WO2001041799A1 - Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions - Google Patents
Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions Download PDFInfo
- Publication number
- WO2001041799A1 WO2001041799A1 PCT/US2000/033549 US0033549W WO0141799A1 WO 2001041799 A1 WO2001041799 A1 WO 2001041799A1 US 0033549 W US0033549 W US 0033549W WO 0141799 A1 WO0141799 A1 WO 0141799A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide
- hla
- epitope
- epitopes
- peptides
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
- A61K2039/5158—Antigen-pulsed cells, e.g. T-cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55516—Proteins; Peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55555—Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- HPV Human paptllomavirus
- DNA viruses that infect a vanety of higher vertebrates More than 80 types of HPVs have been identified Of these, more than 30 can infect the genital tract Some types, generally types 6 and 11, may cause genital warts, which are typically benign and rarely develop into cancer Other strains of HPV, "cancer- associated", or "high-nsk” types, can more frequently lead to the development of cancer The pnmary mode of transmission of these strains of HPV is through sexual contact
- the mam manifestations of the genital warts are cauliflower-like condylomata acummata that usually involve moist surfaces, keratotic and smooth papular warts, usually on dry surfaces, and subclinical "flat" warts, which are found on any mucosal or cutaneous surface (Handsfield, H , Am J Med 102(5 A) 16-20, 1997) These warts are typically benign but are a source of inter-individual spread of the virus (Ponten, J & Guo, Z , Cancer Surv 32 201-29, 1998) At least three HPV strains associated with genital warts have been identified type 6a (see, e g , Hofmann, K J , et al , Virology 209(2) 506-518, 1995), type 6b (see, e g , Hofmann et al , supra) and type 11 (see, e g , Dartmann, K et al , Virology 151(1) 124-
- HPVs have been linked with cancer m both men and women, they mclude, but are not limited to, HPV-16, HPV-18, HPV-31, HPV-45, HPV-33 and HPV-56
- the high nsk types are typically associated with the development of cervical carcinoma and premahgnant lesions of the cervix in women, but are also associated with similar malignant and premahgnant lesions at other anatomic sites withm the lower gemtal or anogemtal tract
- These lesions mclude neoplasia of the vagina, vulva, perineum, the penis, and the anus HPV mfection has also been associated with respiratory tract papillomas, and rarely, cancer, as well as abnormal growth or neoplasia m other epithelial tissues See, e g
- the HPV genome consists of three functional regions, the early region, the late region, and the "long control region"
- the early region gene products control viral replication, transcnption and cellular transformation They mclude the HPV El and E2 proteins, which play a role in HPV DNA replication, and the E6 and E7 oncoprotems, which are mvolved in the control of cellular proliferation
- the late region include the genes that encode the structural proteins LI and L2, which are the major and mmor capsid proteins, respectively
- the "long control region” contams such sequences as enhancer and promoter regulatory regions HPV expresses different proteins at different stages of the infection, for example early, as well as late, proteins Even in latent infections, however, early protems are often expressed and are therefore useful targets for vaccme-based therapies For example, high-grade dysplasia and cervical squamous cell carcinoma contmue to express E6 and E7, which therefore can be targeted to treat disease at both early and late stages of infection
- HPV infection Treatment for HPV infection is often unsatisfactory because of persistence of virus after treatment and recurrence of clinically apparent disease is common The treatment may require frequent visits to clinics and is not directed at elimination of the virus but at clearing warts Because of persistence of virus after treatment, recurrence of clinically apparent disease is common
- Effective HPV vaccmes would be a significant advance in the control of sexually transmissable infections and could also protect agamst clinical disease, particularly cancers such as cervical cancer (see, e g , Rowen, P & Lacey, C , Dermatologic Clinics 16(4) 835-838, 1998)
- Virus-specific, human leukocyte antigen (HLA) class I-restncted cytotoxic T lymphocytes (CTL) are known to play a major role in the prevention and clearance of virus infections in vivo (Oldstone et al , Nature 321
- HLA class I molecules are expressed on the surface of almost all nucleated cells Following intracellular processmg of antigens, epitopes from the antigens are presented as a complex with the HLA class I molecules on the surface of such cells CTL recognize the peptide-HLA class I complex, which then results in the destruction of the cell bearing the HLA-peptide complex directly by the CTL and/or via the activation of non-destructive mechanisms e g , the production of lnterferon, that inhibit viral replication
- Virus-specific T helper lymphocytes are also known to be critical for maintaining effective immunity in chronic viral infections Histoncally, HTL responses were viewed as pnmanly supporting the expansion of specific CTL and B cell populations, however, more recent data indicate that HTL may directly contribute to the control of virus replication For example, a decline m CD4 + T cells and a corresponding loss m HTL function characterize infection with HIV (Lane et al , New Engl J Med 313 79, 1985) Furthermore, studies m HIV infected patients have also shown that there is an inverse relationship between virus-specific HTL responses and viral load, suggesting that HTL plays a role m viremia (see, e g , Rosenberg et al , Science 278 1447, 1997) The development of vaccmes with prophylactic and therapeutic efficacy agamst HPV is ongoing Early vaccme development was hampered by the inability to culture HPV With the introduction of clonmg techniques and protem expression, however, some attempts have
- the epitope approach allows the incorporation of various antibody, CTL and HTL epitopes, from various protems, in a smgle vaccme composition
- a composition may simultaneously target multiple dominant and subdominant epitopes and thereby be used to achieve effective immunization m a diverse population
- This invention applies our knowledge of the mechanisms by which antigen is recognized by T cells, for example, to develop epitope-based vaccines directed towards HPV More specifically, this application communicates our discovery of specific epitope pharmaceutical compositions and methods of use m the prevention and treatment of HPV infection
- epitope-based vaccmes Upon development of appropriate technology, the use of epitope-based vaccmes has several advantages over current vaccmes, particularly when compared to the use of whole antigens m vaccme compositions There is evidence that the immune response to whole antigens is directed largely toward variable regions of the antigen, allowing for immune escape due to mutations
- the epitopes for inclusion an epitope-based vaccme may be selected from conserved regions of viral or tumor-associated antigens, which thereby reduces the likelihood of escape mutants
- immunosuppressive epitopes that may be present m whole antigens can be avoided with the use of epitope-based vaccmes
- An additional advantage of an epitope-based vaccme approach is the ability to combine selected epitopes (CTL and HTL), and further, to modify the composition of the epitopes, achieving, for example, enhanced immunogenicity Accordmgly, the immune response can be modulated, as appropriate, for the target disease Similar engmeermg of the response is not possible with traditional approaches
- epitope-based immune-stimulating vaccmes Another major benefit of epitope-based immune-stimulating vaccmes is their safety The possible pathological side effects caused by infectious agents or whole protem antigens, which might have their own intrinsic biological activity, is eliminated
- An epitope-based vaccme also provides the ability to direct and focus an immune response to multiple selected antigens from the same pathogen
- patient-by-patient vanability m the immune response to a particular pathogen may be alleviated by inclusion of epitopes from multiple antigens from the pathogen m a vaccme composition
- epitopes denved from multiple strains may also be mcluded
- a "pathogen" may be an infectious agent or a tumor associated molecule
- a need has existed to modulate peptide bmdmg properties, e g , so that peptides that are able to bmd to multiple HLA antigens do so with an affinity that will stimulate an immune response
- Identification of epitopes restricted by more than one HLA allele at an affinity that correlates with immunogenicity is important to provide thorough population coverage, and to allow the ehcitation of responses of sufficient vigor to prevent or clear an infection m a diverse segment of the population Such a response can also target a broad anay of epitopes
- the technology disclosed herem provides for such favored immune responses
- epitopes for inclusion m vaccme compositions of the mvention are selected by a process whereby protem sequences of known antigens are evaluated for the presence of motif or supermotif-beanng epitopes Peptides corresponding to a motif- or supermotif-bearing epitope are then synthesized and tested for the ability to bmd to the HLA molecule that recognizes the selected motif Those peptides that bmd at an mtermediate or high affinity i e , an IC 50 (or a K D value) of 500 nM or less for HLA class I molecules or an IC 50 of 1000 nM or less for HLA class II molecules, are further evaluated for their ability to mduce a CTL or HTL response Immunogenic peptide epitopes are selected for inclusion in vaccme compositions
- Supermotif-bearing peptides may additionally be tested for the ability to bmd to multiple alleles withm the HLA supertype family Moreover, peptide epitopes may be analogued to modify bmdmg affinity and/or the ability to bmd to multiple alleles withm an HLA supertype
- the mvention also mcludes embodiments compnsmg methods for monitoring or evaluatmg an immune response to HPV m a patient havmg a known HLA-type
- Such methods compnse mcubatmg a T lymphocyte sample from the patient with a peptide composition compnsmg an HPV epitope that has an ammo acid sequence descnbed m Tables VII to Table XX which binds the product of at least one HLA allele present in the patient, and detectmg for the presence of a T lymphocyte that bmds to the peptide
- a CTL peptide epitope may, for example, be used as a component of a teframeric complex for this type of analysis
- An alternative modality for defining the peptide epitopes m accordance with the mvention is to recite the physical properties, such as length, pnmary structure, or charge, which are correlated with binding to a particular allele-specific HLA molecule or group of allele-specific HLA molecules
- a further modality for defining peptide epitopes is to recite the physical properties of an HLA bindmg pocket, or properties shared by several allele-specific HLA bmdmg pockets (e g pocket configuration and charge distnbution) and recitmg that the peptide epitope fits and bmds to the pocket or pockets.
- novel synthetic peptides produced by any of the methods described herein are also part of the invention
- the peptides and corresponding nucleic acid compositions of the present mvention are useful for stimulating an immune response to HPV by stimulatmg the production of CTL or HTL responses
- the peptide epitopes which are derived directly or indirectly from native HPV protem ammo acid sequences, are able to bind to HLA molecules and stimulate an immune response to HPV
- the complete sequence of the HPV protems to be analyzed can be obtamed from Genbank Epitopes and analogs thereof can also be readily determmed from sequence information that may subsequently be discovered for heretofore unknown variants of HPV, as will be clear from the disclosure provided below
- the epitopes of the invention have been identified in a number of ways, as will be discussed below Also discussed in greater detail is that analog peptides have been derived and the bmdmg activity for HLA molecules modulated by modifymg specific ammo acid residues to create peptide analogs exhibiting altered immunogenicity Further, the present mvention provides compositions and combinations of compositions that enable epitope-based vaccines that are capable of interacting with HLA molecules encoded by vanous genetic alleles to provide broader population coverage than prior vaccmes
- a “computer” or “computer system” generally mcludes a processor, at least one information storage/retrieval apparatus such as, for example, a hard dnve, a disk dnve or a tape drive, at least one input apparatus such as, for example, a keyboard, a mouse, a touch screen, or a microphone, and display structure Additionally, the computer may mclude a commumcation channel m communication with a network Such a computer may mclude more or less than what is listed above
- a "construct” as used herein generally denotes a composition that does not occur m nature
- a construct can be produced by synthetic technologies, e g , recombmant DNA preparation and expression or chemical synthetic techniques for nucleic or ammo acids
- a construct can also be produced by the addition or affiliation of one matenal with another such that the result is not found m nature m that form
- Cross-reactive bmdmg indicates that a peptide is bound by more than one HLA molecule, a synonym is degenerate bmdmg
- a "cryptic epitope” elicits a response by immunization with an isolated peptide, but the response is not cross-reactive in vitro when mtact whole protem which compnses the epitope is used as an antigen
- a "dommant epitope” is an epitope that mduces an immune response upon immunization with a whole native antigen (see, e g , Sercarz, et al , Annu Rev Immunol 11 729-766, 1993) Such a response is cross-reactive in vitro with an isolated peptide epitope
- an “epitope” is a set of ammo acid residues which is involved m recognition by a particular immunoglobulm, or m the context of T cells, those residues necessary for recognition by T cell receptor protems and/or Major Histocompatibihty Complex (MHC) receptors
- MHC Major Histocompatibihty Complex
- MHC Histocompatibihty Complex
- HLA supertype or family descnbes sets of HLA molecules grouped on the basis of shared peptide-binding specificities HLA class I molecules that share somewhat similar bmdmg affinity for peptides bearing certain amino acid motifs are grouped mto HLA supertypes
- HLA superfamily, HLA supertype family, HLA family, and HLA xx-like molecules are synonyms
- IC 50 is the concentration of peptide m a bmdmg assay at which 50% inhibition of bmdmg of a reference peptide is observed Given the conditions in which the assays are run (1 e , limiting HLA protems and labeled ' peptide concentrations), these values approximate KQ values Assays for determining bmdmg are descnbed m detail, e g , m PCT publications WO 94/20127 and WO 94/03205 It should be noted that IC 50 values can change, often dramatically, if the assay conditions are vaned, and dependmg on the particular reagents used (e g , HLA preparation, etc ) For example, excessive concentrations of HLA molecules will mcrease the apparent measured IC 50 of a given ligand
- bindmg is expressed relative to a reference peptide
- the ICso's of the peptides tested may change somewhat, the bmdmg relative to the reference peptide will not significantly change
- m an assay run under conditions such that the IC 50 of the reference peptide increases 10-fold the IC 50 values of the test peptides will also shift approximately 10-fold Therefore, to avoid ambiguities, the assessment of whether a peptide is a good, mtermediate, weak, or negative bmder is generally based on its IC 50 , relative to the IC 50 of a standard peptide
- Bmdmg may also be determined using other assay systems mcludmg those usmg live cells (e g , Ceppellmi et al , Nature 339 392, 1989, Chnst ick et al , Nature 352 67, 1991, Busch et al , Int Immunol 2 443, 19990, Hill et al , J Immunol 147 189, 1991, del Guercio et al , J Immunol 154 685, 1995), cell free systems usmg detergent lysates (e g , Cerundolo et al , J Immunol 21 2069, 1991), immobilized purified MHC (e g , Hill et al , J Immunol 152, 2890, 1994, Marshall et al , J Immunol 152 4946, 1994), ELISA systems (e g , Reay et al , EMBO J 11 2829, 1992), surface plasmon resonance (
- high affinity with respect to HLA class I molecules is defined as bmdmg with an IC 50 , or K D value, of 50 nM or less
- “mtermediate affinity” is bmdmg with an IC 50 or K D value of between about 50 and about 500 nM
- "High affinity” with respect to binding to HLA class II molecules is defined as bindmg with an IC 50 or K D value of 100 nM or less
- intermediate affinity is bmdmg with an IC 50 or K D value of between about 100 and about 1000 nM
- identity refers to two or more sequences or subsequences that are the same or have a specified percentage of ammo acid residues that are the same, when compared and aligned for maximum correspondence over a comparison window, as measured usmg a sequence companson algonthm or by manual alignment and visual inspection
- immunogenic peptide or “peptide epitope” is a peptide that comprises an allele- specific motif or supermotif such that the peptide will bmd an HLA molecule and mduce a CTL and/or HTL response
- immunogenic peptides of the mvention are capable of bmding to an appropnate HLA molecule and thereafter inducing a cytotoxic T cell response, or a helper T cell response, to the antigen from which the immunogenic peptide is denved
- isolated or “biologically pure” refer to material which is substantially or essentially free from components which normally accompany the matenal as it is found m its native state
- isolated peptides in accordance with the mvention preferably do not contam matenals normally associated with the peptides m their in situ environment
- Link refers to any method known m the art for functionally connecting peptides, mcludmg, without limitation, recombinant fusion, covalent bondmg, disulfide bond g, tonic bondmg, hydrogen bondmg, and electrostatic bondmg
- MHC Major Histocompatibihty Complex
- HLA complex HLA complex
- motif refers to the pattern of residues m a peptide of defined length, usually a peptide of from about 8 to about 13 ammo acids for a class I HLA motif and from about 6 to about 25 ammo acids for a class II HLA motif, which is recognized by a particular HLA molecule
- Peptide motifs are typically different for each protem encoded by each human HLA allele and differ m the pattern of the pnmary and secondary anchor residues
- a "negative bindmg residue” or “deletenous residue” is an ammo acid which, if present at certam positions (typically not primary anchor positions) m a peptide epitope, results m decreased bmdmg affinity of the peptide for the peptide's corresponding HLA molecule
- non-native sequence or “construct” refers to a sequence that is not found m nature, 1 e , is "non-naturally occurring" Such sequences mclude, e g , peptides that are hpidated or otherwise modified, and polyepitopic compositions that contam epitopes that are not contiguous m a native protem sequence
- peptide is used interchangeably with “oligopeptide” m the present specification to designate a senes of residues, typically L-amino acids, connected one to the other, typically by peptide bonds between the ⁇ -amino and carboxyl groups of adjacent ammo acids
- the prefened CTL- mducmg peptides of the invention are 13 residues or less m length and usually consist of between about 8 and about 11 residues, preferably 9 or 10 residues
- the preferred HTL-mducing ohgopeptides are less than about 50 residues in length and usually consist of between about 6 and about 30 residues,
- protem or peptide molecules that comprise an epitope of the mvention as well as additional ammo ac ⁇ d(s) are withm the bounds of the mvention
- an embodiment that is length-limited occurs when the protein/peptide compnsmg an epitope of the mvention comprises a region (i e , a contiguous senes of ammo acids) havmg 100% identity with a native sequence
- the length of any region that has 100% identity with a native peptide sequence is limited
- the region with 100% identity to a native sequence generally
- “Pharmaceutically acceptable” refers to a non-toxic, inert, and/or physiologically compatible composition
- a “pharmaceutical excipient” comprises a matenal such as an adjuvant, a earner, pH- adjusting and buffering agents, tonicity adjusting agents, wetting agents, preservative, and the like
- a "pnmary anchor residue” is an ammo acid at a specific position along a peptide sequence which is understood to provide a contact pomt between the immunogenic peptide and the HLA molecule
- One to three, usually two, pnmary anchor residues withm a peptide of defined length generally defines a "motif for an immunogenic peptide These residues are understood to fit m close contact with peptide binding grooves of an HLA molecule, with then- side chams Krud in specific pockets of the binding grooves themselves
- the pnmary anchor residues are located at position 2 (from the ammo terminal position) and at the carboxyl termmal position of a 9-res ⁇ due peptide epitope in accordance with the invention The primary anchor positions for each
- Promiscuous recognition is where a distmct peptide is recognized by the same T cell clone in the context of various HLA molecules Promiscuous recognition or bindmg is synonymous with cross-reactive bmdmg
- a "protective immune response” or “therapeutic immune response” refers to a CTL and/or an HTL response to an antigen denved from an infectious agent or a tumor antigen, which prevents or at least partially anests disease symptoms or progression The immune response may also mclude an antibody response which has been facilitated by the stimulation of helper T cells
- residue refers to an ammo acid or ammo acid mimetic mcorporated mto an oligopeptide by an amide bond or amide bond mimetic
- a “secondary anchor residue” is an ammo acid at a position other than a pnmary anchor position m a peptide which may influence peptide bmdmg
- a secondary anchor residue occurs at a significantly higher frequency amongst bound peptides than would be expected by random distnbution of ammo acids at one position
- the secondary anchor residues are said to occur at "secondary anchor positions "
- a secondary anchor residue can be identified as a residue which is present at a higher frequency among high or mtermediate affinity bmdmg peptides, or a residue otherwise associated with high or mtermediate affinity bindmg
- analog peptides can be created by altering the presence or absence of particular residues m these secondary anchor positions Such analogs are used to finely modulate the bmdmg affinity of a peptide compnsmg a particular motif or supermotif
- a "subdominant epitope” is an epitope which evokes little or no response
- a "supermotif is a peptide bindmg specificity shared by HLA molecules encoded by two or more HLA alleles
- a supermotif-bearmg peptide is recognized with high or mtermediate affinity (as defined herem) by two or more HLA antigens
- Synthetic peptide refers to a peptide that is man-made usmg such methods as chemical synthesis or recombinant DNA technology
- a "vaccme” is a composition that contams one or more peptides of the mvention
- vaccmes m accordance with the mvention, such as by a cocktail of one or more peptides, one or more epitopes of the mvention comprised by a polyepitopic peptide, or nucleic acids that encode such peptides or polypeptides, e g , a minigene that encodes a polyepitopic peptide
- the "one or more peptides” can mclude any whole unit mteger from 1-150, e g , at least 2, 3, 4, 5, 6, 1, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40 , 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125
- HLA class I-binding peptides of the invention can be admixed with, or linked to, HLA class II-binding peptides, to facilitate activation of both cytotoxic T lymphocytes and helper T lymphocytes.
- Vaccines can also comprise peptide-pulsed antigen presenting cells, e.g., dendritic cells.
- each residue is generally represented by standard three letter or single letter designations.
- the L-form of an amino acid residue is represented by a capital single letter or a capital first letter of a three- letter symbol
- the D-form for those amino acids having D-forms is represented by a lower case single letter or a lower case three letter symbol.
- Glycine has no asymmetric carbon atom and is simply referred to as "Gly" or G.
- the amino acid sequences of peptides set forth herein are generally designated using the standard single letter symbol.
