFA
Puffer B: 0,1% TFA, 80% Acetonitril
Gradient: 25-55% B in 60 min Fluss: 7 ml/min
Detektion: 214 nm, 280 nm
Chromatographieanlage: Kontron 422 S
Fraktionen: ä 7 ml ab Start des Gradienten
Isolierung von HF7072
7a. Schritt: Analytische Größenausschluss-Chromatographie:
1/10 der aktiven Fraktion 30 aus der vorhergehenden Chromatographie wurde über eine analytische Gelfiltrations-Säule aufgetrennt. Die Fraktion 24 enthielt die erfindungsgemäße Substanz.
Chromatographiebedingungen :
Säule: 7.8 mm x 300 mm Stahlsäule
Füllmaterial: TosoHaas TSKgel G 3000 PWXL, 6 μm Puffer: 0.1% TFA, 45% Acetonitril
Gradient: isokratisch
Fluss: 300 μl/min
Detektion: 214 / 280 nm Chromatographieanlage: Kontron
Fraktionen: ä 300 μl ab Start
8a. Schritt: Analytische Umkehrphase C18-Chromatographie
Die aktive Fraktion 24 aus der vorhergehenden Chromatographie wurde über eine analytische Umkehrphase Säule aufgetrennt. Die Fraktion 40 enthielt die erfindungsgemäße Substanz in hochreiner Form.
Chromatographiebedingungen :
Säule: 4.7 mm x 250 mm Stahlsäule
Füllmaterial : Dr. Maisch ReproSil-Pur C18-AQ, 5 μm
Puffer A: 0.1% TFA Puffer B: 0.1% TFA, 80% Acetonitril
Gradient: 20 - 50% B in 60 min
Fluss: 700 μl/min
Detektion: 214/280 nm
Chromatographieanlage: Kontron Fraktionen: ä 700 μ ab Start des Gradienten
Isolierung von HF7638 und HF14448
7b. Schritt: Analytische Kationenaustauscher-Chromatographie:
Die aktiven Fraktionen 25-29 aus der vorhergehenden Chromatographie 6 wurden über eine analytische Kationenaustauscher Säule aufgetrennt. Die Fraktionen 41-43 enthielten die erfindungsgemäßen Substanzen. Chromatographiebedingungen:
Säule: 10 mm x 125 mm Stahlsäule
Füllmaterial: Biotek PepKat 1000/7
Puffer A: 50 mM NaH2PO4, pH : 3,5
Puffer B: 50 mM NaH2PO4 + 1,5 M NaCI, pH: 3,5
Gradient: 0-70% B in 70 min
Fluss: 1,75 ml/min
Detektion : 214 nm
Chromatographieanlage: Kontron 422 S Fraktionen: ä 1,75 ml ab Start
Isolierung von HF7638
8b. Schritt: Analytische Umkehrphase C18-Chromatographie
Die aktiven Fraktionen 41-43 aus der Chromatographie 7b wurden über eine analytische Umkehrphase Säule aufgetrennt. Die Fraktionen 33 und 34 ent- hielten die erfindungsgemäße Substanz HF7638 in hochreiner Form.
Chromatographiebedingungen :
Säule: 4.7 mm x 250 mm Stahlsäule
Füllmaterial: ReproSil-Pur C18-AQ, 5 μm (Dr. Maisch)
Puffer A: 0.1% TFA
Puffer B: 0.1% TFA, 80% Acetonitril
Gradient: 20 - 50% B in 60 min
Fluss: 700 μl/min
Detektion : 214/280 nm
Chromatographieanlage: Kontron
Fraktionen: ä 700 μl ab Start des Gradienten Isolierung von HF 14448
8c. Schritt: Analytische Umkehrphase C18-Chromatoqraphie:
Die aktiven Fraktionen 41-43 aus der Chromatographie 7b wurden über eine analytische Umkehrphasen Säule aufgetrennt. Die Fraktion 36 enthielt die erfindungsgemäße Substanz HF14448 in hochreiner Form.
Chromatographiebedingungen :
Säule: 4.7 mm x 250 mm Stahlsäule
Füllmaterial : ReproSil-Pur C18-AQ, 5 μm (Dr. Maisch)
Puffer A: 0,1% TFA Puffer B: 0,1% TFA, 80% Acetonitril
Gradient: 20 - 50% B in 60 min
Fluss: 700 μl/min
Detektion: 214nm, 280 nm
Chromatographieanlage: Kontron 422 S Fraktionen: ä 700 μl ab Start des Gradienten
Massenbestimmungen
Alle Massenbestimmungen wurden auf einem ESI-Massenspektrometer durchgeführt. Folgende Molekülmassen von HF7638 und HF14448 wurden bestimmt:
HF7072 - natives Peptid
Kettenlänge 62 Aminosäuren: 7072 Da
HF7638 - natives Peptid - Kettenlänge 68 Aminosäuren: 7638 Da
HF14448 - natives Peptid - Kettenlänge 133 Aminosäuren: 14448 Da Aminosäure-Sequenzbestimmung
Die aufgereinigten nativen Peptide, sowie durch Spaltung mit GLU-C erhaltene Fragmente, wurden mittels Edman-Abbau auf einem ABI 473 A Sequenzer analysiert. Die Proben werden auf eine BioPren-Membran in Mengen zwischen 10 und 100 prnol aufgetragen. In Übereinstimmung mit den Ergebnissen der Massenbestimmungen ergaben sich folgende N-terminale Sequenzen :
HF 7072:
Aminosäuren EIVKLCSQYQNQNQAKNGILFCTREN ...
Außerdem folgende chymotryptischen Fragmente:
-CTRENDPIRGPD -HGNLCSMCQAY
HF7638: ESGKATSYAELCSEYRKLVRNGKLACTRENDPI...
HF 14448:
HLARAPKATAPTELNCDDFKKGERDGDFICP...
Außerdem folgende durch Gln-C erhaltende Fragmente:
-AVCGTDGKTYDNRCALCAE
-NDPVLGPDGKTHGNKCAMCAE
Bestimmung der biologischen Aktivitäten der isolierten Peptide:
Die Isolierung der Peptide erfolgte anhand ihrer biologischen Aktivität, nämlich der Inhibition der Serin-Proteinase Trypsin. Dazu wurden jeweils Fraktions- Aliquots der beschriebenen einzelnen Chromatographiestufen gefriergetrocknet und anschließend dem Enzym -Substrat- Assay zugeführt. Der Assay mißt die Aktivität bzw. die Inhibierung von Trypsin in Reaktion mit einem Substrat, welches bei erfolgter Hydrolyse durch Trypsin einen Farbstoff (p-Nitroanilid) freisetzt. Dieser Farbstoff wird bei 405 nm photometrisch detektiert.
Inhibitorische Aktivität von HF 7072, HF 7638 und HF 14448
Zur Charakterisierung der Trypsin-inhibitorischen Aktivität der LEKTI-Domänen wurden die IC50-Wen_e bestimmt.
Die Bestimmungen der IC50-Werte der Inhibitoren sowie die Analyse ihrer Wirkung auf andere Proteinasen wurden in Einzelmessung in einer Küvette durchgeführt. Der IC50-Wert bezeichnet die Konzentration eines Inhibitors, bei dem die Aktivität eines Enzyms zu 50% gehemmt ist. Die Messungen fanden in einem Gesamtvolumen von 100 μl in einer Mikro-Quarzküvette (Typ 104F-QS, 10 mm Schichtdicke, Hellma, Müllheim, D) statt. Als Spektralphotometer diente ein "DU 640" der Firma Beckman (München, D) mit temperierbarem Küvettenhalter in Verbindung mit einem "MultiTempII"-Thermostat der Firma Pharmacia (Freiburg, D). Alle Aktivitätsbestimmungen wurden bei 405 nm und 25°C durchgeführt. Die Konzentrationen von Trypsin (2 μg/ml) und Substrat (Nα-Benzoyl-L-Arginin p-Nitroanilid (L-BAPNA), 200 μg/ml) wurden konstant gehalten, während die Konzentrationen der LEKTI-Domänen variierten. Die Reaktion wurde durch Zugabe des Enzyms gestartet. Es erfolgte eine Messung der Absorption über 3-10 min mit unterschiedlichen Proteinase- und Inhibitorkonzentrationen. Aus diesen Werten wurde dann die Extinktionszunahme je Zeiteinheit (ΔE/Δt) für die einzelnen Messungen berechnet. Zur graphischen Darstellung wurde ΔE/Δt als prozentuale Enzymaktivität angegeben, wobei der Quotient der Messungen ohne Inhibitorzusatz eine Aktivität von 100% darstellt (Figur 1).
Die Messungen ergaben folgende IC50-Werte bei einer Trypsin-Konzentration von 2 μg/ml: HF 7638 =- 35 nM
HF 7072 = 45 nM
HF 14448 = 110 nM
Sequenz HF 7072 (5. LEKTI-Domäne) Seq. ID Nr. 1: EIVKLCSQYQNQAKNGILFCTRENDPIRGPDGKMHGNLCSMCQAYFQAENEEKKKAEA RARN
Sequenz HF 7638 (6. LEKTI-Domäne mit Aminosäureaustausch N-S in Pos. 13) Seq. ID Nr. 2:
ESGKATSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEEE KKKKEGESRN
Sequenz HF 14448 (Gebildet aus der 2. und 3. LEKTI-Domäne) Seq. ID Nr. 3: HLARAPKATAPTELNCDDFKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKT GSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAM CAELFLKEAENAKREGET