- IH.B Stimulation of CTL and HTL responses The mechanism by which T cells recognize antigens has been delineated during the past ten years. Based on our understanding of the immune system we have developed efficacious peptide epitope vaccine compositions that can induce a therapeutic or prophylactic immune response to HPV in a broad population. For an understanding of the value and efficacy of the claimed compositions, a brief review of immunology-related technology is provided. A complex of an HLA molecule and a peptidic antigen acts as the ligand recognized by
- HLA-restricted T cells (Buus, S. et al, Cell 47:1071, 1986; Babbitt, B. P. et al, Nature 317:359, 1985; Townsend, A. and Bodmer, H., Annu. Rev. Immunol. 7:601, 1989; Germain, R. N., Annu. Rev. Immunol. 11 :403, 1993).
- Tables I, II, and III see also, e.g., Southwood, et al, J.
- class I and class II allele-specific HLA bmdmg motifs allows identification of regions withm a protem that have the potential of bmdmg particular HLA ant ⁇ gen(s).
- the present inventors have found that the conelation of bindmg affinity with immunogenicity, which is disclosed herem, is an important factor to be considered when evaluatmg candidate peptides.
- candidates for epitope-based vaccmes have been identified.
- additional confirmatory work can be performed to select, amongst these vaccme candidates, epitopes with prefened charactenstics m terms of population coverage, antigenicity, and immunogenicity.
- ⁇ Cr-re lease assay involving peptide sensitized target cells and target cells expressmg endogenously generated antigen.
- recall responses are detected by cultunng PBL from subjects that have been naturally exposed to the antigen, for mstance through mfection, and thus have generated an immune response "naturally", or from patients who were vaccinated against the mfection PBL from subjects are culmred in vitro for 1-2 weeks m the presence of test peptide plus antigen presenting cells (APC) to allow activation of "memory" T cells, as compared to "naive" T cells
- APC antigen presenting cells
- epitope selection encompassmg identification of peptides capable of bmdmg at high or mtermediate affinity to multiple HLA molecules is preferably utilized, most preferably these epitopes bmd at high or mtermediate affinity to two or more allele-specific HLA molecules
- CTL-inducing peptides of mterest for vaccme compositions preferably include those that have an IC 50 or bmdmg affinity value for class I HLA molecules of 500 nM or better (1 e , the value is ⁇ 500 nM) HTL-mducmg peptides preferably mclude those that have an IC- 0 or bmdmg affinity value for class II HLA molecules of 1000 nM or better, (1 e , the value is ⁇ 1,000 nM)
- peptide bmdmg is assessed by testing the capacity of a candidate peptide to bmd to a punfied HLA molecule in vitro Peptides exhibiting high or mtermediate affinity are then considered for further analysis Selected peptides are tested on other members of the supertype family In prefened embodiments, peptides that exhibit cross- reactive binding are then used m cellular screening analyses or vaccmes
- TAAs tumor-associated antigens
- the bindmg affinity of peptides for HLA molecules can be determmed as described in Example 1, below
- HLA class II peptide ligands A greater degree of heterogeneity in both size and bmdmg frame position of the motif, relative to the N and C termini of the peptide, exists for class II peptide ligands This mcreased heterogeneity of HLA class II peptide ligands is due to the structure of the bmdmg groove of the HLA class II molecule which, unlike its class I counterpart, is open at both ends Crystallographic analysis of HLA class II DRB*0101-pept ⁇ de complexes showed that the major energy of bmdmg is cont ⁇ aded by peptide residues complexed with complementary pockets on the DRB*0101 molecules An important anchor residue engages the deepest hydrophobic pocket (see, e g , Madden, D R Ann Rev Immunol 13 587, 1995) and is refened to as position 1 (PI) PI may represent the N-termmal residue of a class II bmdmg peptide epitope, but more typically
- HLA class I and class II molecules can be classified mto a relatively few supertypes, each charactenzed by largely overlappmg peptide bindmg repertoires, and consensus structures of the mam peptide bmdmg pockets
- peptides of the present mvention are identified by any one of several HLA-specific ammo acid motifs (see, e g , Tables I-III), or if the presence of the motif conesponds to the ability to bind several allele-specific HLA antigens, a supermotif
- the HLA molecules that bmd to peptides that possess a particular ammo acid supermotif are collectively refened to as an HLA "supertype"
- Examples of peptide epitopes bearmg a respective supermotif or motif are mcluded in Tables as designated m the description of each motif or supermotif below The Tables mclude a bmding affinity ratio listing for some of the peptide epitopes
- the IC 50 values of standard peptides used to determme bmdmg affmities for Class I peptides are shown m Table IV
- the IC 50 values of standard peptides used to determme bmdmg affinities for Class II peptides are shown in Table V For example, where an HLA-A2 1 motif-beanng peptide shows a relative bmdmg ratio of 0 01 for HLA-A*0201, the IC 50 value is 500 n
- peptide epitope sequences listed in Tables VII-XX protein sequence data for HPV types 6a, 6b, 11a, 16, 18, 31, 33, 45, and 56 were evaluated for the presence of the designated supermotif or motif. Seven HPV structural and regulatory proteins, El, E2, E5, E6, E7, LI and L2 were included in the analysis. E4 was also included in the evaluation of some of the strains. Peptide epitopes can additionally be evaluated on the basis of their conservancy (i.e., the amount of variance) among the available protein sequences for each HPV antigen.
- motif- and/or supermotif-bearing amino acids sequences identified in the indicated HPV strains are designated by position number and length of the epitope with reference to the HPV sequences and numbering provided below.
- the four columns provide the following information: column 1 indicates the HPV strain; column 2 indicates the HPV protein in which the motif-bearing sequence is found, e.g., El, E2, E4, E5, E6, E7, LI, or L2; column 3 indicates the length of the epitope, or in the case of HLA Class II epitopes, the length of the core sequence; and column 4 designates the amino acid position in the HPV protein sequence that conesponds to the first amino acid residue of the epitope.
- the HPV strain is indicated in the heading at the top of the page.
- the first peptide epitope listed in Table VII i.e., the HLA-Al supermotif, for HPV 16
- protein El is a sequence of 10 residues in length starting at position 206. Accordingly, the amino acid sequence of the epitope is AMLAKFKELY.
- the number and position listed for protein E5 refers to either the HPV11 E5a or HPV11 E5b sequence set out below. Because the epitope must include the designated motif or supermotif, e.g., HLA-A2, it can readily be determined whether the sequence refers to HPV11 E5a or E5b by checking the amino acid sequences of both E5a and E5b and selecting the sequence that conforms to the motif listed in Table I.
- HPV6A E5 1 MEWPVQIAAGTTSTLI PVIIAFWCFVSIILIVWISDFIVYTSVLVLTLLLYL LWLL 60 LTTPLQFFLLT LVCYCPALYIHHYIVNTQQ 91
- HPV6B E4 1 MGAPNIGKYVMAAQLYVLLHLYLALHKKYPFLNLLHTPPHRPPPLCPQAPRKTQCKRRLG 60 NEHEESNSPLATPCVWPTLDP TVETTTSSLTITTSTKDGTTVTVQLRL 109
- HPV16 E6 1 MHQKRTAMFQDPQERPRK PQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIV 60
- GVCTKCLRFYSKVSEFR YRYSVYGTTLEKLTNKGICDLLIRCITCQRPLCPEEKQRHLD 120 KKKRFHNIGGRWTGRCIACWRRPRTETQV 149
- HPV45 El Accession number S36563 1 MADPEGTDGEGTGCNGWFFVETIVEKKTGDVISDDEDETATDTGSDMVDFIDTQLSICEQ 60
- HLA class I peptide epitope supermotifs and motifs delmeated below are summarized in Table I
- Table 1(a) are those most particularly relevant to the invention claimed here
- Pnmary and secondary anchor positions are summarized in Table II
- Allele-specific HLA molecules that comp ⁇ se HLA class I supertype farmhes are listed Table VI
- peptide epitopes may be listed in both a motif and a supermotif Table The relationship of a particular motif and respective supermotif is mdicated m the description of the individual motifs
- the HLA-Al supermotif is characterized by the presence m peptide ligands of a small (T or S) or hydrophobic (L, I, V, or M) pnmary anchor residue m position 2, and an aromatic (Y, F, or W) pnmary anchor residue at the C-termmal position of the epitope
- T or S small
- L, I, V, or M hydrophobic
- Y, F, or W aromatic
- the conespondmg family of HLA molecules (i e , the HLA-A2 supertype that binds these peptides) is comprised of at least A*0201, A*0202, A*0203, A*0204, A*0205, A*0206, A*0207,
- the HLA- A3 supennotif is charactenzed by the presence m peptide ligands of A, L, I, V, M, S, or, T as a primary anchor at position 2, and a positively charged residue, R or K, at the C-termmal position of the epitope, e , in position 9 of 9-mers (see, e g , Sidney et al , Hum Immunol 45 79, 1996)
- Other allele-specific HLA molecules predicted to be members of the A3 supertype are shown m Table VI
- peptide bmdmg to each of the individual allele-specific HLA protems can be modulated by substitutions of ammo acids at the pnmary
- the HLA-A24 supermotif is characterized by the presence m peptide ligands of an aromatic (F, W, or Y) or hydrophobic aliphatic (L, I, V, M, or T) residue as a pnmary anchor m position 2, and Y, F, W, L, I, or M as pnmary anchor at the C-termmal position of the epitope (see, e g , Sette and
- HLA-B7 supermotif The HLA-B7 supermotif is characterized by peptides bearing proline in position 2 as a p ⁇ mary anchor, and a hydrophobic or aliphatic ammo acid (L, I, V, M, A, F, W, or Y) as the primary anchor at the C-termmal position of the epitope
- the conespondmg family of HLA molecules that bind the B7 supermotif is compnsed of at least twenty six HLA-B protems mcludmg B*0702, B*0703, B*0704, B*0705, B* 1508, B*3501, B*3502, B*3503, B*3504, B*3505, B*3506, B*3507, B*3508, B*5101, B*5102, B*5103, B*5104, B*5105, B*5301, B*5401, B*5501, B*5502,
- the HLA-B27 supermotif is charactenzed by the presence m peptide ligands of a positively charged (R, H, or K) residue as a pnmary anchor at position 2, and a hydrophobic (F, Y, L, W, M, I, A, or V) residue as a primary anchor at the C-termmal position of the epitope (see, e g , Sidney and Sette, Immunogenetics 1999 Nov, 50(3-4) 201-12, Review)
- Exemplary members of the conespondmg family of HLA molecules that bmd to the B27 supermotif (i e , the B27 supertype) include at least B* 1401, B* 1402, B* 1509, B*2702, B*2703, B*2704, B*2705, B*2706, B*3801, B*3901, B*3902, and B*7301
- Other allele-specific HLA molecules predicted to be members of the B27 supertype are shown in Table VI Pept
- the HLA-B44 supermotif is characterized by the presence m peptide ligands of negatively -charged (D or E) residues as a primary anchor m position 2, and hydrophobic residues (F, W, Y, L, I, M, V, or A) as a primary anchor at the C-termmal position of the epitope (see, e g , Sidney et al , Immunol Today 17 261, 1996)
- Exemplary members of the conesponding family of HLA molecules that bmd to the B44 supermotif (i e , the B44 supertype) m clude at least B* 1801, B*1802, B*3701, B*4001, B*4002, B*4006, B*4402, B*4403, and B*4006 Peptide bindmg to each of the allele-specific HLA molecules can be modulated by substitutions at pnmary and/or secondary anchor positions, preferably choosmg respective residues specified for the supermotif
- the HLA-B58 supermotif is charactenzed by the presence m peptide ligands of a small aliphatic residue (A, S, or T) as a p ⁇ mary anchor residue at position 2, and an aromatic or hydrophobic residue (F, W, Y, L, I, V, M, or A) as a pnmary anchor residue at the C-termmal position of the epitope (see, e g , Sidney and Sette, Immunogenetics 1999 Nov, 50(3-4) 201-12, Review) Exemplary members of the conespondmg family of HLA molecules that bmd to the B58 supermotif (.
- the B58 supertype mclude at least B* 1516, B*1517, B*5701, B*5702, and B*5801
- Other allele-specific HLA molecules predicted to be members of the B58 supertype are shown m Table VI Peptide bmdmg to each of the allele- specific HLA molecules can be modulated by substitutions at pnmary and/or secondary anchor positions, preferably choosmg respective residues specified for the supermotif
- the HLA-B62 supermotif is characterized by the presence in peptide ligands of the polar aliphatic residue Q or a hydrophobic aliphatic residue (L, V, M, I, or P) as a primary anchor in position 2, and a hydrophobic residue (F, W, Y, M, I, V, L, or A) as a primary anchor at the C-terrmnal position of the epitope (see, e g , Sidney and Sette, Immunogenetics 1999 Nov, 50(3-4) 201-12, Review)
- Other allele-specific HLA molecules predicted to be members of the B62 supertype are shown m Table VI Peptide bmdmg to each of the allele- specific HLA
- HLA-Al motif The HLA-Al motif is charactenzed by the presence m peptide ligands of T, S, or M as a pnmary anchor residue at position 2 and the presence of Y as a p ⁇ mary anchor residue at the C-terminal position of the epitope
- An alternative allele-specific Al motif is characterized by a pnmary anchor residue at position 3 rather than position 2
- This motif is characterized by the presence of D, E, A, or S as a primary anchor residue m position 3, and a Y as a primary anchor residue at the C-termmal position of the epitope (see, e g , DiBrino et al , 1 Immunol -, 152 620, 1994, Kondo et al , Immunogenetics 45 249, 1997, and Kubo et al , J Immunol 152 3913, 1994 for reviews of relevant data)
- HLA-A*0201 motif An HLA-A2*0201 motif was determmed to be characterized by the presence m peptide ligands of L or M as a p ⁇ mary anchor residue m position 2, and L or V as a primary anchor residue at the C-termmal position of a 9-res ⁇ due peptide (see, e g , Falk et al , Nature 351 290-296, 1991) and was further found to comprise an I at position 2 and I or A at the C-terrmnal position of a nine ammo acid peptide (see, e g , Hunt et al , Science 255 1261-1263, March 6, 1992, Parker et al , J Immunol 149 3580-3587, 1992)
- the A*0201 allele-specific motif has also been defined by the present mventors to additionally comprise V, A, T, or Q as a p ⁇ mary anchor residue at position 2, and M or T as a
- A*0201 motif Representative peptide epitopes that comprise an A*0201 motif are set forth in Table VIII.
- the A*0201 motifs comprising the primary anchor residues V, A, T, or Q at position 2 and L, I, V, A, or T at the C-terminal position are those most particularly relevant to the invention claimed herein.
- the HLA- A3 motif is characterized by the presence in peptide ligands of L, M, V, I, S, A, T, F, C, G, or D as a primary anchor residue at position 2, and the presence of K, Y, R, H, F, or A as a primary anchor residue at the C-terminal position of the epitope (see, e.g., DiBrino et al, Proc. Natl. Acad. Sci USA 90:1508, 1993; and Kubo et al, J. Immunol. 152:3913-3924, 1994).
- Peptide binding to HLA-A3 can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the motif.
- A3 motif Representative peptide epitopes that comprise the A3 motif are set forth in Table XVI. Those epitopes that also comprise the A3 supermotif are also listed in Table IX.
- the A3 supermotif primary anchor residues comprise a subset of the A3- and Al 1 -allele specific motif primary anchor residues.
- HLA-Al 1 motif The HLA-Al 1 motif is characterized by the presence in peptide ligands of V, T, M, L, I,
- Peptide binding to HLA-A 11 can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosing respective residues specified for the motif.
- peptide epitopes that comprise the Al 1 motif are set forth in Table XVII; peptide epitopes comprising the A3 allele-specific motif are also present in this Table because of the extensive overlap between the A3 and Al l motif primary anchor specificities. Further, those peptide epitopes that comprise the A3 supermotif are also listed in Table IX.
- the HLA-A24 motif is characterized by the presence in peptide ligands of Y, F, W, or M as a primary anchor residue in position 2, and F, L, I, or W as a primary anchor residue at the C-terminal position of the epitope (see, e.g., Kondo et al, J. Immunol. 155:4307-4312, 1995; and Kubo et al, J. Immunol. 152:3913-3924, 1994).
- Peptide binding to HLA-A24 molecules can be modulated by substitutions at primary and/or secondary anchor positions, preferably choosmg respective residues specified for the motif.
- HLA- DRB1 *0401, DRB1*0101, and/or DRB1*0701 can be modulated by substitutions at primary and or secondary anchor positions, preferably choosmg respective residues specified for the supermotif.
- the alternative DR3 submotif provides for lack of the large, hydrophobic residue at anchor position 1, and or lack of the negatively charged or amide-like anchor residue at position 4, by the presence of a positive charge at position 6 towards the carboxyl termmus of the epitope
- L I, V, M, F, Y, A, or Y is present at anchor position 1
- D, N, Q, E, S, or T is present at anchor position 4
- K, R, or H is present at anchor position 6
- Peptide bmding to HLA-DR3 can be modulated by substitutions at p ⁇ mary and/or secondary anchor positions, preferably choosmg respective residues specified for the motif Representative 9-mer epitopes conespondmg to a rune residue sequence compnsmg the
- DR3a and DR3b submotifs are set forth in Table XXa and b
- Exemplary epitopes of 15 ammo acids in length that compnses the nme residue core mclude the three residues on either side that flank the nme residue core
- HTL epitopes that compnses the cores sequences can also be of lengths other than 15 ammo acids, supra Accordmgly, epitopes of the invention mclude sequnces that typically comprise the nme residue core plus 1, 2, 3 (as m the exemplary 15-mer), 4, or 5 flanking residues on either side of the nme residue core
- each of the HLA class I or class II epitopes set out in the Tables herem are deemed smgly to be an mventive aspect of this application Further, it is also an mventive aspect of this application that each epitope may be used in combination with any other epitope
- Vaccmes that have broad population coverage are prefened because they are more commercially viable and generally applicable to the most people Broad population coverage can be obtamed using the peptides of the invention (and nucleic acid compositions that encode such peptides) through selectmg peptide epitopes that bind to HLA alleles which, when considered m total, are present m most of the population
- the Table below lists the overall frequencies of the HLA class I supertypes m vanous ethnicities (section a) and the combmed population coverage achieved by the A2-, A3-, and B7- supertypes (section b)
- the A2-, A3-, and B7 supertypes are each present on the average of over 40% m each of these five major ethnic groups Coverage in excess of 80% is achieved with a combination of these supermotifs
- section a While less prevalent overall, the B27-, B58-, and B62 supertypes are each present with a frequency >25% m at least one major ethnic group (section a)
- section b the Table summa ⁇ zes the estimated prevalence of combinations of HLA supertypes that have been identified in five major ethnic groups The mcremental coverage obtamed by the inclusion of Al,- A24-, and B44-supertypes to the A2, A3, and B7 coverage and coverage obtamed with all of the supertypes descnbed herem, is shown
- the strategy employed utilizes the motifs or supermotifs which conelate with bmdmg to certam HLA molecules
- the motifs or supermotifs are defined by havmg pnmary anchors, and m many cases secondary anchors
- Analog peptides can be created by substituting ammo acid residues at primary anchor, secondary anchor, or at primary and secondary anchor positions
- analogs are made for peptides that already bear a motif or supermotif Prefened secondary anchor residues of supermotifs and motifs that have been defined for HLA class I and class II bmding peptides are shown m Tables II and III, respectively
- residues are defined which are deleterious to bmdmg to allele-specific HLA molecules or members of HLA supertypes that bmd the respective motif or supermotif (Tables II and III) Accordmgly, removal of such residues that are detrimental to bmdmg can be performed m accordance with the present mvention
- the mcidence of cross-reactivity mcreased from 22% to 37% (see, e g , Sidney, J et al , Hu Immunol 45 79, 1996)
- one strategy to improve the cross-reactivity of peptides withm a given supermotif is simply to delete one or more of the deleterious residues present within a peptide and substitute a small "neutral" residue such as Ala
- an enhanced likelihood of cross-reactivity is expected if, together with elimination of detrimental residues within a peptide, "prefened” residues associated with high affinity binding to an allele-specific HLA molecule or to multiple HLA molecules within a superfamily are inserted.
- the analog peptide when used as a vaccine, actually elicits a CTL response to the native epitope in vivo (or, in the case of class II epitopes, elicits helper T cells that cross-react with the wild type ' peptides), the analog peptide may be used to immunize T cells in vitro from individuals of the appropriate HLA allele.
- the immunized cells' capacity to induce lysis of wild type peptide sensitized target cells is evaluated. It will be desirable to use as antigen presenting cells, cells that have been either infected, or transfected with the appropriate genes, or, in the case of class II epitopes only, cells that have been pulsed with whole protein antigens, to establish whether endogenously produced antigen is also recognized by the relevant T cells.
- Another embodiment of the invention is to create analogs of weak binding peptides, to thereby ensure adequate numbers of cross-reactive cellular binders.
- Class I binding peptides exhibiting binding affinities of 500-5000 nM, and carrying an acceptable but suboptimal primary anchor residue at one or both positions can be "fixed” by substituting prefened anchor residues in accordance with the respective supertype. The analog peptides can then be tested for crossbinding activity.
- Another embodiment for generating effective peptide analogs involves the substitution of residues that have an adverse impact on peptide stability or solubility in, e.g., a liquid environment. This substitution may occur at any position of the peptide epitope.
- a cysteine (C) can be substituted out in favor of ⁇ -amino butyric acid. Due to its chemical nature, cysteine has the propensity to form disulfide bridges and sufficiently alter the peptide structurally so as to reduce binding capacity.