Claims

Patentansprüche
1. Peptide HF7072, HF7638 oder HF14448 sowie deren biologisch aktive Fragmente, Analoga und/oder Derivate.
2. Peptide gemäß Anspruch 1, dadurch gekennzeichnet, dass die Derivate Peptide mit einem Austausch einzelner Aminosäuren sowie glykosylierte, amidierte, acetylierte, sulfatierte, phosphorylierte sowie durch multiple Synthese darstellbare Peptide sind.
3. Nukleinsäuren kodierend für die Peptide nach Anspruch 1.
4. Nukleinsäuren nach Anspruch 3, dadurch gekennzeichnet, dass die Nuk- leinsäuren aus DNA, RNA, genomischer DNA, PNA aufgebaut ist.
5. Ein Vektor enthaltend die Nukleinsäure gemäß Anspruch 3 oder 4.
6. Eine gentechnisch manipulierte Wirtszelle enthaltend den Vektor nach Anspruch 5.
7. Nukleinsäuren, dadurch gekennzeichnet, dass sie komplementär zur Nuk- leinsäuren gemäß Anspruch 3 sind.
8. Antikörper gerichtet gegen die Peptide gemäß Anspruch 1.
9. Arzneimittel enthaltend die Peptide gemäß Anspruch 1 und/oder 2 gegebenenfalls mit weiteren Hilfsstoffen.
10. Arzneimittel enthaltend Nukleinsäuren nach Anspruch 3 oder 7.
11. Verfahren zur Herstellung der Peptide gemäß Anspruch 1 durch
- Extraktion von Hämofiltrat durch Kationenaustauscher-Extraktion mit nachfolgender Elution der adsorbierten Substanzen, eine erneute Kationenaustauscher-Chromatographie des die Peptide enthaltenden Extraktes sowie mehrstufige Umkehrphasen-Chromatographie oder
- durch Festphasensynthese im Sinne der Merrifield-Synthese sowie Flüs- sigphasensynthese nach dem Fachmann bekannten Methoden mit geschützten Aminosäuren und deren Aufreinigung
oder
- durch heterologen Expression mittels gängiger biotechnologischer Vektoren.
12. Diagnostikmittel enthaltend die Antikörper gemäß Anspruch 8 und/oder Nukleinsäuren gemäß Anspruch 3 oder 7.
13. Verwendung der Diagnostikmittel nach Anspruch 12 für Testsysteme zur Kontrolle von Gewebe-, Plasma-, Urin- und Liquor cerebrospinalis- Konzentrationen dieser Substanzen, als Marker für Funktionsstörungen der Muskeln, der Haut, des Nervensystems, der Lymphorgane, des Magen- Darmtraktes, des Immunsystems sowie inflammatorischen und neoplasti- sehen Prozessen sowie als Marker bei Krebs.
14. Verwendung der Arzneimittel nach Anspruch 9 oder 10 zur Behandlung von akuten oder chronischen Hautkrankheiten, Cervixentzündungen, Entzündungen der Bartholinischen Drüsen und anderer vaginaler Bereiche, Tonsil- litis, Pharyngitis und Laryngitis, mit exzessiver Schleimbildung verbundener akut oder chronisch entzündlicher Prozesse und sich daraus ergebener a- kuter Notsituationen, postoperativen Blutungen aufgrund Hyperfibrinolyse, zur Prophylaxe der Lungenemphysembildung bei αl-Proteinase- Inhibitormangel, sowie zur Therapie von Asthma, AIDS, Lungenentzündung, Tumorerkrankung und Leukämie.
PCT/EP2002/001720 2001-02-19 2002-02-19 Humane zirkulierende lekti fragmente hf7072, hf7638 und hf14448 sowie ihre verwendung WO2002066513A2 (de)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DE10107997.4 2001-02-19
DE10107997 2001-02-19