- a native protein sequence e.g. , a tumor-associated antigen, or sequences from an infectious organism, or a donor tissue for transplantation
- a means for computing such as an intellectual calculation or a computer
- the information obtained from the analysis of native peptide can be used directly to evaluate the stams of the native peptide or may be utilized subsequently to generate the peptide epitope.
- ⁇ G a,, x a 2 , x a 3 , x a-., where a i is a coefficient that represents the effect of the presence of a given ammo acid (/) at a given position (.) along the sequence of a peptide of n ammo acids
- a i is a coefficient that represents the effect of the presence of a given ammo acid (/) at a given position (.) along the sequence of a peptide of n ammo acids
- a protem sequence or translated sequence may be analyzed using software developed to search for motifs, for example the "FINDPATTERNS' program (Devereux, ef al Nucl Acids Res 12 387-395, 1984) or MotifSearch 1 4 software program (D Brown, San Diego, CA) to identify potential peptide sequences contaming appropriate HLA bindmg motifs
- the identified peptides can be scored usmg customized polynomial algonthms to predict their capacity to bmd specific HLA class I or class II alleles
- a large anay of computer programmmg software and hardware options are available m the relevant art which can be employed to implement the motifs of the mvention in order to evaluate (e g , without limitation, to identify epitopes, identify epitope concentration per peptide length, or to generate analogs) known or unknown peptide sequences
- Peptides in accordance with the mvention can be prepared synthetically, by recombmant DNA technology or chemical synthesis, or from natural sources such as native tumors or pathogenic organisms Peptide epitopes may be synthesized individually or as polyepitopic peptides Although the peptide will preferably be substantially free of other naturally occurring host cell protems and fragments thereof, in some embodiments the peptides may be synthetically conjugated to native fragments or particles
- the peptides m accordance with the mvention can be a variety of lengths, and either in their neutral (uncharged) forms or m forms which are salts
- the peptides m accordance with the invention are either free of modifications such as glycosylation, side cha oxidation, or phosphorylation, or they contam these modifications, subject to the condition that modifications do not destroy the biological activity of the peptides as descnbed herem
- HLA class I bmdmg epitopes of the mvention such as can be used in a polyepitopic construct, to a length of about 8 to about 13 ammo acid residues, often 8 to 11, preferably 9 to 10 HLA class II bmdmg peptide epitopes of the mvention may be optimized to a length of about 6 to about 30 ammo acids length, preferably to between about 13 and about 20 residues
- the peptide epitopes are commensurate size with endogenously processed pathogen-derived peptides or tumor cell peptides that are bound to the relevant HLA molecules, however, the identification and preparation of peptides that comprise epitopes of the mvention can also be earned out usmg the techniques described herein
- epitopes of the mvention can be linked as a polyepitopic peptide, or as a mmigene that encodes a polyepitopic peptide
- a sequence is generally selected on the basis that it contams the greatest number of epitopes per ammo acid length
- epitopes can be present in a nested or overlapping manner, e g a 10 amino acid long peptide could contain two 9 amino acid long epitopes and one 10 ammo acid long epitope, upon intracellular processmg, each epitope can be exposed and bound by an HLA molecule upon administration of such a peptide
- This larger, preferably multi-epitopic, peptide can be generated synthetically, recombinantly, or via cleavage from the native source
- the peptides of the mvention can be prepared m a wide variety of ways for the prefened relatively short size, the peptides can be synthesized in solution or on a solid support in accordance with conventional techniques Vanous automatic synthesizers are commercially available and can be used m accordance with known protocols (See, for example, Stewart & Young, SOLID PHASE PEPTIDE SYNTHESIS, 2D ED , Pierce Chemical Co , 1984) Further, individual peptide epitopes can be jomed usmg chemical ligation to produce larger peptides that are still withm the bounds of the mvention
- recombinant DNA technology can be employed wherem a nucleotide sequence which encodes an immunogenic peptide of interest is inserted mto an expression vector, transformed or transfected mto an appropnate host cell and cultivated under conditions suitable for expression
- a nucleotide sequence which encodes an immunogenic peptide of interest is inserted mto an expression vector, transformed or transfected mto an appropnate host cell and cultivated under conditions suitable for expression
- procedures are generally known in the art, as descnbed generally m Sambrook et al , MOLECULAR CLONING, A LABORATORY MANUAL, Cold Spring Harbor Press, Cold Spring Harbor, New York (1989)
- recombmant polypeptides which comp ⁇ se one or more peptide sequences of the mvention can be used to present the appropnate T cell epitope
- nucleotide codmg sequence for peptide epitopes of the prefened lengths contemplated herem can be synthesized by chemical techniques, for example, the phosphot ⁇ ester method of Matteucci, et al , J Am Chem Soc 103 3185 (1981) Peptide analogs can be made simply by substituting the appropriate and desired nucleic acid base(s) for those that encode the native peptide sequence, exemplary nucleic acid substitutions are those that encode an ammo acid defined by the motifs/supermotifs herem
- the codmg sequence can then be provided with appropnate linkers and ligated mto expression vectors commonly available in the art, and the vectors used to transform suitable hosts to produce the desired fusion protem A number of such vectors and suitable host systems are now available For expression of the fusion protems, the codmg sequence will be provided with operably linked start and stop codons, promoter and terminator regions and usually a replication system to provide an expression vector for expression in the desired cellular
- HLA bmding peptides Once HLA bmding peptides are identified, they can be tested for the ability to elicit a T- cell response
- motif-beanng peptides are described m PCT publications WO 94/20127 and WO 94/03205 Bnefly, peptides compnsmg epitopes from a particular antigen are synthesized and tested for their ability to bmd to the appropnate HLA proteins
- These assays may involve evaluatmg the bmdmg of a peptide of the invention to purified HLA class I molecules m relation to the bmdmg of a radioiodinated reference peptide
- cells expressmg empty class I molecules (i e lacking peptide therem) may be evaluated for peptide bindmg by lmmunofluorescent staming and flow microfluo ⁇ metry
- Other assays that may be used to evaluate peptide
- Analogous assays are used for evaluation of HLA class II bindmg peptides HLA class II motif-beanng peptides that are shown to bmd, typically at an affinity of 1000 nM or less, are further evaluated for the ability to stimulate HTL responses
- antigen-presenting cells that have been mcubated with a peptide can be assayed for the ability to mduce CTL responses m responder cell populations
- Antigen-presenting cells can be normal cells such as penpheral blood mononuclear cells or dendntic cells
- mutant non-human mammalian cell lmes that are deficient m their ability to load class I molecules with internally processed peptides and that have been transfected with the appropriate human class I gene, may be used to test for the capacity of the peptide to induce in vitro pnmary CTL responses
- PBMCs Peripheral blood mononuclear cells
- the appropriate antigen-presentmg cells are mcubated with peptide, after which the peptide-loaded antigen-presentmg cells are then mcubated with the responder cell population under optimized culture conditions
- Positive CTL activation can be determined by assaymg the culture for the presence of CTLs that kill radio-labeled target cells, both specific peptide-pulsed targets as well as target cells expressmg endogenously processed forms of the antigen from which the peptide sequence was de ⁇ ved
- HTL activation may also be assessed usmg such techniques known to those in the art such as T cell proliferation and secretion of lymphokmes, e g IL-2 (see, e g Alexander et al , Immunity 1 751- 761, 1994)
- HLA transgenic mice can be used to determine immunogenicity of peptide epitopes
- transgenic mouse models mcludmg mice with human A2 1, Al l (which can additionally be used to analyze HLA- A3 epitopes), and B7 alleles have been charactenzed and others (e g , transgenic mice for HLA-Al and A24) are bemg developed HLA-DRl and HLA-DR3 mouse models have also been developed
- Additional transgenic mouse models with other HLA alleles may be generated as necessary
- Mice may be immunized with peptides emulsified in Incomplete Freund's Adjuvant and the resulting T cells tested for their capacity to recognize peptide-pulsed target cells and target cells transfected with appropnate genes
- CTL responses may be analyzed usmg cytotoxicity assays described above
- HTL responses may be analyzed usmg such assays as T cell proliferation or secretion of lymphokmes
- HLA class I and class II bindmg peptides as descnbed herem can be used as reagents to evaluate an immune response
- the immune response to be evaluated is mduced by usmg as an immunogen any agent that may result m the production of antigen-specific CTLs or HTLs that recognize and bmd to the peptide ep ⁇ tope(s) to be employed as the reagent
- the peptide reagent need not be used as the immunogen Assay systems that are used for such an analysis mclude relatively recent technical developments such as tetramers, stammg for intracellular lymphokmes and mterferon release assays, or ELISPOT assays
- a peptide of the invention is used in a tetramer stammg assay to assess penpheral blood mononuclear cells for the presence of antigen-specific CTLs following exposure to a pathogen or immunogen
- the HLA-tetrame ⁇ c complex is used to directly visualize
- a tetramer reagent using a peptide of the mvention is generated as follows A peptide that bmds to an HLA molecule is refolded m the presence of the conespondmg HLA heavy cham and ⁇ 2 - microglobulin to generate a tnmolecular complex The complex is biotinylated at the carboxyl termmal end of the heavy cham at a site that was previously engmeered mto the protem Tetramer formation is then mduced by the addition of streptavidm By means of fluorescently labeled streptavidm, the tetramer can be used to stam antigen-specific cells The cells can then be readily identified, for example, by flow cytometry Such procedures are used for diagnostic or prognostic purposes Cells identified by the procedure can also be used for therapeutic purposes
- Peptides of the mvention are also used as reagents to evaluate immune recall responses (see, e g , Bertoni et al , J Clin Invest 100 503-513, 1997 and Penna et al , J Exp Med 174 1565-1570, 1991 )
- patient PBMC samples from mdividuals infected with HPV are analyzed for the presence of antigen-specific CTLs or HTLs using specific peptides
- a blood sample containmg mononuclear cells may be evaluated by cultivating the PBMCs and stimulating the cells with a peptide of the invention After an appropriate cultivation penod, the expanded cell population may be analyzed, for example, for CTL or for HTL activity
- the peptides are also used as reagents to evaluate the efficacy of a vaccme PBMCs obtained from a patient vaccmated with an immunogen are analyzed usmg, for example, either of the methods described above
- the patient is HLA typed, and pepnde epitope reagents that recognize the allele- specific molecules present m that patient are selected for the analysis
- the immunogenicity of the vaccme is mdicated by the presence of HPV epitope-specific CTLs and/or HTLs m the PBMC sample
- the peptides of the invention are also be used to make antibodies, using techniques well known in the art (see, e.g.
- Such antibodies include those that recognize a peptide in the context of an HLA molecule, i.e., antibodies that bind to a peptide-MHC complex.
- Vaccines and methods of preparing vaccines that contain an immunogenically effective amount of one or more peptides as described herein are further embodiments of the invention.
- immunogenic epitopes Once appropriately immunogenic epitopes have been defined, they can be sorted and delivered by various means, herein refened to as "vaccine” compositions.
- Such vaccine compositions can include, for example, lipopeptides (e.g., Vitiello, A. ef al, J. Clin. Invest. 95:341, 1995), peptide compositions encapsulated in poly(DL-lactide-co-glycolide) ("PLG”) microspheres (see, e.g., Eldridge, et al., Molec. Immunol.
- Toxin-targeted delivery technologies also known as receptor mediated targeting, such as those of Avant Immunotherapeutics, Inc. (Needham, Massachusetts) may also be used.
- Vaccine compositions of the invention include nucleic acid-mediated modalities. DNA or RNA encoding one or more of the peptides of the invention can also be administered to a patient. This approach is described, for instance, in Wolff ef. al, Science 247: 1465 (1990) as well as U.S. Patent Nos. 5,580,859; 5,589,466; 5,804,566; 5,739,118; 5,736,524; 5,679,647; WO 98/04720; and in more detail below.
- DNA-based delivery technologies include "naked DNA”, facilitated (bupivicaine, polymers, peptide-mediated) delivery, cationic lipid complexes, and particle-mediated (“gene gun”) or pressure-mediated delivery (see, e.g., U.S. Patent No. 5,922,687).
- the peptides of the invention can be expressed by viral or bactenal vectors
- expression vectors mclude attenuated viral hosts, such as vaccmia or fowlpox
- This approach mvolves the use of vaccinia virus, for example, as a vector to express nucleotide sequences that encode the peptides of the mvention
- the recombmant vaccmia virus Upon introduction mto an acutely or chronically infected host or mto a non-infected host, the recombmant vaccmia virus expresses the immunogenic peptide, and thereby elicits a host CTL and or HTL response
- Vaccmia vectors and methods useful in immunization protocols are descnbed m, e g , U S Patent No 4,722,848
- Another vector is BCG (Bacille Calmette Guenn) BCG vectors are descnbed m Stover e
- vaccmes m accordance with the mvention encompass compositions of one or more of the claimed peptides
- a peptide can be present m a vaccme individually
- the peptide can exist as a homopolymer compnsmg multiple copies of the same peptide, or as a heteropolymer of various peptides
- Polymers have the advantage of mcreased immunological reaction and, where different peptide epitopes are used to make up the polymer, the additional ability to mduce antibodies and/or CTLs that react with different antigenic determmants of the pathogemc orgamsm or mmor-related peptide targeted for an immune response
- the composition can be a naturally occurring region of an antigen or can be prepared, e g , recombmantly or by chemical synthesis
- Carners that can be used with vaccmes of the mvention are well known m the art, and mclude, e g , thyroglobulm, albumins such as human serum albumin, tetanus toxoid, polyamino acids such as poly L-lysme, poly L-glutamic acid, influenza, hepatitis B virus core protem, and the like
- the vaccines can contam a physiologically tolerable (i e , acceptable) diluent such as water, or salme, preferably phosphate buffered salme
- the vaccmes also typically mclude an adjuvant Adjuvants such as mcomplete Freund's adjuvant, aluminum phosphate, alummum hydroxide, or alum are examples of materials well known m the art Additionally, as disclosed herem, CTL responses can be primed by conjugatmg peptides of the invention to lipids, such as t ⁇ palmitoyl-S-
- a peptide composition m accordance with the invention Upon immunization with a peptide composition m accordance with the invention, via injection, aerosol, oral, transdermal, transmucosal, lntrapleural, intrathecal, or other suitable routes, the immune system of the host responds to the vaccme by producmg large amounts of CTLs and/or HTLs specific for the desired antigen Consequently, the host becomes at least partially immune to later mfection, or at least partially resistant to developmg an ongomg chronic infection, or denves at least some therapeutic benefit when the antigen was tumor-associated
- a prefe ⁇ ed embodiment of such a composition compnses class I and class II epitopes m accordance with the mvention
- An alternative embodiment of such a composition comprises a class I and/or class
- Vaccme compositions can also be admmistered in vivo m combmation with dendntic cell mobilization whereby loadmg of dendntic cells occurs in vivo
- Antigenic peptides are used to elicit a CTL and/or HTL response ex vivo, as well
- the resulting CTL or HTL cells can be used to treat chronic infections, or tumors m patients that do not respond to other conventional forms of therapy, or will not respond to a therapeutic vaccme peptide or nucleic acid m accordance with the mvention
- Ex vivo CTL or HTL responses to a particular antigen are mduced by incubating m tissue culture the patient's, or genetically compatible, CTL or HTL precursor cells together with a source of antigen-presenting cells (APC), such as dendntic cells, and the appropriate immunogemc peptide
- APC antigen-presenting cells
- the precursor cells are activated and expanded mto effector cells
- the cells are infused back mto the patient, where they will destroy (CTL) or facilitate destruction (HTL) of their specific target cell (an in
- the vaccme compositions of the invention can also be used m conjunction with other treatments used for cancer, e g , surgery, chemotherapy, drug therapies, radiation therapies, etc including use combmation with immune adjuvants such as IL-2, IL-12, GM-CSF, and the like
- the following principles are utilized when selectmg an anay of epitopes for mclusion m a polyepitopic composition for use a vaccine, or for selectmg discrete epitopes to be mcluded in a vaccme and/or to be encoded by nucleic acids such as a minigene It is prefened that each of the following principles are balanced in order to make the selection
- the multiple epitopes to be mcorporated m a given vaccme composition may be, but need not be, contiguous m sequence m the native antigen from which the epitopes are de ⁇ ved
- Epitopes are selected which, upon administration, mimic immune responses that have been observed to be conelated with clearance of HPV infection or tumor clearance For HLA Class I this mcludes 3-4 epitopes that come from at least one TAA For HLA Class II a similar rationale is employed, again 3-4 epitopes are selected from at least one TAA (see, e g , Rosenberg ef al , Science 278 1447-1450) Epitopes from one TAA may be used combination with epitopes from one or more additional TAAs to produce a vaccme that targets tumors with varying expression patterns of frequently- expressed TAAs as described, e g , in Example 15
- Epitopes are selected that have the requisite bmding affinity established to be conelated with immunogenicity for HLA Class I an IC j0 of 500 nM or less, often 200 nM or less, and for Class II an IC- 0 of 1000 nM or less
- Sufficient supermotif bea ⁇ ng-peptides, or a sufficient anay of allele-specific motif-beanng peptides, are selected to give broad population coverage For example, it is preferable to have at least 80% population coverage
- a Monte Carlo analysis a statistical evaluation known m the art, can be employed to assess the breadth, or redundancy of, population coverage
- nested epitopes Nested epitopes occur where at least two epitopes overlap m a given peptide sequence
- a nested peptide sequence can comp ⁇ se both HLA class I and HLA class II epitopes
- a general objective is to provide the greatest number of epitopes per sequence
- an aspect is to avoid providmg a peptide that is any longer than the ammo termmus of the ammo termmal epitope and the carboxyl termmus of the carboxyl termmal epitope m the peptide
- providmg a multi-epitopic sequence such as a sequence compnsmg nested epitopes, it is generally important to screen the sequence in order to msure that it does not have pathological or other deletenous biological properties
- a polyepitopic protein is created, or when creating a minigene, an objective is to generate the smallest peptide that encompasses the epitopes of interest This principle is similar, if not the same as that employed when selecting a peptide compnsmg nested epitopes
- the size minimization objective is balanced agamst the need to mtegrate any spacer sequences between epitopes m the polyepitopic protem Spacer ammo acid residues can, for example, be introduced to avoid junctional epitopes (an epitope recognized by the immune system, not present m the target antigen, and only created by the man-made juxtaposition of epitopes), or to facilitate cleavage between epitopes and thereby enhance epitope presentation Junctional epitopes are generally to be avoided because the recipient may generate an immune response to that non-native epitope Of particular concern is a junctional epitope that is a
- potential peptide epitopes can also be selected on the basis of their conservancy
- a c ⁇ te ⁇ on for conservancy may define that the entire sequence of an HLA class I bmdmg peptide or the entire 9-mer core of a class II bmdmg peptide be conserved in a designated percentage of the sequences evaluated for a specific protem antigen
- nucleic acids encodmg the peptides of the mvention are a particularly useful embodiment of the invention
- Epitopes for mclusion m a mmigene are preferably selected according to the guidelines set forth m the previous section
- a prefened means of admmistenng nucleic acids encodmg the peptides of the mvention uses mmigene constructs encodmg a peptide compnsmg one or multiple epitopes of the mvention
- multi-epitope mmigenes is descnbed below and m, e g , co-pendmg application U S S N 09/311,784, Ishioka et al , J Immunol 162 3915-3925, 1999, An, L and Whitton, J L , J Virol 71 2292, 1997, Thomson, S A et al , J Immunol 157 822, 1996, Whitton, J L et al , J Virol 67 348, 1993, Hanke, R et al , Vaccine 16 426, 1998
- a multi-epitope DNA plasmid encoding supermotif- and or motif-beanng epitopes derived from multiple regions of one or more HPV antigens, the PADRE universal helper T cell epitope (or multiple HTL epitopes from HPV antigens), and an endoplasmic reticulum-translocatmg signal sequence can be engmeered
- the immunogenicity of a multi-epitopic mmigene can be tested m transgenic mice to evaluate the magnitude of CTL induction responses agamst the epitopes tested Further, the immunogenicity of DNA-encoded epitopes in vivo can be conelated with the in vitro responses of specific CTL lmes agamst target cells transfected with the DNA plasmid Thus, these experiments can show that the mmigene serves to both 1 ) generate a CTL response and 2 ) that the mduced CTLs recognized cells expressmg the encoded epitopes
- the ammo acid sequences of the epitopes may be reverse translated
- a human codon usage table can be used to guide the codon choice for each ammo acid
- the minigene sequence may be converted to DNA by assembling oligonucleotides that encode the plus and minus strands of the mmigene Overlappmg oligonucleotides (30-100 bases long) may be synthesized, phosphorylated, purified and annealed under appropnate conditions using well known techniques The ends of the oligonucleotides can be jomed, for example, usmg T4 DNA hgase This synthetic mmigene, encodmg the epitope polypeptide, can then be cloned mto a desired expression vector Standard regulatory sequences well known to those of skill in the art are preferably mcluded in the vector to ensure expression in the target cells Several vector elements are desirable a promoter with a down-stream clonmg site for minigene insertion, a polyadenylation signal for efficient transcnption termination, an E coli origin of replication, and an E coli selectable marker (e g ampicilhn or
- introns are required for efficient gene expression, and one or more synthetic or naturally-occurnng nitrons could be mcorporated mto the transcnbed region of the mmigene
- mRNA stabilization sequences and sequences for replication mammalian cells may also be considered for increasing mmigene expression
- the mmigene is cloned into the polylinker region downstream of the promoter
- This plasmid is transformed into an appropriate E coli strain, and DNA is prepared usmg standard techniques
- the orientation and DNA sequence of the mmigene, as well as all other elements included the vector, are confirmed using rest ⁇ ction mappmg and DNA sequence analysis
- Bactenal cells harboring the conect plasmid can be stored as a master cell bank and a working cell bank
- lmmunostimulatory sequences appear to play a role m the immunogenicity of DNA vaccines
- ISSs or CpGs appear to play a role m the immunogenicity of DNA vaccines
- These sequences may be mcluded m the vector, outside the mmigene codmg sequence, if desired to enhance immunogenicity
- a bi-cistromc expression vector which allows production of both the minigene-encoded epitopes and a second protem (mcluded to enhance or decrease immunogenicity) can be used.
- protems or polypeptides that could beneficially enhance the immune response if co- expressed mclude cytokines (e g , IL-2, IL-12, GM-CSF), cytokine-inducing molecules (e g , LeIF), costimulatory molecules, or for HTL responses, pan-DR bindmg protems (PADRETM, Epunmune, San
- Helper (HTL) epitopes can be jomed to mfracellular targeting signals and expressed separately from expressed CTL epitopes, this allows direction of the HTL epitopes to a cell compartment different than that of the CTL epitopes If required, this could facilitate more efficient entry of HTL epitopes mto the HLA class II pathway, thereby improving HTL mduction
- immunosuppressive molecules e g TGF- ⁇
- Therapeutic quantities of plasmid DNA can be produced for example, by fermentation in E coli, followed by purification Aliquots from the workmg cell bank are used to moculate growth medium, and grown to saturation m shaker flasks or a bioreactor accordmg to well known techniques Plasmid DNA can be punfied using standard bioseparation technologies such as solid phase anion- exchange resms supplied by QIAGEN, Inc (Valencia, California) If required, supercoiled DNA can be isolated from the open circular and lmear forms usmg gel electrophoresis or other methods
- Purified plasmid DNA can be prepared for injection usmg a variety of formulations The simplest of these is reconstitution of lyophilized DNA in stenle phosphate-buffer salme (PBS) This approach, known as "naked DNA," is cunently bemg used for mtramuscular (IM) administration m clmical trials To maximize the lmmunotherapeutic effects of minigene DNA vaccmes, an alternative method for formulating purified plasmid DNA may be desirable A variety of methods have been described, and new techniques may become available Cationic lipids, glycohpids, and fusogenic liposomes can also be used in the formulation (see, e g , as described by WO 93/24640, Mannino & Gould-Foge ⁇ te, BioTechmques 6(7) 682 (1988), U S Pat No 5,279,833, WO 91/06309, and Feigner, et al , Proc Nat 'I Acad Sci USA
- Target cell sensitization can be used as a functional assay for expression and HLA class I presentation of mmigene-encoded CTL epitopes
- the plasmid DNA is mtroduced mto a mammalian cell Ime that is suitable as a target for standard CTL chromium release assays
- the transfection method used will be dependent on the final formulation Electroporation can be used for "naked" DNA, whereas cationic lipids allow direct in vitro transfection
- a plasmid expressing green fluorescent protem (GFP) can be co-transfected to allow ennchment of transfected cells usmg fluorescence activated cell sorting (FACS)
- FACS fluorescence activated cell sorting
- the nucleic acids can be admmistered usmg ballistic delivery as descnbed, for mstance, m U S Patent No 5,204,253 Using this technique, particles comprised solely of DNA are admmistered In a further alternative embodiment, DNA can be adhered to particles, such as gold particles
- Mmigenes can also be delivered usmg other bactenal or viral delivery systems well known m the art, e g , an expression construct encodmg epitopes of the mvention can be incorporated mto a viral vector such as vaccmia
- Vaccme compositions compnsmg CTL peptides of the mvention can be modified to provide desired attnbutes, such as unproved serum half life, broadened population coverage or enhanced immunogenicity
- desired attnbutes such as unproved serum half life, broadened population coverage or enhanced immunogenicity
- the ability of a peptide to mduce CTL activity can be enhanced by linking the peptide to a sequence which contains at least one epitope that is capable of inducing a T helper cell response
- T helper epitopes m conjunction with CTL epitopes to enhance immunogenicity is illustrated, for example, in the co-pendmg applications U S S N 08/820,360, U S S N 08/197,484, and U S S N 08/464,234
- CTL epitope can be directly linked to a T helper peptide
- CTL epitope/HTL epitope conjugates are linked by a spacer molecule
- the spacer is typically compnsed of relatively small, neutral molecules, such as ammo acids or amino acid mimetics, which are substantially uncharged under physiological conditions
- the spacers are typically selected from, e g , Ala, Gly, or other neutral spacers of nonpolar ammo acids or neutral polar ammo acids It will be understood that the optionally present spacer need not be compnsed of the same residues and thus may be a hetero- or homo- oligomer When present, the spacer will usually be at least one or two residues, more usually three to six residues and sometimes 10 or more residues
- the CTL peptide epitope can be linked to the T helper peptide epitope either directly or via a spacer either at the ammo or carboxy terminus of the CTL peptide The ammo terminus of either the immuno
- the T helper peptide is one that is recognized by T helper cells present in the majonty of the population This can be accomplished by selectmg peptides that bmd to many, most, or all of the HLA class II molecules These are known as "loosely HLA-restncted” or "promiscuous" T helper sequences
- ammo acid sequences that are promiscuous include sequences from antigens such as tetanus toxoid at positions 830-843 (QYIKANSKFIGITE, SEQ ID NO 51484), Plasmodium falciparum circumsporozoite (CS) protem at positions 378-398 (DIEKKIA EKASSVFN NS, SEQ ID NO 51485), and Streptococcus 18kD protem at positions 116 (GAVDSILGGVATYGAA, SEQ ID NO 51486)
- m the pharmaceutical compositions of the mvention at least one component which primes cytotoxic T lymphocytes
- Lipids have been identified as agents capable of priming CTL in vivo against viral antigens
- palmitic acid residues can be attached to the ⁇ -and ⁇ - ammo groups of a lysme residue and then linked, e g , via one or more linking residues such as Gly, Gly-Gly-, Ser, Ser-Ser, or the like, to an immunogenic peptide
- the hpidated peptide can then be administered either directly in a micelle or particle, mcorporated mto a liposome, or emulsified in an adjuvant, e g , mcomplete Freund's adjuvant
- a particularly effective immunogenic composition compnses palmitic acid attached to ⁇ - and ⁇ - ammo groups of Lys, which is attached via linkage, e g , Ser
- E coli hpoprotems such as tnpalmitoyl-S-g.ycerylcysteinlyseryl- serine (P 3 CSS) can be used to prune virus specific CTL when covalently attached to an approp ⁇ ate peptide (see, e g , Deres, et al , Nature 342 561, 1989)
- Peptides of the invention can be coupled to P 3 CSS, for example, and the hpopeptide admmistered to an individual to specifically prime a CTL response to the target antigen
- two such compositions can be combined to more effectively elicit both humoral and cell-mediated responses
- CTL and/or HTL peptides can also be modified by the addition of ammo acids to the termini of a peptide to provide for ease of linking peptides one to another, for coupling to a earner support or larger peptide, for modifying the physical or chemical properties of the peptide or oligopeptide, or the like
- Ammo acids such as tyrosine, cysteme, lysme, glutamic or aspartic acid, or the like, can be introduced at the C- or N-termmus of the peptide or oligopeptide, particularly class I peptides.
- modification at the carboxyl termmus of a CTL epitope may, m some cases, alter bmdmg charactenstics of the peptide
- the peptide or oligopeptide sequences can differ from the natural sequence by bemg modified by term ⁇ nal-NH 2 acylation, e g , by alkanoyl (C1-C20) or thioglycolyl acetylation, termmal-carboxyl amidation, e g , ammonia, methylamine, etc In some mstances these modifications may provide sites for linking to a support or other molecule
- Vaccine Compositions Comprising DC Pulsed with CTL and/or HTL Peptides
- An embodiment of a vaccme composition m accordance with the invention comprises ex vivo administration of a cocktail of epitope-bea ⁇ ng peptides to PBMC, or isolated DC therefrom, from the patient's blood
- a pharmaceutical to facilitate harvesting of DC can be used, such as Progempoietm (Monsanto, St Louis, MO) or GM-CSF/IL-4
- the DC are washed to remove unbound peptides
- a vaccme compnses peptide-pulsed DCs which present the pulsed peptide epitopes complexed with HLA molecules on their surfaces
- the DC can be pulsed ex vivo with a cocktail of peptides, some of which stimulate CTL responses to one or more HPV antigens of interest
- a helper T cell (HTL) peptide such as a PADRE family molecule
- HTL helper T cell
- a vaccme m accordance with the invention preferably comprising epitopes from multiple HPV antigens, is used to treat HPV infection or cancer resulting from HPV infection
- peptides of the present invention and pharmaceutical and vaccme compositions of the invention are typically used to treat and or prevent cancer associated with HPV infection
- Vaccme compositions containing the peptides of the mvention are admmistered to a patient infected with HPV or to an individual susceptible to, or otherwise at risk for, HPV infection to elicit an immune response agamst HPV antigens and thus enhance the patient's own immune response capabilities
- peptides compnsmg CTL and or HTL epitopes of the invention mduce immune responses when presented by HLA molecules and contacted with a CTL or HTL specific for an epitope comprised by the peptide
- the peptides (or DNA encodmg them) can be administered individually or as fusions of one or more peptide sequences
- the manner m which the peptide is contacted with the CTL or HTL is not c ⁇ hcal to
- the vaccinating agent can comprise a population of cells, e g , peptide-pulsed dendntic cells, or HPV-specific CTLs, which have been mduced by pulsmg antigen-presentmg cells in vitro with the peptide or by fransfectmg antigen-presentmg cells with a mmigene of the mvention Such a cell population is subsequently admmistered to a patient m a therapeutically effective dose
- peptide and/or nucleic acid compositions are admmistered to a patient m an amount sufficient to elicit an effective CTL and/or HTL response to the virus antigen and to cure or at least partially anest or slow symptoms and/or complications
- An amount adequate to accomplish this is defined as "therapeutically effective dose"
- Amounts effective for this use will depend on, e g , the particular composition admmistered, the manner of administration, the stage and seventy of the disease bemg treated, the weight and general state of health of the patient, and the judgment of the presc ⁇ bmg physician
- the immunogemc peptides of the mvention, or DNA encodmg them are generally admmistered to an individual already infected with HPV
- the peptides or DNA encoding them can be admmistered individually or as fusions of one or more peptide sequences HPV-infected patients, with or without neoplasia, can be
- composition can be targeted to them, thus minimizing the need for admmistration to a larger population
- Susceptible populations include those individuals who are sexually active
- compositions used for the treatment or prophylaxis of HPV infection can be used, e g , in persons who have not manifested symptoms, e g , genital warts or neoplastic growth
- compositions which stimulate helper T cell responses can also be given m accordance with this embodiment of the mvention
- the dosage for an initial therapeutic immunization generally occurs m a unit dosage range where the lower value is about 1, 5, 50, 500, or 1,000 ⁇ g and the higher value is about 10,000, 20,000, 30,000, or 50,000 ⁇ g
- Dosage values for a human typically range from about 500 ⁇ g to about 50,000 ⁇ g per 70 kilogram patient
- Boostmg dosages of between about 1 0 ⁇ g to about 50,000 ⁇ g of peptide pursuant to a boostmg regimen over weeks to months may be admmistered depending upon the patient's response and condition as determmed by measuring the specific activity of CTL and HTL obtamed from the patient's blood
- Admmistration should contmue until at least clmical symptoms or laboratory tests indicate that the viral infection, or neoplasia, has been eliminated or reduced and for a penod thereafter
- the dosages, routes of administration, and dose schedules are adjusted m accordance with methodologies known m the art In certam embodiments,
- the vaccme compositions of the mvention can also be used purely as prophylactic agents
- the dosage for an initial prophylactic immunization generally occurs m a unit dosage range where the lower value is about 1, 5, 50, 500, or 1000 ⁇ g and the higher value is about 10,000, 20,000, 30,000, or 50,000 ⁇ g
- Dosage values for a human typically range from about 500 ⁇ g to about 50,000 ⁇ g per 70 kilogram patient This is followed by boostmg dosages of between about 1 0 ⁇ g to about 50,000 ⁇ g of peptide admmistered at defined intervals from about four weeks to SLX months after the initial admmistration of vaccme
- the immunogenicity of the vaccme can be assessed by measuring the specific activity of CTL and HTL obtamed from a sample of the patient's blood
- compositions for therapeutic treatment are mtended for parenteral, topical, oral, intrathecal, or local (eg as a cream or topical omtment) administration
- the pharmaceutical compositions are admmistered parentally, e g , intravenously, subcutaneously, intradermally, or intramuscularly
- the mvention provides compositions for parenteral admmistration which compnse a solution of the immunogenic peptides dissolved or suspended m an acceptable earner, preferably an aqueous earner
- aqueous earners may be used, e g , water, buffered water, 0 8% salme, 0 3% glycme, hyaluromc acid and the like
- These compositions may be sterilized by conventional, well known sterilization techniques, or may be sterile filtered
- the resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation bemg combined with a
- a human unit dose form of the peptide composition is typically included m a pharmaceutical composition that compnses a human unit dose of an acceptable earner, preferably an aqueous earner, and is admmistered in a volume of fluid that is known by those of skill m the art to be used for administration of such compositions to humans (see, e g , Remmgton's Pharmaceutical Sciences. 17 th Edition, A Gennaro, Editor, Mack Pubhsmg Co , Easton, Pennsylvania, 1985)
- the peptides of the mvention, and/or nucleic acids encodmg the peptides can also be admmistered via liposomes, which may also serve to target the peptides to a particular tissue, such as lymphoid tissue, or to target selectively to mfected cells, as well as to mcrease the half-life of the peptide composition
- liposomes mclude emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like
- the peptide to be delivered is incorporated as part of a liposome, alone or m conjunction with a molecule which bmds to a receptor prevalent among lymphoid cells, such as monoclonal antibodies which bmd to the CD45 antigen, or with other therapeutic or immunogenic compositions
- liposomes either filled or decorated with a desired peptide of the mvention can be directed to the site of lymphoi
- a ligand to be mcorporated mto the liposome can mclude, e g , antibodies or fragments thereof specific for cell surface determinants of the desired immune system cells
- a liposome suspension containing a peptide may be admmistered intravenously, locally, topically, efc in a dose which vanes accordmg to, inter aha, the manner of admmistration, the peptide bemg delivered, and the stage of the disease bemg treated
- nontoxic solid earners may be used which mclude, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like
- a pharmaceutically acceptable nontoxic composition is formed by incorporating any of the normally employed excipients, such as those earners previously listed, and generally 10-95% of active ingredient, that is, one or more peptides of the invention, and more preferably at a concentration of 25%-75%.
- the immunogenic peptides are preferably supplied m finely divided form along with a surfactant and propellant Typical percentages of peptides are 0 01%-20% by weight, preferably 1%-10%
- the surfactant must, of course, be nontoxic, and preferably soluble m the propellant
- Representative of such agents are the esters or partial esters of fatty actds containing from 6 to 22 carbon atoms, such as caproic, octanoic, launc, palmitic, steanc, hnoleic, hnolenic, oleste ⁇ c and oleic acids with an aliphatic polyhyd ⁇ c alcohol or its cyclic anhydride
- Mixed esters, such as mixed or natural glyce ⁇ des may be employed
- the surfactant may constitute 0 l%-20% by weight of the composition, preferably 0 25-5%.
- the balance of the composition is ordina ⁇ ly propellant.
- a canier can also be
- Neoplastic disease results m the accumulation of several different biochemical alterations of cancer cells, as a function of disease progression It also results in significant levels of uitra- and mter- cancer heterogeneity, particularly m the late, metastatic stage
- HLA class I antigens m tumors has been studied m many different tumor types and alterations have been reported m all types of tumors studied The molecular mechanisms underlining HLA class I alterations have been demonstrated to be quite heterogeneous They mclude alterations in the TAP/processing pathways, mutations of ⁇ 2-m ⁇ croglobul ⁇ n and specific HLA heavy chams, alterations m the regulatory elements controlling over class I expression and loss of entire chromosome sections.
- e g Ganido F, et al , Natural history of HLA expression during tumour development Immunol Today 14(10) 491-499, 1993, Kaklamanis L, ef al , Loss of HLA class-I alleles, heavy chains and ⁇ 2-m ⁇ croglobuhn in colorectal cancer Int J Cancer, 51(3) 379-85, May 28,1992
- HLA Class I alteration complete loss, allele- specific loss and decreased expression
- HLA class I While the complete absence of class I expression will eliminate CTL recognition of those tumor cells, the loss of HLA class I will also render the mmor cells extraordinary sensitive to lysis from NK cells (Ohnmacht, GA, ef al , Heterogeneity m expression of human leukocyte antigens and melanoma- associated antigens m advanced melanoma J Cellular Phys 182 332-338, 2000, Liunggren HG, ef al , Host resistance directed selectively agamst H-2 deficient lymphoma va ⁇ ants Analysis of the mechanism J Exp Med , Dec 1,162(6) 1745-59, 1985, Maio M, ef al , Reduction m susceptibility to natural killer cell- mediated lysis of human FO-1 melanoma cells after mduction of HLA class I antigen expression by transfection with B2m gene J Clin Invest 88(1) 282-9, July 1991, Schner PI, et al , Relationship between myc on
- an embodiment of the present invention comprises a composition of the mvention together with a method or composition that augments functional activity or numbers of NK cells
- Such an embodiment can compnse a protocol that provides a composition of the invention sequentially
- HLA class I expression can be upregulated by gamma IFN, commonly secreted by effector CTL Additionally, HLA class I expression can be mduced m vivo by both alpha and beta IFN (Halloran, ef al Local T cell responses mduce widespread MHC expression J Immunol 148 3837, 1992, Pestka, S, ef al , Interferons and their actions Annu Rev Biochem 56 727-77, 1987) Conversely, decreased levels of HLA class I expression also render cells more susceptible to NK lysis
- HLA expression can render tumor cells more susceptible to NK lysis (Ohnmacht, GA, et al , Heterogeneity expression of human leukocyte antigens and melanoma-associated antigens m advanced melanoma J Cellular Phys 182 332-38, 2000, Liunggren HG, et al , Host resistance directed selectively agamst H-2 deficient lymphoma variants Analysis of the mechanism J Exp Med , 162(6) 1745-59, December 1, 1985, Maio M, ef al , Reduction m susceptibility to natural killer cell-mediated lysis of human FO-1 melanoma cells after mduction of HLA class I antigen expression by transfection with ⁇ 2m gene J Clin Invest 88(1) 282-9, July 1991 , Schner PI, et al , Relationship between myc oncogene activation and MHC class I expression Adv Cancer Res , 60 181-246, 1993) If decreases m
- HLA class I A majority of the tamors express HLA class I, with a general tendency for the more severe alterations to be found in later stage and less differentiated tumors This pattern is encouragmg the context of immunotherapy, especially considering that 1) the relatively low sensitivity of immunohistochemical techniques might underestimate HLA expression m tamors, 2) class I expression can be mduced m tumor cells as a result of local inflammation and lymphokme release, and, 3) class I negative cells are sensitive to lysis by NK cells
- vanous embodiments of the present mvention can be selected m view of the fact that there can be a degree of loss of HLA molecules, particularly m the context of neoplastic disease
- the treating physician can assay a patient's tamor to ascertain whether HLA is bemg expressed If a percentage of tamor cells express no class I HLA, then embodiments of the present mvention that comprise methods or compositions that elicit NK cell responses can be employed as noted herein, such NK-inducmg methods or composition can compnse a Flt3 ligand or ProGP which facilitate mobilization of dendntic cells, the rationale bemg that dendntic cells produce large amounts of IL-12 IL- 12 can also be administered directly in either amino acid or nucleic acid form. It should be noted that compositions in accordance with the invention can be administered concunently with NK cell-inducing compositions, or these compositions can be administered sequentially.
- a tamor retains class I expression and may thus escape NK cell recognition, yet still be susceptible to a.CTL-based vaccine in accordance with the invention which comprises epitopes conesponding to the remaining HLA type.
- the concept here is analogous to embodiments of the invention that include multiple disease antigens to guard against mutations that yield loss of a specific antigen.
- embodiments of the present invention can be combined with alternative therapeutic compositions and methods.
- Such alternative compositions and methods comprise, without limitation, radiation, cytotoxic pharmaceuticals, and/or compositions/methods that induce humoral antibody responses.
- embodiments of the invention can also comprise alpha, beta and/or gamma IFN to facilitate upregualtion of HLA.
- compositions of the invention are administered concunently with the standard therapy.
- the patient's immune system is directed to induce responses against the epitopes comprised by the present inventive compositions.
- the patient Upon removal from the treatment having side effects, the patient is primed to respond to the infectious pathogen should the pathogen load begin to increase.
- Composition of the invention can be provided during the drug holiday as well.
- many therapies are immunosuppressive.
- a composition in accordance with the invention is administered. Accordingly, as the patient's immune system reconstitutes, precious immune resources are simultaneously directed against the cancer.
- Composition of the invention can also be administered concunently with an • immunosuppressive regimen if desired.