Publications (2)

Publication Number Publication Date
WO2002066513A2 true WO2002066513A2 (de) 2002-08-29
WO2002066513A3 WO2002066513A3 (de) 2003-04-03

Family

ID=7674767

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2002/001720 WO2002066513A2 (de) 2001-02-19 2002-02-19 Humane zirkulierende lekti fragmente hf7072, hf7638 und hf14448 sowie ihre verwendung

Country Status (1)

Country Link
WO (1) WO2002066513A2 (de)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003070953A1 (de) * 2002-02-22 2003-08-28 Ipf Pharmaceuticals Gmbh Verbindung zur inhibierung der serin-proteinasen und zur inhibierung von infektionen oder virusvermehrung: rld 8564
WO2010097066A1 (de) 2009-02-27 2010-09-02 Universitätsklinikum Schleswig-Holstein Serinprotease-inhibitoren zur spezifischen inhibition von gewebs-kallikreinen
WO2018232300A1 (en) * 2017-06-16 2018-12-20 Azitra Inc Compositions and methods for treatment of netherton syndrome with lekti expressing recombinant microbes
WO2021198176A1 (en) 2020-03-31 2021-10-07 Pharis Biotec Gmbh Polypeptide for the prophylaxis and treatment of viral infections

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999033974A1 (de) * 1997-12-23 1999-07-08 Forssmann Wolf Georg Serin-proteinase-inhibitoren
WO2000078963A1 (de) * 1999-06-22 2000-12-28 Forssmann, Wolf-Georg Serin-proteinase-inhibitoren
WO2001064747A1 (en) * 2000-03-02 2001-09-07 Isis Innovation Limited Mutations in spink5 responsible for netherton's syndrome and atopic diseases

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1999033974A1 (de) * 1997-12-23 1999-07-08 Forssmann Wolf Georg Serin-proteinase-inhibitoren
WO2000078963A1 (de) * 1999-06-22 2000-12-28 Forssmann, Wolf-Georg Serin-proteinase-inhibitoren
WO2001064747A1 (en) * 2000-03-02 2001-09-07 Isis Innovation Limited Mutations in spink5 responsible for netherton's syndrome and atopic diseases

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
M[GERT H J ET AL: "LEKTI, a novel 15-domain type of human serine proteinase inhibitor." THE JOURNAL OF BIOLOGICAL CHEMISTRY. UNITED STATES 30 JUL 1999, Bd. 274, Nr. 31, 30. Juli 1999 (1999-07-30), Seiten 21499-21502, XP002220533 ISSN: 0021-9258 in der Anmeldung erw{hnt *
M[GERT HANS J]RGEN ET AL: "LEKTI: a multidomain serine proteinase inhibitor with pathophysiological relevance." THE INTERNATIONAL JOURNAL OF BIOCHEMISTRY & CELL BIOLOGY. ENGLAND JUN 2002, Bd. 34, Nr. 6, Juni 2002 (2002-06), Seiten 573-576, XP002220534 ISSN: 1357-2725 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2003070953A1 (de) * 2002-02-22 2003-08-28 Ipf Pharmaceuticals Gmbh Verbindung zur inhibierung der serin-proteinasen und zur inhibierung von infektionen oder virusvermehrung: rld 8564
WO2010097066A1 (de) 2009-02-27 2010-09-02 Universitätsklinikum Schleswig-Holstein Serinprotease-inhibitoren zur spezifischen inhibition von gewebs-kallikreinen
DE102009010942A1 (de) 2009-02-27 2010-09-02 Universitätsklinikum Schleswig-Holstein Serinprotease-Inhibitoren zur spezifischen Inhibition von Gewebs-Kallikreinen
WO2018232300A1 (en) * 2017-06-16 2018-12-20 Azitra Inc Compositions and methods for treatment of netherton syndrome with lekti expressing recombinant microbes
US11773154B2 (en) 2017-06-16 2023-10-03 Azitra Inc Compositions and methods for treatment of Netherton Syndrome with LEKTI expressing recombinant microbes
WO2021198176A1 (en) 2020-03-31 2021-10-07 Pharis Biotec Gmbh Polypeptide for the prophylaxis and treatment of viral infections