- kits can be provided in kit form together with instructions for vaccme administration
- the kit would mclude desired peptide compositions in a container, preferably m unit dosage form and instructions for admmistration
- An alternative kit would mclude a mmigene construct with desired nucleic acids of the mvention in a contamer, preferably m unit dosage form together with instructions for administration Lymphokines such as IL-2 or IL-12 may also be mcluded m the kit
- kit components that may also be desirable mclude, for example, a stenle syringe, booster dosages, and other desired excipients
- Epitopes in accordance with the present mvention were successfully used to mduce an immune response Immune responses with these epitopes have been mduced by administering the epitopes in various forms
- the epitopes have been admmistered as peptides, as nucleic acids, and as viral vectors compnsmg nucleic acids that encode the ep ⁇ to ⁇ e(s) of the mvention
- immune responses have been mduced by direct loadmg of an epitope onto an empty HLA molecule that is expressed on a cell, and via intemalization of the epitope and processmg via the HLA class I pathway, m either event, the HLA molecule expressmg the epitope was then able to mteract with and induce a CTL response
- Peptides can be delivered directly or usmg such agents as liposomes They can additionally be delivered usmg ballistic delivery, m which the peptides are typically
- composition in accordance with the mvention comprises a plurality of peptides
- This plurality or cocktail of peptides is generally admixed with one or more pharmaceutically acceptable excipients
- the peptide cocktail can comprise multiple copies of the same peptide or can comp ⁇ se a mixture of peptides
- the peptides can be analogs of naturally occurring epitopes
- the peptides can compnse artificial amino acids and/or chemical modifications such as addition of a surface active molecule, e g , lipidation, acetylation, glycosylation, biotinylation, phosphorylation etc
- the peptides can be CTL or HTL epitopes
- the peptide cocktail compnses a plurality of different CTL epitopes and at least one HTL epitope
- the HTL epitope can be naturally or non-natarally (e g , PADRE®, Epimmune Inc , San Diego, CA)
- compositions m accordance with the mvention compnses a polypeptide multi-epitope construct, i e , a polyepitopic peptide
- Polyepitopic peptides m accordance with the invention are prepared by use of technologies well-known m the art By use of these known technologies, epitopes in accordance with the mvention are connected one to another
- the polyepitopic peptides can be linear or non-linear, e g , multivalent
- These polyepitopic constructs can compnse artificial amino acids, spacmg or spacer ammo acids, flanking ammo acids, or chemical modifications between adjacent epitope units
- the polyepitopic construct can be a heteropolymer or a homopolymer
- the polyepitopic constructs generally comprise epitopes in a quantity of any whole unit mteger between 2-150 (e g , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18,
- a composition m accordance with the mvention comprises construct which compnses a series, sequence, stretch, etc , of ammo acids that have homology to ( i e ,'co ⁇ esponds to or is contiguous with) to a native sequence
- This stretch of ammo acids compnses at least one subsequence of ammo acids that, if cleaved or isolated from the longer senes of ammo acids, functions as an HLA class I or HLA class II epitope in accordance with the mvention
- the peptide sequence is modified, so as to become a construct as defined herein, by use of any number of techniques known or to be provided m the art
- the polyepitopic constructs can contam homology to a native sequence in any whole unit mteger mcrement from 70-100%, e g , 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82,
- a further embodiment of a composition m accordance with the mvention is an antigen presentmg cell that comprises one or more epitopes in accordance with the mvention
- the antigen presentmg cell can be a "professional" antigen presentmg cell, such as a dendntic cell
- the antigen presentmg cell can compnse the epitope of the mvention by any means known or to be determmed m the art Such means mclude pulsing of dendntic cells with one or more individual epitopes or with one or more peptides that compnse multiple epitopes, by nucleic acid administranon such as ballistic nucleic acid delivery or by other techniques in the art for administration of nucleic acids, mcludmg vector-based, e g viral vector, delivery of nucleic acids
- compositions m accordance with the mvention compnse nucleic acids that encode one or more peptides of the mvention, or nucleic acids which encode a polyepitopic peptide m accordance with the mvention
- vanous nucleic acids compositions will encode the same peptide due to the redundancy of the genetic code
- This embodiment of the mvention comprises DNA or RNA, and in certain embodiments a combination of DNA and RNA.
- compositions comprising nucleic acids that will encode a peptide in accordance with the invention or any other peptide based composition in accordance with the invention, falls within the scope of this invention.
- peptide-based forms of the invention can comprise analogs of epitopes of the invention generated using priniciples already known, or to be known, in the art.
- Principles related to analoging are now known in the art, and are disclosed herein; moreover, analoging principles (heteroclitic analoging) are disclosed in co-pending application serial number U.S.S.N. 09/226,775 filed 6 January 1999.
- compositions of the invention are isolated or purified.
- binding assays can be performed with peptides that are either motif-bearing or not motif-bearing.
- binding assays can be performed with peptides that are either motif-bearing or not motif-bearing.
- HLA class I and class II binding assays using purified HLA molecules were performed in accordance with disclosed protocols (e.g., PCT publications WO 94/20127 and WO 94/03205; Sidney et al., Current Protocols in Immunology 18.3.1 (1998); Sidney, et al, J. Immunol 154:247 (1995); Sette, et al, Mol. Immunol. 31:813 (1994)). Briefly, purified MHC molecules (5 to 500nM) were incubated with various unlabeled peptide inhibitors and 1-lOnM 125 I-radiolabeled probe peptides as described.
- MHC-peptide complexes were separated from free peptide by gel filtration and the fraction of peptide bound was determined.
- each MHC preparation was titered in the presence of fixed amounts of radiolabeled peptides to determine the concentration of HLA molecules necessary to bind 10-20% of the total radioactivity. All subsequent inhibition and direct binding assays were performed using these HLA concentrations.
- Binding assays as outlined above may be used to analyze supermotif and/or motif-bearing epitopes as, for example, described in Example 2.
- Vaccine compositions of the invention can include multiple epitopes that comprise multiple HLA supermotifs or motifs to achieve broad population coverage. This example illustrates the identification of supermotif- and motif-bearing epitopes for the inclusion in such a vaccine composition. Calculation of population coverage was performed using the strategy described below.
- HLA-A2 supermotif-bearing sequences are shown m Table VIII Typically, these sequences are then scored usmg the A2 algorithm and the peptides conespondmg to the positive-scoring sequences are synthesized and tested for their capacity to bmd punfied HLA-A*0201 molecules in vitro (HLA-A*0201 is considered a prototype A2 supertype molecule)
- peptides that bind to HLA-A*0201 with IC 50 values ⁇ 500 nM are shown m Table VIII These peptides are then tested for the capacity to bmd to additional A2-superty ⁇ e molecules (A*0202, A*0203, A*0206, and A*6802) Peptides that bmd to at least three of the five A2-supertype alleles tested are typically deemed A2-supertype cross-reactive bmders Prefened peptides bmd at an affinity equal to or less than 500 nM to three or more HLA-A2 supertype molecules
- Peptides conespondmg to the supermotif-bearing sequences are then synthesized and tested for binding to HLA-A*0301 and HLA-A*1101 molecules, the two most prevalent A3-supertype alleles
- the peptides that are found to bmd one of the two alleles with bmdmg affinities of ⁇ 500 nM, often ⁇ 200 nM, are then tested for bmdmg cross-reactivity to the other common A3-supertype alleles (A*3101,
- Conespondmg peptides are synthesized and tested for bindmg to HLA-B*0702, the most common B7-supertype allele (i e , the prototype B7 supertype allele) Peptides bmdmg B*0702 with IC 50 of
- HLA-Al and -A24 epitopes can, for example, also be incorporated mto potential vaccme constructs
- An analysis of the protem sequence data from the HPV target antigens utilized above can also be performed to identify HLA-Al- and A24-motif-contaimng sequences
- Cross-reactive candidate CTL A2-supermot ⁇ f-bea ⁇ ng peptides that are identified as descnbed m Example 2 were selected for in vitro immunogenicity testmg Testmg was performed usmg the following methodology Target Cell Lines for Cellular Screening:
- the .221A2.1 cell line produced by transferring the HLA-A2.1 gene into the HLA-A, -B, -C null mutant human B-lymphoblastoid cell line 721.221, is used as the peptide-loaded target to measure activity of HLA- A2.1 -restricted CTL.
- This cell line is grown in RPMI-1640 medium supplemented with antibiotics, sodium pyruvate, nonessential amino acids and 10% (v/v) heat inactivated FCS.
- Cells that express an antigen of interest, or transfectants comprising the gene encoding the antigen of interest can be used as target cells to test the ability of peptide-specific CTLs to recognize endogenous antigen.
- DC Dendritic Cells
- PBMCs are thawed in RPMI with 30 g/ml DNAse, washed twice and resuspended in complete medium (RPMI-1640 plus 5% AB human serum, non-essential amino acids, sodium pyruvate, L-glutamine and penicillm/strpetomycin).
- the monocytes are purified by plating 10 x 10 6 PBMC/well in a 6-well plate. After 2 hours at 37°C, the non-adherent cells are removed by gently shaking the plates and aspirating the supernatants.
- the wells are washed a total of three times with 3 ml RPMI to remove most of the non-adherent and loosely adherent cells.
- Three ml of complete medium containing 50 ng/ml of GM-CSF and 1,000 U/ml of IL-4 are then added to each well.
- TNF is added to the DCs on day 6 at 75 ng/ml and the cells are used for CTL induction cultures on day 7.
- CD8+ T-cells are isolated by positive selection with Dynal immunomagnetic beads (Dynabeads® M-450) and the detacha-bead® reagent. Typically about 200-250xl0 6 PBMC are processed to obtain 24xl0 6 CD8 + T-cells (enough for a 48-well plate culture). Briefly, the PBMCs are thawed in RPMI with 30 ⁇ g/ml DNAse, washed once with PBS containing 1% human AB serum and resuspended in PBS/1% AB serum at a concentration of 20xl0 6 cells/ml.
- the magnetic beads are washed 3 times with PBS/AB serum, added to the cells (140 ⁇ l beads/20xl0 6 cells) and incubated for 1 hour at 4°C with continuous mixing.
- the beads and cells are washed 4x with PBS/AB serum to remove the nonadherent cells and resuspended at lOOxlO 6 cells/ml (based on the original cell number) in PBS/AB serum containing lOO ⁇ l/ml detacha-bead® reagent and 30 ⁇ g/ml DNAse.
- the mixture is incubated for 1 hour at room temperature with continuous mixing.
- the beads are washed again with PBS/AB/DNAse to collect the CD8+ T-cells.
- the DC are collected and centrifuged at 1300 rpm for 5-7 minutes, washed once with PBS with 1% BSA, counted and pulsed with 40 ⁇ g/ml of peptide at a cell concentration of l-2xl0 6 /ml in the presence of 3 ⁇ g/ml ⁇ 2 - microglobulm for 4 hours at 20°C.
- the DC are then i ⁇ adiated (4,200 rads), washed 1 time with medium and counted again.
- cytokine-generated DC (@lxl0 5 cells/ml) are co-cultured with 0.25ml of CD8+ T-cells (@2xl0 6 cell/ml) m each well of a 48-well plate in the presence of 10 ng/ml of IL-7.
- Recombinant human IL10 is added the next day at a final concentration of 10 ng/ml and rhuman IL2 is added 48 hours later at lOIU/ml.
- the plates are washed twice with RPMI by tapping the plate gently to remove the nonadherent cells and the adherent cells pulsed with lO ⁇ g/ml of peptide in the presence of 3 ⁇ g/ml ⁇ 2 microglobulin in 0.25ml RPMI/5%AB per well for 2 hours at 37°C.
- Peptide solution from each well is aspirated and the wells are washed once with RPMI. Most of the media is aspirated from the induction cultures (CD8+ cells) and brought to 0.5 ml with fresh media. The cells are then transfened to the wells containing the peptide-pulsed adherent cells.
- rhuman IL10 is added at a final concentration of lOng/ml and rhuman IL2 is added the next day and again 2-3 days later at 50IU/ml (Tsai et al, Critical Reviews in Immunology 18(l-2):65-75, 1998). Seven days later the cultures are assayed for CTL activity in a Cr release assay. In some experiments the cultures are assayed for peptide- specific recognition in the in situ IFN ⁇ ELISA at the time of the second restimulation followed by assay of endogenous recognition 7 days later. After expansion, activity is measured in both assays for a side by side comparison.
- cytotoxicity is determined in a standard (5hr) 51 Cr release assay by assaying individual wells at a single E:T.
- Peptide-pulsed targets are prepared by incubating the cells with lO ⁇ g/ml peptide overnight at 37°C.
- Adherent target cells are removed from culture flasks with trypsin-EDTA.
- Target cells are labelled with 200 ⁇ Ci of 51 Cr sodium chromate (Dupont, Wilmington, DE) for 1 hour at 37°C.
- Labelled target cells are resuspended at 10 6 per ml and diluted 1: 10 with K562 cells at a concentration of 3.3xl0 6 /ml (an NK-sensitive erythroblastoma cell line used to reduce non-specific lysis).
- Target cells (100 ⁇ l) and 1 OO ⁇ l of effectors are plated in 96 well round-bottom plates and incubated for 5 hours at 37°C.
- Immulon 2 plates are coated with mouse anti-human IFN ⁇ monoclonal antibody (4 ⁇ g/ml 0. IM NaHC0 3 , pH8.2) overnight at 4°C.
- the plates are washed with Ca 2+ , Mg 2+ -free PBS/0.05% Tween 20 and blocked with PBS/10% FCS for 2 hours, after which the CTLs (100 ⁇ l/well) and targets (100 ⁇ l/well) are added to each well, leaving empty wells for the standards and blanks (which received media only).
- the target cells either peptide-pulsed or endogenous targets, are used at a concentration of 1x10 cells/ml.
- the plates are incubated for 48 hours at 37°C with 5% C0 2 .
- Recombinant human IFN ⁇ is added to the standard wells starting at 400 pg or
- A2-supermot ⁇ f cross-reactive bindmg peptides are tested m the cellular assay for the ability to mduce peptide-specific CTL m normal individuals
- a peptide is typically considered to be an epitope if it induces peptide-specific CTLs m at least 2 donors (unless otherwise noted) and preferably, also recognizes the endogenously expressed peptide
- PBMCs isolated from HPV-mfected patients Bnefly, PBMCs are isolated from patients, re-stimulated with peptide-pulsed monocytes and assayed for the ability to recognize peptide-pulsed target cells as well as transfected cells endogenously expressmg the antigen
- HLA-A3 supermotif-bearmg cross-reactive bmdmg peptides are also evaluated for immunogenicity using methodology analogous for that used to evaluate the immunogenicity of the HLA- A2 supermotif peptides Evaluation ofB7 immunogenicity
- HLA motifs and supermotifs are useful m the identification and preparation of highly cross-reactive native peptides, as demonstrated herem Moreover, the definition of HLA motifs and supermotifs also allows one to engmeer highly cross-reactive epitopes by identifying residues within a native peptide sequence which can be analoged, or "fixed” to confer upon the peptide certain charactenstics, e g greater cross-reactivity withm the group of HLA molecules that comp ⁇ se a supertype, and or greater bmdmg affinity for some or all of those HLA molecules Examples of analogmg peptides to exhibit modulated bmdmg affinity are set forth in this example
- Peptide engmeenng strategies are implemented to further increase the cross-reactivity of the epitopes For example, on the basis of the data disclosed, e g , related and co-pendmg U S S N
- a peptide is tested for bmdmg to one or all supertype members and then analogued to modulate bmdmg affinity to any one (or more) of the supertype members to add population coverage
- WT peptides must be present endogenously m sufficient quantity to be biologically relevant Analoged peptides have been shown to have mcreased immunogemcity and cross-reactivity by T cells specific for the parent epitope (see, e g , Parkhurst et al , J Immunol 157 2539, 1996, and Pogue et al , Proc Natl Acad Sci
- analog-specific CTLs are also able to recognize the wild-type peptide and, when possible, target cells that endogenously express the epitope Analoging of HLA- A3 and B7 -supermotif-bearing peptides
- HLA-A3 supermotif-bearmg epitopes are generated usmg strategies similar to those employed in analogmg HLA-A2 supermotif-bearing peptides
- peptides bmdmg to 3/5 of the A3-supertype molecules are engineered at primary anchor residues to possess a prefened residue (V, S, M, or A) at position 2
- peptides bmdmg 3 or more B7- supertype alleles can be unproved, where possible, to achieve mcreased cross-reactive bmding
- B7 supermotif-bearmg peptides are, for example, engineered to possess a prefened residue (V, I, L, or F) at the C-terminal p ⁇ mary anchor position, as demonstrated by Sidney et al (J Immunol 157 3480-3490, 1996) Analogumg at primary anchor residues of other motif and/or supermotif-bearmg epitopes is performed m a like manner
- analog-specific CTLs are also able to recognize the wild-type peptide and, when possible, targets that endogenously express the epitope
- HLA supermotifs are of value m engineering highly cross-reactive peptides and/or peptides that bmd HLA molecules with increased affinity by identifying particular residues at secondary anchor positions that are associated with such properties For example, the bmdmg capacity of a
- B7 supermotif-bearmg peptide with an F residue at postion 1 is analyzed
- the peptide is then analoged to, for example, substitute L for F at position 1
- the analoged peptide is evaluated for mcreased bmdmg affinity/ and or mcreased cross-reactivity
- Such a procedure identifies analoged peptides with modulated bmdmg affinity
- Engineered analogs with sufficiently unproved bmdmg capacity or cross-reactivity can also be tested for immunogenicity m HLA-B7-transgen ⁇ c mice, following for example, IFA immunization or lipopeptide immunization Analogued peptides are additionally tested for the ability to stimulate a recall response usmg PBMC from HPV-mfected patients
- cysteine has the propensity to form disulfide bridges and sufficiently alter the peptide structurally so as to reduce bmdmg capacity
- Subtitution of ⁇ -amino butync acid for cysteme not only alleviates this problem, but has been shown to improve bmdmg and crossbmdmg capabilities m some mstances (see, e g , the review by Sette et al , In Persistent Viral Infections, Eds R Ahmed and I Chen, John Wiley & Sons, England, 1999)
- the bmding affinity and/or cross- reactivity of peptide ligands for HLA supertype molecules can be modulated
- HLA class II HTL epitopes To identify HPV-de ⁇ ved, HLA class II HTL epitopes, the protem sequences from the same HPV antigens used for the identification of HLA Class I supermotif/motif sequences were analyzed for the presence of sequences bearmg an HLA-DR-motif or supermotif Specifically, 15-mer sequences were selected comprising a DR-supermotif, further comp ⁇ smg a 9-mer core, and three-residue N- and C- terminal flanking regions (15 ammo acids total)
- Protocols for predictmg peptide bmdmg to DR molecules have been developed (Southwood et al , J Immunol 160 3363-3373, 1998) These protocols, specific for individual DR molecules, allow the scoring, and ranking, of 9-mer core regions Each protocol not only scores peptide sequences for the presence of DR-supermotif primary anchors (I e , at position 1 and position 6) within a 9- mer core, but additionally evaluates sequences for the presence of secondary anchors Usmg allele specific selection tables (see, e g , Southwood ef al , ibid ), it has been found that these protocols efficiently select peptide sequences with a high probability of bindmg a particular DR molecule Additionally, it has been found that performing these protocols in tandem, specifically those for DRl, DR4w4, and DR7, can efficiently select DR cross-reactive peptides
- HPV-denved peptides identified above are tested for their bmdmg capacity for various common HLA-DR molecules All peptides are initially tested for bmdmg to the DR molecules in the pnmary panel DRl, DR4w4, and DR7 Peptides bmdmg at least 2 of these 3 DR molecules are then tested for bmdmg to DR2w2 ⁇ l, DR2w2 ⁇ 2, DR6wl9, and DR9 molecules m secondary assays Finally, peptides bindmg at least 2 of the 4 secondary panel DR molecules, and thus cumulatively at least 4 of 7 different DR molecules, are screened for bmdmg to DR4wl5, DR5wl 1, and DR8w2 molecules m tertiary assays Peptides bmdmg at least 7 of the 10 DR molecules comp ⁇ smg the primary, secondary, and tertiary screenmg assays are considered
- HLA-DR3 is an allele that is prevalent m Caucasian, Black, and Hispanic populations
- DR3 bmdmg capacity is an important c ⁇ tenon m the selection of HTL epitopes
- data generated previously mdicated that DR3 only rarely cross-reacts with other DR alleles (Sidney et al .