Also Published As

Publication number Publication date
WO2002066513A3 (de) 2003-04-03

Similar Documents

Publication Publication Date Title
DE69429631T2 (de) Conotoxinpeptide
EP0471701B2 (de) Neue proteine mit tnf-hemmender wirkung und ihre herstellung
DE3785615T2 (de) Hemmungsstoffe der serin-protease.
Sautière et al. New toxins acting on sodium channels from the scorpion Leiurus quinquestriatus hebraeus suggest a clue to mammalian vs insect selectivity
DE19641876A1 (de) Streptavidinmuteine
DE69024104T2 (de) Polypeptide und Polypeptidanaloge mit inhibitorischer Aktivität gegenüber menschlicher Elastase
EP0497915B1 (de) hPTH-FRAGMENT-(1-37), SEINE HERSTELLUNG, DIESES ENTHALTENDE ARZNEIMITTEL UND SEINE VERWENDUNG
DE68925199T2 (de) Peptide und polypeptide stammend von den submaxillaren drüsen der ratte, deren entsprechende monoklonale und polyklonale antikörper entsprechende hybridomen und verwendung dieser verbindungen in der diagnose bei bestimmungen und für pharmazeutische zwecke
EP0736095B1 (de) Humanes zirkulierendes cytokin cc-1
EP1481004A2 (de) Streptavidin-bindungspeptid
DE69132813T2 (de) Genetisches igfbp-5 rodierendes material
EP1959013B1 (de) Humanes zirkulierendes Virus inhibierendes Peptid (VIRIP) und seine Verwendung
DE69233155T2 (de) Insulinartigen wachstumsfaktor bindendes protein
WO2002066513A2 (de) Humane zirkulierende lekti fragmente hf7072, hf7638 und hf14448 sowie ihre verwendung
DE69019525T2 (de) Für kappa-opioid-rezeptoren spezifische dynorphinanaloga.
DE60112424T2 (de) Protonen-abhängiges na+-kanal hemmendes polypeptid
EP0616642B1 (de) Neue thrombininhibitorische proteine aus landblutegeln
DE69312320T2 (de) Den kalzium kanal blokierende polypeptide aus filistata hibernalis.
DE4427531A1 (de) Humanes zirkulierendes beta-Defensin hBD-1
EP1023445B1 (de) Cadherin derived growth factor und seine verwendung
DE4344397A1 (de) Humanes zirkulierendes Cytokin CC-1
EP1556488B1 (de) Humanes chondroosteomodulin (tig2), herstellung und verwendung zur behandlung oder diagnose von knochen- und knorpelerkrankungen, fettsucht sowie entzündlichen erkrankungen und hauterkrankungen
DE68912090T2 (de) Calcitonin-Derivate und deren Salze.
DE4427395A1 (de) Humanes zirkulierendes Cytokin CC-1
DE19730786C2 (de) Humanes zirkulierendes hNLP (humanes Neutrophilen-Lymphocyten-Peptid)

Legal Events

Date Code Title Description
AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ OM PH PL PT RO RU SD SE SG SI SK SL TJ TM TN TR TT TZ UA UG US UZ VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

122 Ep: pct application non-entry in european phase
NENP Non-entry into the national phase

Ref country code: JP

WWW Wipo information: withdrawn in national office

Country of ref document: JP