- conespondmg peptides are then synthesized and tested for the ability to bmd DR3 with an affinity of 1 ⁇ M or better, I e , less than 1 ⁇ M Peptides are found that meet this bindmg criterion and qualify as HLA class II high affinity bmders
- DR3 binding epitopes identified in this manner are mcluded m vaccme compositions with DR supermotif-bearmg peptide epitopes
- the class II motif-bearmg peptides are analoged to improve affinity or cross-reactivity
- aspartic acid at position 4 of the 9-mer core sequence is an optimal residue for DR3 bindmg, and substitution for that residue often improves DR 3 bmdmg
- Immunogemcity of HTL epitopes are evaluated m a manner analogous to the determmation of immunogenicity of CTL epitopes by assessmg the ability to stimulate HTL responses and or by usmg appropnate transgenic mouse models Immunogemcity is determined by screening for 1 ) in vitro pnmary mduction using normal PBMC or 2 ) recall responses from cancer patient PBMCs
- This example illustrates the assessment of the breadth of population coverage of a vaccme composition compnsed of multiple epitopes compnsmg multiple supermotifs and/or motifs
- transgenic mouse model to be used for such an analysis depends upon the ep ⁇ tope(s) that is bemg evaluated
- transgenic mouse models mcludmg mice with human Al 1, which may also be used to evaluate A3 epitopes, and B7 alleles have been charactenzed and others (e , transgenic mice for HLA-Al and A24) are being developed HLA-DRl and HLA-DR3 mouse models have also been developed, which may be used to evaluate HTL epitopes
- This example illustrates the mduction of CTLs and HTLs m transgenic mice by use of a tamor associated antigen CTL/HTL peptide conjugate whereby the vaccine composition compnses peptides to be administered to an HPV-infected patient
- the peptide composition can comprise multiple CTL and/or HTL epitopes and further, can comprise epitopes selected from multiple HPV target antigens
- the epitopes are identified usmg methodology as descnbed in Examples 1-6
- This analysis demonstrates the enhanced immunogemcity that can be achieved by mclusion of one or more HTL epitopes in a vaccine composition
- Such a peptide composition can comprise an HTL epitope conjugated to a prefened CTL epitope containing, for example, at least one CTL epitope that bmds to multiple HLA family members at an affinity of 500 nM or less, or analogs of that epitope
- the peptides may be hpidated, if
- mice which are transgenic for the human HLA A2 1 allele and are useful for the assessment of the immunogemcity of HLA-A*0201 motif- or HLA-A2 supermotif-bearmg epitopes, are primed subcutaneously (base of the tail) with a 0 1 ml of peptide m Incomplete Freund's Adjuvant, or if the peptide composition is a hpidated CTL/HTL conjugate, m DMSO/sahne or if the peptide composition is a polypeptide, in PBS or Incomplete Freund's Adjuvant Seven days after priming, splenocytes obtamed from these animals are restimulated with syngemc uradiated LPS-activated lymphoblasts coated with peptide
- Cell lmes Target cells for peptide-specific cytotoxicity assays are Jurkat cells transfected with the HLA-A2 1/K b chimenc gene (e g , Vitiello et al , J Exp Med 173 1007, 1991)
- HLA-A2 1/K b chimenc gene e g , Vitiello et al , J Exp Med 173 1007, 1991
- spleen cells (30xl0 6 cells/flask) are co- cultured at 37°C with syngeneic, uradiated (3000 rads), peptide coated lymphoblasts (lOxlO 6 cells/flask) m 10 ml of culture med ⁇ um/T25 flask After six days, effector cells are harvested and assayed for cytotoxic activity
- Target cells (1 0 to 1 5xl0 6 ) are mcubated at 37°C m the presence of 200 ⁇ l of 51 Cr After 60 mmutes, cells are washed three times and resuspended m R10 medium Peptide is added where required at a concentration of 1 ⁇ g/ml
- 10 4 51 Cr-labeled target cells are added to different concentrations of effector cells (final volume of 200 ⁇ l) m U-bottom 96-well plates After a 6 hour incubation period at 37°C, a 0 1 ml aliquot of supernatant is removed from each well and radioactivity is determmed m a Micromedic automatic gamma counter
- percent 51 Cr release data is expressed as
- the peptides m the composition can be m the form of a nucleic acid sequence, either smgle or one or more sequences (i e , mmigene) that encodes pept ⁇ de(s), or can be smgle and/or polyepitopic peptides
- the following prmciples are utilized when selecting an anay of epitopes for inclusion m a vaccme composition Each of the following prmciples is balanced m order to make the selection
- Epitopes are selected which, upon admmistration, mimic immune responses that have been observed to be conelated with HPV clearance
- the number of epitopes used depends on observations of patients who spontaneously clear HPV For example, if it has been observed that patients who spontaneously clear HPV generate an immune response to at least 3 epitopes on at least one HPV antigen, then 3-4 epitopes should be mcluded for HLA class I
- a similar rationale is used to determme HLA class II epitopes
- Epitopes are often selected that have a bmdmg affinity of an IC 50 of 500 nM or less for an HLA class I molecule, or for class II, an IC 50 of 1000 nM or less Sufficient supermotif bearmg peptides, or a sufficient anay of allele-specific motif bearing peptides, are selected to give broad population coverage
- epitopes are selected to provide at least 80% population coverage
- a Monte Carlo analysis a statistical evaluation known m the art, can be employed to assess breadth, or redundancy, of population coverage
- potential peptide epitopes can also be selected on the basis of then conservancy
- a cntenon for conservancy may define that the entire sequence of an HLA class I bmdmg peptide or the entire 9-mer core of a class II bmdmg peptide be conserved in a designated percentage of the sequences evaluated for a specific protein antigen.
- a vaccme composition comprised of selected peptides, when administered, is safe, efficacious, and elicits an immune response similar m magnitude to an immune response that controls or clears an acute HPV infection.
- Mmigene plasmids may, of course, contain vanous configurations of CTL and/or HTL epitopes or epitope analogs as descnbed herem. Examples of the construction and evaluation of expression plasmids are descnbed, for example, in co-pendmg U S S N 09/311,784 filed 5/13/99
- a mmigene expression plasmid typically mcludes multiple CTL and HTL peptide epitopes.
- HLA-A2, -A3, -B7 supermotif-bearmg peptide epitopes and HLA-Al and -A24 motif-beanng peptide epitopes are used m conjunction with DR supermotif-bearmg epitopes and/or DR3 epitopes
- HLA class II epitopes are selected from multiple HPV antigens to provide broad population coverage, i e both HLA DR-1-4-7 supermotif-bearmg epitopes and HLA DR-3 motif-beanng epitopes are selected for mclusion m the mmigene construct
- Such a construct may additionally mclude sequences that direct the HTL epitopes to the endoplasmic reticulum
- the Ii protem may be fused to one or more HTL epitopes as descnbed m co-pendmg application U.S. S N. 09/311,784 filed 5/13/99, wherem the CLIP sequence of the Ii protem is removed and replaced with an HLA class II epitope sequence so that HLA class II epitope is directed to the endoplasmic reticulum, where the epitope bmds to an HLA class II molecules
- This example illustrates the methods to be used for construction of a mmigene-beanng expression plasmid.
- Other expression vectors that may be used for mmigene compositions are available and known to those of skill m the art
- the minigene DNA plasmid of this example contams a consensus Kozak sequence and a consensus munne kappa Ig-hght cham signal sequence followed by CTL and or HTL epitopes selected m accordance with prmciples disclosed herem
- the sequence encodes an open readmg frame fused to the Myc and His antibody epitope tag coded for by the pcDNA 3 1 Myc-His vector
- Overlappmg oligonucleotides that can, for example, average about 70 nucleotides m length with 15 nucleotide overlaps, are synthesized and HPLC-punfied
- the oligonucleotides encode the selected peptide epitopes as well as appropriate linker nucleotides, Kozak sequence, and signal sequence
- the final multiepitope minigene is assembled by extendmg the overlappmg oligonucleotides m three sets of reactions usmg PCR.
- a Perkin/ ⁇ lmer 9600 PCR machme is used and a total of 30 cycles are performed usmg the following conditions: 95°C for 15 sec, annealing temperature (5° below the lowest calculated Tm of each primer pair) for 30 sec, and 72°C for 1 mm
- Example 12 The plasmid construct and the degree to which it mduces immunogemcity
- the degree to which a plasmid construct, for example a plasmid constructed m accordance with Example 11, is able to mduce immunogenicity can be evaluated in vitro by testmg for epitope presentation by APC following transduction or transfection of the APC with an epitope-expressmg nucleic acid construct Such a study determines "antigenicity" and allows the use of human APC
- the assay determines the ability of the epitope to be presented by the APC m a context that is recognized by a T cell by quantifying the density of epitope-HLA class I complexes on the cell surface Quantitation can be performed by directly measuring the amount of peptide eluted from the APC (see, e g , Sijts et al , J Immunol 156 683-692, 1996, Demotz ef al , Nature 342 682-684, 1989), or the number of peptide-HLA class I complexes can be estimated by measuring the amount of lysis
- HLA-A2 1/K b transgenic mice for example, are immunized intramuscularly with 100 ⁇ g of naked cDNA.
- a control group of animals is also immunized with an actual peptide composition that comprises multiple epitopes synthesized as a smgle polypeptide as they would be encoded by the mmigene Splenocytes from immunized animals are stimulated twice with each of the respective compositions (peptide epitopes encoded m the mmigene or the polyepitopic peptide), then assayed for peptide-specific cytotoxic activity m
- I-A b - restricted mice are immunized intramuscularly with 100 ⁇ g of plasmid DNA
- a group of control animals is also immunized with an actual peptide composition emulsified in complete Freund's adjuvant CD4+ T cells, i e HTLs, are punfied from splenocytes of immunized animals and stimulated with each of the respective compositions (peptides encoded in the mmigene)
- the HTL response is measured usmg a 3 H-thym ⁇ dme incorporation proliferation assay, (see, e g , Alexander et al Immunity 1 751-761, 1994)
- the results are measured usmg a 3 H-thym ⁇ dme incorporation proliferation assay, (see, e g , Alexander et al Immunity 1 751-761, 1994) The results
- DNA mmigenes constructed as described m Example 11 may also be evaluated as a vaccme m combmation with a boosting agent usmg a prime boost protocol
- the boostmg agent can consist of recombmant protem (e g , Bamett ef al , Aids Res and Human Retroviruses 14, Supplement 3 S299- S309, 1998) or recombmant vaccmia, for example, expressmg a mmigene or DNA encodmg the complete protem of interest (see, e g , Hanke ef al , Vaccine 16 439-445, 1998, Sedegah et al , Proc Natl Acad Sci USA 95 7648-53, 1998, Hanke and McMichael, Immunol Letters 66 177-181, 1999, and Robmson et al , Nature Med 5 526-34, 1999)
- mice are immunized IM with 100 g of a DNA mmigene encodmg the immunogenic peptides mcludmg at least one HLA-A2 supermotif-bearmg peptide
- the mice are boosted IP with 10 7 pfu mouse of a recombmant vaccmia virus expressmg the same sequence encoded by the DNA mmigene
- Control mice are immunized with 100 g of DNA or recombmant vaccmia without the mmigene sequence, or with DNA encodmg the minigene, but without the vaccmia boost
- splenocytes from the mice are immediately assayed for peptide-specific activity m an
- Vaccine compositions of the present mvention can be used to prevent HPV infection m persons who are at nsk for such infection
- a polyepitopic peptide epitope composition (or a nucleic acid comp ⁇ smg the same) contammg multiple CTL and HTL epitopes such as those selected m Examples 9 and or 10, which are also selected to target greater than 80% of the population, is admmistered to individuals at nsk for HPV mfection
- a peptide-based composition can be provided as a single polypeptide that encompasses multiple epitopes
- the vaccine is typically admmistered m a physiological solution that compnses an adjuvant, such as Incomplete Freunds Adjuvant
- the dose of peptide for the initial immunization is from about 1 to about 50,000 ⁇ g, generally 100-5,000 ⁇ g, for a 70 kg patient.
- the initial administration of vaccme is followed by booster dosages at 4 weeks followed by evaluation of the magnitude of the immune response m the patient, by techniques that determme the presence of epitope- specific CTL populations m a PBMC sample Additional booster doses are administered as required
- the composition is found to be both safe and efficacious as a prophylaxis against HPV mfection.
- composition typically compnsmg transfecting agents can be used for the admmistration of a nucleic acid-based vaccme m accordance with methodologies known m the art and disclosed herem
- a native HPV polyprotem sequence is screened, preferably usmg computer algorithms defined for each class I and or class II supermotif or motif, to identify "relatively short” regions of the polyprotem that comprise multiple epitopes and is preferably less m length than an entire native antigen.
- This relatively short sequence that contains multiple distmct, even overlappmg, epitopes is selected and used to generate a mmigene construct.
- the construct is engmeered to express the peptide, which conesponds to the native protem sequence
- the "relatively short" peptide is generally less than 250 amino acids m length, often less than 100 ammo acids in length, preferably less than 75 ammo acids m length, and more preferably less than 50 ammo acids in length.
- the protem sequence of the vaccme composition is selected because it has maximal number of epitopes contamed with the sequence, . e , it has a high concentration of epitopes
- epitope motifs may be nested or overlappmg (i e , frame shifted relative to one another) For example, with f overlappmg epitopes, two 9-mer epitopes and one 10-mer epitope can be present m a 10 ammo acid peptide.
- Such a vaccme composition is admmistered for therapeutic or prophylactic purposes.
- the vaccine composition will mclude, for example, three CTL epitopes from at least one HPV target antigen and at least one HTL epitope
- This polyepitopic native sequence is admmistered either as a peptide or as a nucleic acid sequence which encodes the peptide Alternatively, an analog can be made of this native sequence, whereby one or more of the epitopes comp ⁇ se substitutions that alter the cross- reactivity and or bmdmg affinity properties of the polyepitopic peptide
- the embodiment of this example provides for the possibility that an as yet undiscovered aspect of immune system processmg will apply to the native nested sequence and thereby facilitate the production of therapeutic or prophylactic immune response-mducmg vaccme compositions Additionally such an embodiment provides for the possibility of motif-beanng epitopes for an HLA makeup that is presently unknown.
- this embodiment (absent analogs) directs the immune response to multiple peptide sequences that are actually present in native HPV antigens thus avoidmg the need to evaluate any junctional epitopes Lastly, the embodiment provides an economy of scale when producing nucleic acid vaccine compositions Related to this embodiment, computer programs can be derived in accordance with prmciples m the art, which identify in a target sequence, the greatest number of epitopes per sequence length
- HPV peptide epitopes of the present mvention are used m conjunction with peptide epitopes from other target tumor-associated antigens to create a vaccme composition that is useful for the prevention or treatment of cancer resulting from HPV mfection m multiple patients
- a vaccme composition can be provided as a smgle polypeptide that mcorporates multiple epitopes from HPV antigens as well as tumor-associated antigens that are often expressed with a target cancer, e g , cervical cancer, associated with HPV mfection, or can be admmistered as a composition comprising one or more discrete epitopes
- the vaccine can be administered as a mmigene construct or as dendntic cells which have been loaded with the peptide epitopes in vitro
- Example 16 Use of peptides to evaluate an immune response
- Peptides of the mvention may be used to analyze an immune response for the presence of specific CTL or HTL populations directed to HPV Such an analysis may be performed in a manner as that descnbed by Ogg et al , Science 279 2103-2106, 1998
- peptides m accordance with the mvention are used as a reagent for diagnostic or prognostic purposes, not as an immunogen
- tetramers are used for a cross-sectional analysis of, for example, HPV HLA-A* 0201 -specific CTL frequencies from HLA A*0201 -positive mdividuals at different stages of mfection or following immunization usmg an HPV peptide contammg an A*0201 motif Tetramenc complexes are synthesized as descnbed (Musey et al .
- Example 17 Use of Peptide Epitopes to Evaluate Recall Responses
- the peptide epitopes of the mvention are used as reagents to evaluate T cell responses, such as acute or recall responses, in patients Such an analysis may be performed on patients who have recovered from infection, who are chronically mfected with HPV, or who have been vaccinated with an HPV vaccine
- the class I restncted CTL response of persons who have been vaccmated may be analyzed.
- the vaccme may be any HPV vaccme PBMC are collected from vaccmated mdividuals and HLA typed Approp ⁇ ate peptide epitopes of the mvention that, optimally, bear supermotifs to provide cross-reactivity with multiple HLA supertype family members, are then used for analysis of samples derived from mdividuals who bear that HLA type
- PBMC from vaccinated individuals are separated on Ficoll-Histopaque density gradients (Sigma Chemical Co., St. Louis, MO), washed three times m HBSS (GIBCO Laboratories), resuspended in RPMI-1640 (GIBCO Laboratories) supplemented with L-glutamine (2mM), penicillin (50U/ml), streptomycin (50 ⁇ g/ml), and Hepes (lOmM) contammg 10% heat-mactivated human AB serum (complete RPMI) and plated using microculture formats.
- a positive CTL response requires two or more of the eight replicate cultures to display greater than 10% specific 51 Cr release, based on comparison with uninfected control subjects as previously described (Rehermann, et al , Nature Med 2 1104,1108, 1996, Rehermann et al , J Clin Invest 97 1655-1665, 1996, and Rehermann et al J Chn Invest 98 1432-1440, 1996)
- Target cell lmes are autologous and allogeneic EBV-transformed B-LCL that are either purchased from the American Society for Histocompatibihty and Immunogenetics (ASHI, Boston, MA) or established from the pool of patients as descnbed (Guilhot, et al J Virol ,6.2670-2678, 1992).
- Target cells consist of either allogeneic HLA-matched or autologous EBV-transformed B lymphoblastoid cell Ime that are mcubated ovemight with the synthetic peptide epitope of the mvention at 10 ⁇ M, and labeled with 100 ⁇ Ci of 5l Cr (Amersham Corp , Arlmgton Heights, IL) for 1 hour after which they are washed four times with HBSS.
- Cytolytic activity is determmed in a standard 4-h, split well 51 Cr release assay usmg U- bottomed 96 well plates contammg 3,000 targets/well Stimulated PBMC are tested at effector/target (E/T) ratios of 20-50: 1 on day 14 Percent cytotoxicity is determmed from the formula. 100 x [(experimental release-spontaneous release)/max ⁇ mum release-spontaneous release)]. Maximum release is determined by lysis of targets by detergent (2% Triton X-100, Sigma Chemical Co , St Louis, MO) Spontaneous release is ⁇ 25% of maximum release for all expenments
- the results of such an analysis indicate the extent to which HLA-restncted CTL populations have been stimulated by previous exposure to HPV or an HPV vaccme
- the class II restricted HTL responses may also be analyzed Punfied PBMC are cultured in a 96-well flat bottom plate at a density of 1 5xl0 5 cells/well and are stimulated with 10 ⁇ g/ml synthetic peptide, whole antigen, or PHA Cells are routinely plated in replicates of 4-6 wells for each condition After seven days of cultare, the medium is removed and replaced with fresh medium contammg lOU/ml IL- 2 Two days later, 1 ⁇ Ci 3 H-thym ⁇ dme is added to each well and incubation is continued for an additional 18 hours Cellular DNA is then harvested on glass fiber mats and analyzed for 3 H-thym ⁇ d ⁇ ne incorporation Antigen-specific T cell proliferation is calculated as the ratio of 3 H-thym ⁇ d ⁇ ne incorporation in the presence of antigen
- Example 18 Induction Of Specific CTL Response In Humans
- An immunogenic composition comp ⁇ smg CTL and HTL epitopes of the mvention is set up as an IND Phase I, dose escalation study and earned out as a randomized, double-blind, placebo-controlled trial
- Such a trial is designed, for example, as follows
- a total of about 27 individuals are enrolled and divided mto 3 groups
- Group I 3 subjects are injected with placebo and 6 subjects are mjected with 5 ⁇ g of peptide composition,
- Group II 3 subjects are mjected with placebo and 6 subjects are mjected with 50 ⁇ g peptide composition
- Group III 3 subjects are injected with placebo and 6 subjects are mjected with 500 ⁇ g of peptide composition After 4 weeks following the first mjection, all subjects receive a booster moculabon at the same dosage
- the vaccme is found to be both safe and efficacious Example 19 Phase II Trials In Patients Infected With HPV
- Phase II trials are performed to study the effect of administering the CTL-HTL peptide compositions to patients havmg cancer associated with HPV mfection
- the mam objectives of the t ⁇ als are to determine an effective dose and regimen for mducing CTLs in HPV-infected patients with cancer, to establish the safety of inducing a CTL and HTL response in these patients, and to see to what extent activation of CTLs improves the clmical picture of chronically mfected HPV patients, as manifested by a reduction m viral load, e g , the reduction and/or shrinking of lesions
- a reduction m viral load e g
- the studies are performed m multiple centers
- the t ⁇ al design is an open-label, uncontrolled, dose escalation protocol wherem the peptide composition is administered as a single dose followed six weeks later by a smgle booster shot of the same dose
- the dosages are 50, 500 and 5,000 micrograms per injection
- Drug-associated adverse effects (seventy and reversibility) are recorded
- the first group is mjected with 50 micrograms of the peptide composition and the second and third groups with 500 and 5,000 micrograms of peptide composition, respectively
- the patients withm each group range m age from 21-65 and represent diverse ethnic backgrounds All of them are infected with HPV and are HIV, HC V, HBV and delta hepatitis virus (HDV) negative, but are positive for HPV DNA as monitered by PCR
- a prime boost protocol similar in its underlymg principle to that used to evaluate the efficacy of a DNA vaccine in transgenic mice, such as descnbed m Example 12, can also be used for the admmistration of the vaccme to humans
- Such a vaccme regimen can mclude an initial admmistration of, for example, naked DNA followed by a boost usmg recombmant virus encodmg the vaccme, or recombmant protein/polypeptide or a peptide mixture admmistered m an adjuvant
- the initial immunization may be performed using an expression vector, such as that constructed m Example 11, m the form of naked nucleic acid admmistered IM (or SC or ID) m the amounts of 0 5-5 mg at multiple sites
- the nucleic acid (0 1 to 1000 ⁇ g) can also be admmistered usmg a gene gun Following an mcubation period of 3-4 weeks, a booster dose is then admmistered
- the booster can be recombmant fowlpox virus admmistered at a dose of 5-10 7 to 5xl0 9 pfu
- An alternative recombmant virus such as an MVA, canarypox, adenovirus, or adeno-associated virus, can also be used for the booster, or the polyepitopic protem or a mixture of the peptides can be admmistered
- patient blood samples will be obtained before unmumzation as well as at m
- Vaccines comprising peptide epitopes of the mvention can be administered using APCs, or "professional" APCs such as DC
- the peptide-pulsed DC are administered to a patient to stimulate a CTL response in vivo
- dendntic cells are isolated, expanded, and pulsed with a vaccine comprising peptide CTL and HTL epitopes of the mvention
- the dendntic cells are infused back mto the patient to elicit CTL and HTL responses in vivo
- the mduced CTL and HTL then destroy or facilitate destruction of the specific target cells that bear the protems from which the epitopes m the vaccme are derived
- a cocktail of epitope-beanng peptides is admmistered ex vivo to PBMC, or isolated DC therefrom
- a pharmaceutical to facilitate harvesting of DC can be used, such as Progenipoietin (Monsanto, St Louis, MO) or GM
- the number of DC reinfused mto the patient can vary (see, e g Nature Med 4 328, 1998, Nature Med 2 52, 1996 and Prostate 32 272, 1997) Although 2-50 x 10 6 DC per patient are typically admmistered, larger number of DC, such as 10 7 or 10 8 can also be provided Such cell populations typically contain between 50-90% DC
- peptide-loaded PBMC are mjected mto patients without purification of the DC
- PBMC contammg DC generated after treatment with an agent such as Progenipoietin are mjected into patients without purification of the DC
- the total number of PBMC that are admmistered often ranges from 10 8 to 10 10
- the cell doses mjected mto patients is based on the percentage of DC in the blood of each patient, as determmed, for example, by immunofluorescence analysis with specific anti-DC antibodies
- ProgenipoietinTM mobilizes 2% DC m the penpheral blood of a given patient, and that patient is to receive 5 x 10 6 DC
- the patient will be mjected with a total of 2 5 x 10 s peptide-loaded PBMC
- the percent DC mobilized by an agent such as ProgenipoietinTM is typically estimated to be between 2-10%, but can vary
- ex vivo CTL or HTL responses to HPV antigens can be mduced by mcubatmg m tissue culture the patient's, or genetically compatible, CTL or HTL precursor cells together with a source of APC, such as DC, and the appropriate immunogenic peptides After an appropnate mcubation time (typically about 7-28 days), m which the precursor cells are activated and expanded mto effector cells, the cells are infused back mto the patient, where they wdl destroy (CTL) or facilitate destruction (HTL) of then: specific target cells, i e , tumor cells
- CTL wdl destroy
- HTL facilitate destruction
- Another method of identifying motif-beanng peptides is to elute them from cells bearmg defined MHC molecules
- EBV transformed B cell lmes used for tissue typing have been extensively characterized to determine which HLA molecules they express In certain cases these cells express only a single type of HLA molecule
- These cells can be mfected with a pathogenic organism or transfected with nucleic acids that express the antigen of mterest, e g HPV regulatory or structural protems Peptides produced by endogenous antigen processmg of peptides produced consequent to infection (or as a result of transfection) will then bmd to HLA molecules withm the cell and be transported and displayed on the cell surface Peptides are then eluted from the HLA molecules by exposure to mild acid conditions and their ammo acid sequence determmed, e , by mass spectral analysis (e , Kubo et al , J Immunol 152 3913, 1994) Because the majonty of peptides that b
- cell lmes that do not express endogenous HLA molecules can be transfected with an expression construct encoding a single HLA allele
- These cells can then be used as described, i e , they can be infected with a pathogen or transfected with nucleic acid encodmg an antigen of interest to isolate peptides conespondmg to the pathogen or antigen of mterest that have been presented on the cell surface Peptides obtamed from such an analysis will bear mot ⁇ f(s) that conespond to bmdmg to the smgle HLA allele that is expressed in the cell
- a peptide is considered motif-bearing if it has primary anchors at each primary anchor position for a motif or supermotif as specified in the above table.
- a peptide is considered motif-bearing if it has primary anchors at each primary anchor position for a motif or supermotif as specified in the above table.
- A24 preferred Y.F.W.R.H. , 1 “Anchor S.T.C Y.F.W, Y.F.W. 1 "Anchor 9-mer Y.F.W./W F.L.l.W deleterious D.E.G, D,E, G, Q.N.P, D.E,R.H,K, G, A.Q.N,
- Secondary anchor specificities are designated for each position independently.
- Table IV HLA Class I Standard Peptide Binding Affinity.
- A2 A*0201, A*0202, A*0203, A*0204, A*0205, A*0206, A*0207, A*0208, A*0210, A*0211, A*0212, A*0213 A*0209, A*0214, A*6802, A*6901
- A3 A*0301, A*1101, A*3101, A*3301, A*6801 A*0302, A* 1102, A*2603, A*3302, A*3303, A*3401,
- Verified alleles include alleles whose specificity has been determined by pool sequencing analysis, peptide binding assays, or by analysi of the sequences of CTL epitopes.
- Predicted alleles are alleles whose specificity is predicted on the basis of B and F pocket structure to overlap with the supertype specificity.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Virology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Oncology (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Communicable Diseases (AREA)
- Mycology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP00986316A EP1246644A4 (en) | 1999-12-10 | 2000-12-11 | HUMAN PAPILLOMAVIRUS CELLULAR IMMUNE RESPONSE INDUCED BY USE OF PEPTIDE COMPOSITIONS AND NUCLEIC ACID |
| CA2393960A CA2393960C (en) | 1999-12-10 | 2000-12-11 | Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions |
| JP2001543143A JP2004512814A (ja) | 1999-12-10 | 2000-12-11 | ペプチドおよび核酸組成物を使用する、ヒトパピローマウイルスに対する細胞性免疫応答の誘導 |
| MXPA02005639A MXPA02005639A (es) | 1999-12-10 | 2000-12-11 | Induccion de respuestas celulares iinmunologicas al virus de papiloma humano y utilizacion de composiciones de peptidos y acidos nucleico. |
| AU22582/01A AU2258201A (en) | 1999-12-10 | 2000-12-11 | Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions |
| US10/149,136 US7572882B2 (en) | 1999-12-10 | 2000-12-11 | Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions |
| AU2006200654A AU2006200654C1 (en) | 1999-12-10 | 2006-02-16 | Inducing cellular immune responses to human papilloma virus using peptide and nucleic acid compositions |
| US12/292,281 US20090214632A1 (en) | 1999-12-10 | 2008-11-14 | Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions |
| US13/618,996 US20130017253A1 (en) | 1999-12-10 | 2012-09-14 | Inducing Cellular Immune Responses to Human Papillomavirus Using Peptide and Nucleic Acid Compositions |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17270599P | 1999-12-10 | 1999-12-10 | |
| US60/172,705 | 1999-12-10 | ||
| US09/641,528 | 2000-08-15 | ||
| US09/641,528 US7026443B1 (en) | 1999-12-10 | 2000-08-15 | Inducing cellular immune responses to human Papillomavirus using peptide and nucleic acid compositions |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US09/641,528 Continuation-In-Part US7026443B1 (en) | 1999-12-10 | 2000-08-15 | Inducing cellular immune responses to human Papillomavirus using peptide and nucleic acid compositions |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US12/292,281 Division US20090214632A1 (en) | 1999-12-10 | 2008-11-14 | Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2001041799A1 true WO2001041799A1 (en) | 2001-06-14 |
Family
ID=26868370
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2000/033549 Ceased WO2001041799A1 (en) | 1999-12-10 | 2000-12-11 | Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions |
Country Status (7)
| Country | Link |
|---|---|
| US (4) | US7026443B1 (https=) |
| EP (1) | EP1246644A4 (https=) |
| JP (1) | JP2004512814A (https=) |
| AU (3) | AU2258201A (https=) |
| CA (1) | CA2393960C (https=) |
| MX (1) | MXPA02005639A (https=) |
| WO (1) | WO2001041799A1 (https=) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2005032586A1 (en) * | 2003-09-29 | 2005-04-14 | Merck & Co., Inc. | Optimized expression of hpv 45 l1 in yeast |
| WO2008145685A1 (en) * | 2007-05-31 | 2008-12-04 | Genimmune N.V. | Hpv polyepitope constructs and uses thereof |
| EP1732598A4 (en) * | 2003-12-31 | 2009-08-26 | Pharmexa Inc | TRIGGERING CELLULAR IMMUNE RESPONSES TO THE HUMAN PAPILLOVIRUS USING PEPTIDE AND NUCLEIC ACID COMPOSITIONS |
| AU2006236905B2 (en) * | 2005-04-15 | 2010-06-03 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Methods and compositions for producing an enhanced immune response to a human papillomavirus immunogen |
| WO2010086294A2 (en) | 2009-01-28 | 2010-08-05 | Epimmune Inc. | Pan-dr binding polypeptides and uses thereof |
| EP1753845A4 (en) * | 2004-04-28 | 2010-12-15 | Headwaters Heavy Oil Llc | FIXED-BED HYDROPROCESSING METHOD AND SYSTEMS AND METHOD FOR UPGRADING AN EXISTING FIXED BINING SYSTEM |
| US9605215B2 (en) | 2004-04-28 | 2017-03-28 | Headwaters Heavy Oil, Llc | Systems for hydroprocessing heavy oil |
| US9644157B2 (en) | 2012-07-30 | 2017-05-09 | Headwaters Heavy Oil, Llc | Methods and systems for upgrading heavy oil using catalytic hydrocracking and thermal coking |
| US9790440B2 (en) | 2011-09-23 | 2017-10-17 | Headwaters Technology Innovation Group, Inc. | Methods for increasing catalyst concentration in heavy oil and/or coal resid hydrocracker |
| US10822553B2 (en) | 2004-04-28 | 2020-11-03 | Hydrocarbon Technology & Innovation, Llc | Mixing systems for introducing a catalyst precursor into a heavy oil feedstock |
| US11091707B2 (en) | 2018-10-17 | 2021-08-17 | Hydrocarbon Technology & Innovation, Llc | Upgraded ebullated bed reactor with no recycle buildup of asphaltenes in vacuum bottoms |
| US11118119B2 (en) | 2017-03-02 | 2021-09-14 | Hydrocarbon Technology & Innovation, Llc | Upgraded ebullated bed reactor with less fouling sediment |
| US11414607B2 (en) | 2015-09-22 | 2022-08-16 | Hydrocarbon Technology & Innovation, Llc | Upgraded ebullated bed reactor with increased production rate of converted products |
| US11414608B2 (en) | 2015-09-22 | 2022-08-16 | Hydrocarbon Technology & Innovation, Llc | Upgraded ebullated bed reactor used with opportunity feedstocks |
| US11421164B2 (en) | 2016-06-08 | 2022-08-23 | Hydrocarbon Technology & Innovation, Llc | Dual catalyst system for ebullated bed upgrading to produce improved quality vacuum residue product |
| US11732203B2 (en) | 2017-03-02 | 2023-08-22 | Hydrocarbon Technology & Innovation, Llc | Ebullated bed reactor upgraded to produce sediment that causes less equipment fouling |
| US12497569B2 (en) | 2022-05-26 | 2025-12-16 | Hydrocarbon Technology & Innovation, Llc | Method and system for mixing catalyst precursor into heavy oil using a high boiling hydrocarbon diluent |
Families Citing this family (66)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL105554A (en) * | 1992-05-05 | 1999-08-17 | Univ Leiden | Peptides of human papillomavirus for use in preparations elicit a human T cell response |
| US20050100928A1 (en) * | 1999-09-16 | 2005-05-12 | Zycos Inc., A Delaware Corporation | Nucleic acids encoding polyepitope polypeptides |
| CA2425648A1 (en) | 2000-10-19 | 2002-04-19 | Epimmune Inc. | Hla class i and ii binding peptides and their uses |
| US20060222656A1 (en) * | 2005-04-01 | 2006-10-05 | University Of Maryland, Baltimore | MAGE-A3/HPV 16 peptide vaccines for head and neck cancer |
| US7842480B2 (en) * | 2001-05-18 | 2010-11-30 | Mayo Foundation For Medical Education And Research | Chimeric antigen-specific t cell-activating polypeptides |
| US8067535B2 (en) * | 2003-01-24 | 2011-11-29 | The University Of Massachusetts | Identification of gene sequences and proteins involved in vaccinia virus dominant T cell epitopes |
| WO2004067032A2 (en) * | 2003-01-24 | 2004-08-12 | University Of Massachusetts Medical Center | Identification of gene sequences and proteins involved in vaccinia virus dominant t cell epitopes |
| US7981601B2 (en) * | 2003-08-01 | 2011-07-19 | Institute Of Basic Medical Sciences | Method of preparing polyepitope chimeric gene vaccine |
| MY139500A (en) * | 2003-11-12 | 2009-10-30 | Merck Sharp & Dohme | Optimized expression of hpv 58 l1 in yeast |
| US8252893B2 (en) * | 2005-01-31 | 2012-08-28 | Board Of Trustees Of The University Of Arkansas | CD8 T cell epitopes in HPV 16 E6 and E7 proteins and uses thereof |
| CA2523032A1 (en) | 2005-10-07 | 2007-04-07 | Immunovaccine Technologies Inc. | Vaccines for cancer therapy |
| US20070218080A1 (en) * | 2006-03-14 | 2007-09-20 | Mackay Memorial Hospital | Peptide antigen of human papillomavirus type 16 and application thereof |
| CA3057039C (en) * | 2006-07-28 | 2023-02-28 | The Trustees Of The University Of Pennsylvania | Hiv consensus envelope sequences and methods for using same |
| WO2008021296A2 (en) * | 2006-08-14 | 2008-02-21 | Thymon, L.L.C. | Compositions and methods for the treatment and prophylaxis of alzheimer's disease |
| WO2009021063A2 (en) * | 2007-08-06 | 2009-02-12 | The Regents Of The University Of California | Composition and method of use for hcv immunization |
| CN106310293A (zh) | 2007-09-27 | 2017-01-11 | 免疫疫苗技术有限公司 | 在包括连续疏水相的载体中的脂质体在体内输送多核苷酸中的应用 |
| US8652482B2 (en) * | 2007-10-03 | 2014-02-18 | The Board Of Trustees Of The University Of Arkansas | HPV E6 protein T cell epitopes and uses thereof |
| US8722851B2 (en) * | 2007-11-02 | 2014-05-13 | Pain Therapeutics, Inc. | Analgesia with minimal tolerance and dependence by a mu opioid receptor agonist that also binds filamin A |
| WO2009093251A2 (en) * | 2008-01-24 | 2009-07-30 | Gavish-Galilee Bio Applications Ltd | Reovirus vaccine based on sigma c protein sequence |
| KR20090103571A (ko) * | 2008-03-28 | 2009-10-01 | 바이오코아 주식회사 | 면역성 펩타이드 및 그 펩타이드를 포함하는 hpv 관련질환 예방 또는 치료용 조성물 |
| WO2009149021A2 (en) | 2008-06-02 | 2009-12-10 | Dana-Farber Cancer Institute, Inc. | Xbp1, cd138, and cs1 peptides |
| WO2009146523A1 (en) | 2008-06-05 | 2009-12-10 | Immunovaccine Technologies Inc. | Compositions comprising liposomes, an antigen, a polynucleotide and a carrier comprising a continuous phase of a hydrophobic substance |
| TW201000119A (en) * | 2008-06-10 | 2010-01-01 | Oncotherapy Science Inc | MYBL2 epitope peptides and vaccines containing the same |
| TWI526219B (zh) * | 2008-06-19 | 2016-03-21 | 腫瘤療法 科學股份有限公司 | Cdca1抗原決定位胜肽及含此胜肽的疫苗 |
| EP2344191A4 (en) * | 2008-09-02 | 2013-02-13 | Antigen Express Inc | HUMAN PAPILLOMAVIRUS / LI-KEY HYBRIDS AND METHODS OF USE |
| EP2993183B1 (en) * | 2010-02-16 | 2020-02-26 | Österreichische Akademie der Wissenschaften | Anti-hpv e7 antibodies |
| US20120045413A1 (en) * | 2010-04-09 | 2012-02-23 | Mayumi Nakagawa | Human papilloma virus peptide-specific T-cell response for treatment of warts |
| TWI507413B (zh) * | 2010-11-15 | 2015-11-11 | Nat Health Research Institutes | 脂質化多抗原表位疫苗 |
| US8663964B2 (en) * | 2011-07-20 | 2014-03-04 | Tamir Biotechnology, Inc. | Methods of treating human papillomavirus |
| ES2402286B1 (es) * | 2011-09-29 | 2014-03-04 | Universidad De Valladolid | Péptido inmunogénico del gluten y sus aplicaciones. |
| CN113876945A (zh) | 2011-10-06 | 2022-01-04 | 免疫疫苗技术有限公司 | 包括激活或增加tlr2活性的佐剂的脂质体组合物及其应用 |
| US8715681B2 (en) * | 2012-02-02 | 2014-05-06 | Hengsun Pharmaceutical Technology Co. Ltd. | Minimal motifs of linear B-cell epitopes in L1 protein from human papillomavirus type 58 and their applications |
| WO2014007584A1 (en) * | 2012-07-05 | 2014-01-09 | Gwangju Institute Of Science And Technology | Decoy peptides inhibiting protein phosphatase 1-mediated dephosphorylation of phospholamban |
| EP2872532A4 (en) | 2012-07-10 | 2016-04-13 | Oncotherapy Science Inc | CDCA1-EPITOPPEPTIDES FOR TH1 CELLS AND VACCINES THEREWITH |
| JP6374392B2 (ja) | 2012-11-05 | 2018-08-15 | デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド | Xbp1、cd138およびcs1ペプチド、該ペプチドを含有する薬学的組成物、ならびにかかるペプチドおよび組成物を使用する方法 |
| CN104004067B (zh) * | 2013-02-22 | 2017-09-01 | 艾托金生物医药(苏州)有限公司 | 用于检测抗人乳头瘤病毒抗体的抗原及相关免疫检测试剂盒 |
| CN110592133A (zh) * | 2013-05-17 | 2019-12-20 | 北京安百胜生物科技有限公司 | 用汉逊酵母表达系统产生hpv31 l1蛋白的方法 |
| KR101523503B1 (ko) * | 2013-09-17 | 2015-05-29 | 강원대학교산학협력단 | 아디포넥틴으로부터 유래한 펩타이드 및 이를 포함하는 조성물 |
| EP2883550A1 (en) | 2013-12-12 | 2015-06-17 | Deutsches Krebsforschungszentrum Stiftung des Öffentlichen Rechts | Novel promiscuous HPV16-derived T helper epitopes for immunotherapy |
| US9919034B2 (en) | 2014-03-28 | 2018-03-20 | Tamir Biotechnology, Inc. | Methods of treating and prophylactically protecting mammalian patients infected by viruses classified in Baltimore group V |
| KR101677940B1 (ko) * | 2014-07-18 | 2016-11-21 | 연세대학교 산학협력단 | 인유두종바이러스 e7 절단된 펩타이드의 자궁경부암 진단 및 치료 용도 |
| KR101680567B1 (ko) | 2014-07-09 | 2016-11-29 | 연세대학교 산학협력단 | 인유두종바이러스 펩타이드의 자궁경부암 진단 및 치료 용도 |
| US10835598B2 (en) | 2014-08-18 | 2020-11-17 | Orgenesis Inc. | Prophylactic protection against viral infections, particularly HIV |
| EP3261666A4 (en) * | 2015-02-26 | 2018-10-31 | Bioventures, Llc | Recall antigen for promoting t-helper type 1 response |
| DK3271382T3 (da) | 2015-03-16 | 2020-05-04 | Max Delbrueck Centrum Fuer Molekulare Medizin Helmholtz Gemeinschaft | Fremgangsmåde til detektion af nye immunogene T-celleepitoper og isolering af nye antigenspecifikke T-cellereceptorer ved hjælp af et MHC-cellebibliotek |
| SG10201911292SA (en) | 2015-06-15 | 2020-02-27 | Tamir Biotechnology Inc | Pharmaceuticals for treatment of viral infections of the eye |
| CN105175498A (zh) * | 2015-10-09 | 2015-12-23 | 深圳市康尔诺生物技术有限公司 | 一种宫颈癌相关的热休克蛋白复合物及其应用 |
| WO2018039205A1 (en) | 2016-08-23 | 2018-03-01 | Oncopep, Inc. | Peptide vaccines and durvalumab for treating breast cancer |
| WO2018039203A1 (en) | 2016-08-23 | 2018-03-01 | Oncopep, Inc. | Peptide vaccines and durvalumab for treating multiple myeloma |
| CA3058807A1 (en) * | 2017-04-03 | 2018-10-11 | Biontech Us Inc. | Protein antigens and uses thereof |
| GB201713163D0 (en) * | 2017-08-16 | 2017-09-27 | Univ Oxford Innovation Ltd | HPV vaccine |
| JP7385556B2 (ja) | 2017-09-01 | 2023-11-22 | デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド | Bcma抗原に特異的な免疫原性ペプチドおよびその使用 |
| EP3700575A1 (en) | 2017-10-24 | 2020-09-02 | Oncopep, Inc. | Peptide vaccines and pembrolizumab for treating breast cancer |
| WO2019083960A1 (en) | 2017-10-24 | 2019-05-02 | Oncopep, Inc. | PEPTIDE VACCINES AND HDAC INHIBITORS FOR THE TREATMENT OF MULTIPLE MYELOMA |
| WO2019145792A1 (en) * | 2018-01-24 | 2019-08-01 | The Council Of The Queensland Institute Of Medical Research | Hpv immunotherapy |
| TW202023581A (zh) | 2018-08-02 | 2020-07-01 | 日商腫瘤療法 科學股份有限公司 | 來自cdca1的胜肽及含有此的疫苗 |
| CN109517033B (zh) * | 2018-10-31 | 2021-02-05 | 深圳凯联健康生物科技有限公司 | 活性肽、重组载体、重组细胞、抗炎组合物及其制备方法和应用 |
| CN111440811A (zh) * | 2019-02-25 | 2020-07-24 | 武汉凯德维斯生物技术有限公司 | 同时靶向hpv16 l1及hpv16 e5e6e7的宫颈癌疫苗及其制备方法 |
| EP3941938A1 (en) | 2019-03-06 | 2022-01-26 | Dana-Farber Cancer Institute, Inc. | T cell receptors specific to b-cell maturation antigen for treatment of cancer |
| CN111153967B (zh) * | 2019-12-16 | 2023-04-07 | 温州医科大学 | 一种对hpv16 e5蛋白特异性结合的多肽及其应用 |
| CN115867295A (zh) * | 2020-03-23 | 2023-03-28 | 昆士兰医学研究所理事会 | 用于靶向hpv感染细胞的组合物和方法 |
| CN113984947B (zh) * | 2020-07-27 | 2024-05-17 | 中国食品药品检定研究院 | 测定9价hpv疫苗中抗原蛋白含量的特异性肽段及方法 |
| CN114539363B (zh) * | 2020-11-26 | 2023-12-01 | 中国医学科学院基础医学研究所 | 一种c端改造的人乳头瘤病毒11型l1蛋白及其用途 |
| EP4337694A1 (en) | 2021-05-12 | 2024-03-20 | Dana-Farber Cancer Institute, Inc. | Lag3 and gal3 inhibitory agents, xbp1, cs1, and cd138 peptides, and methods of use thereof |
| US12584918B2 (en) * | 2021-09-23 | 2026-03-24 | Arizona Board Of Regents On Behalf Of Arizona State University | Multiplexed lateral flow assay for detection of HPV associated cancer |
| CN120424179A (zh) * | 2025-05-06 | 2025-08-05 | 扬州大学 | 人乳头瘤病毒l1蛋白的b细胞保守表位肽及其在感染早期抗体检测中的应用 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5180806A (en) * | 1988-05-16 | 1993-01-19 | The Scripps Research Institute | Polypeptides and compositions of human papillomavirus latent proteins, diagnostic systems and methods |
| WO1995031476A1 (en) * | 1994-05-17 | 1995-11-23 | The University Of Queensland | Recombinant papilloma virus l1 |
| US5618536A (en) * | 1992-09-03 | 1997-04-08 | The United States Of America As Represented By The Department Of Health And Human Services | Chimeric papillomavirus-like particles |
| US5716620A (en) * | 1992-09-03 | 1998-02-10 | The United States Of America As Represented By The Department Of Health And Human Services | Self-assembling recombinant papillomavirus capsid proteins |
| US5753233A (en) * | 1990-05-10 | 1998-05-19 | Behring Diagnostics Gmbh | Seroreactive epitopes on proteins of human papilloma-virus (HPV) 18 |
Family Cites Families (49)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4235877A (en) * | 1979-06-27 | 1980-11-25 | Merck & Co., Inc. | Liposome particle containing viral or bacterial antigenic subunit |
| FI83662C (fi) | 1980-07-17 | 1991-08-12 | Scripps Clinic Res | Diagnostik antikropp och foerfarande foer dess framstaellning. |
| US4487715A (en) * | 1982-07-09 | 1984-12-11 | The Regents Of The University Of California | Method of conjugating oligopeptides |
| US4599230A (en) * | 1984-03-09 | 1986-07-08 | Scripps Clinic And Research Foundation | Synthetic hepatitis B virus vaccine including both T cell and B cell determinants |
| FR2591227B1 (fr) | 1985-12-06 | 1988-11-10 | Pasteur Institut | Peptides capables d'inhiber les interactions entre les virus lav et les lymphocytes t4, produits qui en sont derives et leurs applications |
| US4837028A (en) * | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
| US5128319A (en) * | 1987-08-28 | 1992-07-07 | Board Of Regents, The University Of Texas System | Prophylaxis and therapy of acquired immunodeficiency syndrome |
| US5013548A (en) * | 1987-09-08 | 1991-05-07 | Duke University | Production of antibodies to HIV |
| US5200320A (en) | 1987-12-07 | 1993-04-06 | National Jewish Center For Immunology And Respiratory Medicine | Method for identifying useful polypeptide vaccines |
| CA2006700A1 (en) | 1989-01-17 | 1990-07-17 | Antonello Pessi | Synthetic peptides and their use as universal carriers for the preparation of immunogenic conjugates suitable for the development of synthetic vaccines |
| IT1238343B (it) | 1989-10-16 | 1993-07-13 | Cesalpino Andrea Fond | Procedimento per la preparazione di vaccini capaci di generare non solo la risposta immune dei linfociti t helper,ma anche un'efficace risposta di linfociti t citotossici,e vaccini con queste caratteristiche |
| GB8924438D0 (en) | 1989-10-31 | 1989-12-20 | Hoffmann La Roche | Vaccine composition |
| DE4015044A1 (de) * | 1990-05-10 | 1991-11-14 | Behringwerke Ag | Seroreaktive epitope auf proteinen des menschlichen papillomavirus (hpv) 18 |
| SE9001705D0 (sv) | 1990-05-11 | 1990-05-11 | Medscand Ab | Saett foer diagnostik av virusbaerande tumoerer genom immunoassay |
| AU8305491A (en) | 1990-08-01 | 1992-03-02 | Cytel Corporation | Novel immunosuppressant peptides |
| JPH06507384A (ja) | 1991-01-22 | 1994-08-25 | ザ イミューン レスポンス コーポレイション | 特定のt細胞群による病理的応答により生じる疾患に対するワクチン投与および方法 |
| DE4143467C2 (de) | 1991-05-17 | 1995-02-09 | Max Planck Gesellschaft | Peptidmotiv und dessen Verwendung |
| US6419931B1 (en) * | 1991-08-26 | 2002-07-16 | Epimmune Inc. | Compositions and methods for eliciting CTL immunity |
| EP0534615B1 (en) | 1991-08-26 | 2001-01-03 | Epimmune Inc. | HLA-restricted hepatitis B virus CTL epitopes |
| US6037135A (en) * | 1992-08-07 | 2000-03-14 | Epimmune Inc. | Methods for making HLA binding peptides and their uses |
| US7252829B1 (en) * | 1998-06-17 | 2007-08-07 | Idm Pharma, Inc. | HLA binding peptides and their uses |
| WO1993021324A1 (en) | 1992-04-21 | 1993-10-28 | Institut Pasteur | Recombinant mutants for inducing specific immune responses |
| IL105554A (en) | 1992-05-05 | 1999-08-17 | Univ Leiden | Peptides of human papillomavirus for use in preparations elicit a human T cell response |
| US5662907A (en) | 1992-08-07 | 1997-09-02 | Cytel Corporation | Induction of anti-tumor cytotoxic T lymphocytes in humans using synthetic peptide epitopes |
| US20020168374A1 (en) | 1992-08-07 | 2002-11-14 | Ralph T. Kubo | Hla binding peptides and their uses |
| US20020177694A1 (en) | 1996-01-23 | 2002-11-28 | Alessandro Sette | Hla binding peptides and their uses |
| US20040096445A1 (en) * | 1999-06-30 | 2004-05-20 | John Sidney | Subunit vaccines with A2 supermotifs |
| WO1994003205A1 (en) | 1992-08-07 | 1994-02-17 | Cytel Corporation | Hla binding peptides and their uses |
| US20020098197A1 (en) | 1994-07-21 | 2002-07-25 | Alesandro Sette | Hla binding peptides and their uses |
| US5405940A (en) | 1992-08-31 | 1995-04-11 | Ludwig Institute For Cancer Research | Isolated nonapeptides derived from MAGE genes and uses thereof |
| DE4238416A1 (de) | 1992-11-13 | 1994-05-19 | Max Planck Gesellschaft | Bestimmung von Peptidmotiven auf MHC-Molekülen |
| BR9406652A (pt) | 1993-03-05 | 1996-09-10 | Cytel Corp | Composição |
| US5853755A (en) | 1993-07-28 | 1998-12-29 | Pharmaderm Laboratories Ltd. | Biphasic multilamellar lipid vesicles |
| US6413935B1 (en) * | 1993-09-14 | 2002-07-02 | Epimmune Inc. | Induction of immune response against desired determinants |
| DE69435171D1 (de) | 1993-09-14 | 2009-01-08 | Pharmexa Inc | Pan dr-bindeproteinen zur erhöhung der immunantwort |
| US20050049197A1 (en) * | 1993-09-14 | 2005-03-03 | Epimmune Inc. | Induction of immune response against desired determinants |
| AUPN015794A0 (en) * | 1994-12-20 | 1995-01-19 | Csl Limited | Variants of human papilloma virus antigens |
| AU5849796A (en) | 1994-12-27 | 1996-08-07 | United Biomedical Inc. | Peptide ratchet libraries for ctl-inducing vaccines and therapeutics |
| JP3958360B2 (ja) * | 1995-02-24 | 2007-08-15 | キャンタブ ファーマシューティカルズ リサーチ リミティド | 免疫治療剤として役立つポリペプチド及びポリペプチド調製の方法 |
| US5821048B1 (en) * | 1995-06-07 | 2000-05-23 | Harvard College | Methods kits and compositions for diagnosing papillomavirus infection |
| AUPN443995A0 (en) * | 1995-07-27 | 1995-08-17 | Csl Limited | Papillomavirus polyprotein |
| JP4108126B2 (ja) | 1996-04-26 | 2008-06-25 | リュクスウニヴェルシテート テ レイデン | T細胞ペプチド・エピトープの選択と産生方法および選択したエピトープを組込むワクチン |
| US5783567A (en) * | 1997-01-22 | 1998-07-21 | Pangaea Pharmaceuticals, Inc. | Microparticles for delivery of nucleic acid |
| CA2323632A1 (en) | 1998-03-13 | 1999-09-16 | Epimmune Inc. | Hla-binding peptides and their uses |
| US6534482B1 (en) * | 1998-05-13 | 2003-03-18 | Epimmune, Inc. | Expression vectors for stimulating an immune response and methods of using the same |
| ATE512666T1 (de) | 1999-06-29 | 2011-07-15 | Epimmune Inc | Hla-bindende peptide und ihre verwendungen |
| EP1230268B1 (en) * | 1999-11-18 | 2009-10-14 | Pharmexa Inc. | Heteroclitic analogs of class i epitopes |
| US6602510B1 (en) * | 2000-04-05 | 2003-08-05 | Epimmune Inc. | HLA class I A2 tumor associated antigen peptides and vaccine compositions |
| US20040157273A1 (en) * | 2001-08-22 | 2004-08-12 | John Sidney | Subunit vaccines with a2 supermotifs |
-
2000
- 2000-08-15 US US09/641,528 patent/US7026443B1/en not_active Expired - Lifetime
- 2000-12-11 AU AU22582/01A patent/AU2258201A/en not_active Abandoned
- 2000-12-11 US US10/149,136 patent/US7572882B2/en not_active Expired - Lifetime
- 2000-12-11 EP EP00986316A patent/EP1246644A4/en not_active Ceased
- 2000-12-11 MX MXPA02005639A patent/MXPA02005639A/es active IP Right Grant
- 2000-12-11 WO PCT/US2000/033549 patent/WO2001041799A1/en not_active Ceased
- 2000-12-11 CA CA2393960A patent/CA2393960C/en not_active Expired - Fee Related
- 2000-12-11 JP JP2001543143A patent/JP2004512814A/ja active Pending
-
2006
- 2006-02-16 AU AU2006200654A patent/AU2006200654C1/en not_active Ceased
-
2008
- 2008-11-14 US US12/292,281 patent/US20090214632A1/en not_active Abandoned
-
2009
- 2009-10-15 AU AU2009225354A patent/AU2009225354A1/en not_active Abandoned
-
2012
- 2012-09-14 US US13/618,996 patent/US20130017253A1/en not_active Abandoned
Patent Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5180806A (en) * | 1988-05-16 | 1993-01-19 | The Scripps Research Institute | Polypeptides and compositions of human papillomavirus latent proteins, diagnostic systems and methods |
| US5753233A (en) * | 1990-05-10 | 1998-05-19 | Behring Diagnostics Gmbh | Seroreactive epitopes on proteins of human papilloma-virus (HPV) 18 |
| US5618536A (en) * | 1992-09-03 | 1997-04-08 | The United States Of America As Represented By The Department Of Health And Human Services | Chimeric papillomavirus-like particles |
| US5716620A (en) * | 1992-09-03 | 1998-02-10 | The United States Of America As Represented By The Department Of Health And Human Services | Self-assembling recombinant papillomavirus capsid proteins |
| US5855891A (en) * | 1992-09-03 | 1999-01-05 | The United States Of America As Represented By The Department Of Health And Human Services | Ichimeric papillomavirus-like particles |
| US5871998A (en) * | 1992-09-03 | 1999-02-16 | The United States Of America As Represented By The Department Of Health And Human Services | Self-assembling recombinant papillomavirus capsid proteins |
| US5985610A (en) * | 1992-09-03 | 1999-11-16 | The United States Of America As Represented By The Department Of Health And Human Services | Self-assembling recombinant papillomavirus capsid proteins |
| WO1995031476A1 (en) * | 1994-05-17 | 1995-11-23 | The University Of Queensland | Recombinant papilloma virus l1 |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP1246644A4 * |
Cited By (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7250170B2 (en) | 2003-09-29 | 2007-07-31 | Merck & Co., Inc. | Optimized expression of HPV 45 L1 in yeast |
| US7482015B2 (en) | 2003-09-29 | 2009-01-27 | Merck & Co., Inc. | Optimized expression of HPV 45 L1 in yeast |
| AU2004277934B2 (en) * | 2003-09-29 | 2009-09-17 | Merck Sharp & Dohme Llc | Optimized expression of HPV 45 L1 in yeast |
| WO2005032586A1 (en) * | 2003-09-29 | 2005-04-14 | Merck & Co., Inc. | Optimized expression of hpv 45 l1 in yeast |
| EP1732598A4 (en) * | 2003-12-31 | 2009-08-26 | Pharmexa Inc | TRIGGERING CELLULAR IMMUNE RESPONSES TO THE HUMAN PAPILLOVIRUS USING PEPTIDE AND NUCLEIC ACID COMPOSITIONS |
| US10941353B2 (en) | 2004-04-28 | 2021-03-09 | Hydrocarbon Technology & Innovation, Llc | Methods and mixing systems for introducing catalyst precursor into heavy oil feedstock |
| US10822553B2 (en) | 2004-04-28 | 2020-11-03 | Hydrocarbon Technology & Innovation, Llc | Mixing systems for introducing a catalyst precursor into a heavy oil feedstock |
| US10118146B2 (en) | 2004-04-28 | 2018-11-06 | Hydrocarbon Technology & Innovation, Llc | Systems and methods for hydroprocessing heavy oil |
| US9920261B2 (en) | 2004-04-28 | 2018-03-20 | Headwaters Heavy Oil, Llc | Method for upgrading ebullated bed reactor and upgraded ebullated bed reactor |
| EP1753845A4 (en) * | 2004-04-28 | 2010-12-15 | Headwaters Heavy Oil Llc | FIXED-BED HYDROPROCESSING METHOD AND SYSTEMS AND METHOD FOR UPGRADING AN EXISTING FIXED BINING SYSTEM |
| US9605215B2 (en) | 2004-04-28 | 2017-03-28 | Headwaters Heavy Oil, Llc | Systems for hydroprocessing heavy oil |
| AU2006236905B2 (en) * | 2005-04-15 | 2010-06-03 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Methods and compositions for producing an enhanced immune response to a human papillomavirus immunogen |
| US8969542B2 (en) | 2007-05-31 | 2015-03-03 | Genimmune N.V. | HPV polyepitope constructs and uses thereof |
| WO2008145685A1 (en) * | 2007-05-31 | 2008-12-04 | Genimmune N.V. | Hpv polyepitope constructs and uses thereof |
| WO2010086294A2 (en) | 2009-01-28 | 2010-08-05 | Epimmune Inc. | Pan-dr binding polypeptides and uses thereof |
| US9790440B2 (en) | 2011-09-23 | 2017-10-17 | Headwaters Technology Innovation Group, Inc. | Methods for increasing catalyst concentration in heavy oil and/or coal resid hydrocracker |
| US9969946B2 (en) | 2012-07-30 | 2018-05-15 | Headwaters Heavy Oil, Llc | Apparatus and systems for upgrading heavy oil using catalytic hydrocracking and thermal coking |
| US9644157B2 (en) | 2012-07-30 | 2017-05-09 | Headwaters Heavy Oil, Llc | Methods and systems for upgrading heavy oil using catalytic hydrocracking and thermal coking |
| US11414607B2 (en) | 2015-09-22 | 2022-08-16 | Hydrocarbon Technology & Innovation, Llc | Upgraded ebullated bed reactor with increased production rate of converted products |
| US11414608B2 (en) | 2015-09-22 | 2022-08-16 | Hydrocarbon Technology & Innovation, Llc | Upgraded ebullated bed reactor used with opportunity feedstocks |
| US11421164B2 (en) | 2016-06-08 | 2022-08-23 | Hydrocarbon Technology & Innovation, Llc | Dual catalyst system for ebullated bed upgrading to produce improved quality vacuum residue product |
| US11118119B2 (en) | 2017-03-02 | 2021-09-14 | Hydrocarbon Technology & Innovation, Llc | Upgraded ebullated bed reactor with less fouling sediment |
| US11732203B2 (en) | 2017-03-02 | 2023-08-22 | Hydrocarbon Technology & Innovation, Llc | Ebullated bed reactor upgraded to produce sediment that causes less equipment fouling |
| US11091707B2 (en) | 2018-10-17 | 2021-08-17 | Hydrocarbon Technology & Innovation, Llc | Upgraded ebullated bed reactor with no recycle buildup of asphaltenes in vacuum bottoms |
| US12497569B2 (en) | 2022-05-26 | 2025-12-16 | Hydrocarbon Technology & Innovation, Llc | Method and system for mixing catalyst precursor into heavy oil using a high boiling hydrocarbon diluent |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2006200654A2 (en) | 2006-03-23 |
| EP1246644A4 (en) | 2005-05-11 |
| CA2393960C (en) | 2015-06-02 |
| US7026443B1 (en) | 2006-04-11 |
| MXPA02005639A (es) | 2004-09-10 |
| AU2258201A (en) | 2001-06-18 |
| CA2393960A1 (en) | 2001-06-14 |
| AU2006200654A1 (en) | 2006-03-23 |
| US20070053922A1 (en) | 2007-03-08 |
| AU2006200654C1 (en) | 2010-03-04 |
| US20130017253A1 (en) | 2013-01-17 |
| US20090214632A1 (en) | 2009-08-27 |
| US7572882B2 (en) | 2009-08-11 |
| EP1246644A1 (en) | 2002-10-09 |
| AU2006200654B2 (en) | 2009-07-30 |
| JP2004512814A (ja) | 2004-04-30 |
| AU2009225354A1 (en) | 2009-11-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2001041799A1 (en) | Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions | |
| US20070014810A1 (en) | Inducing cellular immune responses to human papillomavirus using peptide and nucleic acid compositions | |
| US20040037843A1 (en) | Inducing cellular immune responses to prostate cancer antigens using peptide and nucleic acid compositions | |
| US20070020327A1 (en) | Inducing cellular immune responses to prostate cancer antigens using peptide and nucleic acid compositions | |
| EP1568373A2 (en) | Inducing cellular immune responses to HER2/neu using peptide and nucleic acid compositions | |
| US20070059799A1 (en) | Inducing cellular immune responses to hepatitis B virus using peptide and nucleic acid compositions | |
| US20070054262A1 (en) | Methods of identifying optimal variants of peptide epitopes | |
| US20040018971A1 (en) | Inducing cellular immune responses to her2/neu using peptide and nucleic acid compositions | |
| US20040146519A1 (en) | Inducing cellular immune responses to carcinoembryonic antigen using peptide and nucleic acid compositions | |
| WO2001042267A1 (en) | Inducing cellular immune responses to mage2/3 using peptide and nucleic acid compositions | |
| US20040048790A1 (en) | Inducing cellular immune responses to p53 using peptide and nucleic acid compositions | |
| US20040053822A1 (en) | Inducing cellular immune responses to mage2/3 using peptide and nucleic acid compositions |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG US UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE TR BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2002/005639 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2001 543143 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2393960 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 22582/01 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2000986316 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 2000986316 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2007053922 Country of ref document: US Ref document number: 10149136 Country of ref document: US |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| WWP | Wipo information: published in national office |
Ref document number: 10149136 Country of ref document: US |