WO2001030843A1 - Ligand activated transcriptional regulator proteins - Google Patents
Ligand activated transcriptional regulator proteins Download PDFInfo
- Publication number
- WO2001030843A1 WO2001030843A1 PCT/EP2000/010430 EP0010430W WO0130843A1 WO 2001030843 A1 WO2001030843 A1 WO 2001030843A1 EP 0010430 W EP0010430 W EP 0010430W WO 0130843 A1 WO0130843 A1 WO 0130843A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- fusion protein
- vector
- dna
- sequence
- receptors
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70567—Nuclear receptors, e.g. retinoic acid receptor [RAR], RXR, nuclear orphan receptors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/72—Receptors; Cell surface antigens; Cell surface determinants for hormones
- C07K14/721—Steroid/thyroid hormone superfamily, e.g. GR, EcR, androgen receptor, oestrogen receptor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the field of this invention is the regulation of gene expression.
- ligand-activated fusion proteins also referred to herein as chimeric regulators
- the fusion polypeptides contain a DNA binding domain containing one or a plurality of zinc finger polypeptide domains and a ligand binding domain (LBD) derived from an intracellular receptor.
- LBD ligand binding domain
- Intracellular receptors are a superfamily of related proteins that mediate the nuclear effects of a variety of hormones and effector molecules, include steroid hormones, thyroid hormones and vitamins A and D. Members of this family of intracellular receptors are prototypical ligand activated transcription factors. These receptors contain two primary functional domains: a DNA binding domain (DBD) that contains about sixty-six amino acids and a ligand-binding domain (LBD) located in the carboxyl-terminal half of the receptor that has about 300 amino acids
- DBD DNA binding domain
- LBD ligand-binding domain
- the receptors are inactive in the absence of hormone (ligand) by virtue of association with inactivating factors, such as heat shock proteins. Upon ligand binding, the receptors dissociate from the inactivating complex and dimerize, which renders them able to bind to DNA and modulate transcription. For example, for the steroid receptors, binding of a steroid hormone to its receptor results in receptor protein homodimerization and subsequent binding to the "steroid response element" (SRE) DNA sequence in nuclear DNA. Conformational changes in the receptor associated with ligand binding results in the recruitment of other transcriptional regulatory proteins, called co-activators, that regulate the transcription from promoters adjacent to the SRE binding sites.
- co-activators transcriptional regulatory proteins
- Modified steroid hormone receptors have been developed for use for regulated expression of transgenes (see, e.g., U.S. Patent No. 5,874,534 and published International PCT application No. WO
- polypeptides that function as versatile regulators of gene expression.
- the polypeptides are fusion proteins that are ligand activated transcriptional regulator that can be targeted to any desired endogenous or exogenous gene. Variants of the fusion protein can be designed to have different selectivity and sensitivity for endogenous and exogenous ligands.
- Nucleic acid molecules encoding the fusion proteins, expression vectors containing the nucleic acids and cells containing the expression vectors are provided.
- the fusion protein or nucleic acids, particularly vectors, that encode the fusion protein can be introduced into a cell and, when expressed in the cell, regulate gene expression in a ligand- dependent manner.
- the fusion proteins provided, herein contain a ligand binding domain (designated herein LBD) from an intracellular receptor, preferably a LBD that has modified ligand specificity compared to the native intracellular receptor from which the LBD originates, and a nucleic acid binding domain (designated herein DBD) that can be tailored for any desired specificity.
- LBD ligand binding domain
- DBD nucleic acid binding domain
- the fusion proteins may also include a transcriptional regulating domain (designated herein TRD), particularly a repressor or activator domain. The domains are operatively linked whereby the resulting fusion protein functions as a ligand-regulated targeted transcription factor.
- the domains When delivered to the nucleus of a cell, the domains, which are operatively linked, together act to modulate the expression of a targeted gene, which may be a native gene in a cell or a gene that also is delivered to a cell.
- the targeted gene can be an endogenous cellular gene or an exogenously supplied recombinant polynucleotide construct.
- the fusion protein may also include a transcriptional regulating domain that is selected to activate, enhance or suppress transcription of a targeted gene.
- the fusion protein is constructed from components highly similar to human proteins, preferably components that are about 80% more preferably about 85%, most preferably at least about 90% identical in amino acid sequence to the corresponding human domain.
- the fusion protein binds to a naturally occurring gene and modulates the transcription of the naturally occurring gene in a ligand-dependent way. In another embodiment, the fusion protein binds to an exogenously supplied recombinant construct and modulates the transcription of the exogenously supplied recombinant construct in a ligand-dependent way.
- the isolated recombinant fusion protein forms a dimer when bound to a polynucleotide.
- the dimer can be a homodimer or a heterodimer.
- the dimer includes at least one DNA binding domain, at least one, preferably two, ligand binding domains and at least one transcription modulating domain.
- the dimer can include two different DNA binding domains, two different ligand binding domains or two different transcription modulating domains.
- One exemplary heterodimer includes at least three zinc finger modular units, two different ligand binding sites and a transcription modulating domain.
- Exemplary fusion proteins containing zinc fingers and LBD that are non-responsive to estrogen, and that are induced by synthetic non- steroidal drugs that are routinely used for clinical treatments are described; these regulators provide ligand-dependent gene activation.
- Exemplary fusion proteins comprise the sequence of amino acids encoded by the open reading frame set forth in each of SEQ ID Nos. 1 -18. The fusion proteins can be used in plant species as well as animals.
- Transgenic plants resistant to particular bacterial or viral pathogens can be produced.
- the LBD is derived from an intracellular receptor, particularly a steroid hormone receptor.
- the receptors from which the LBD is derived include, but is not limited to, glucocorticoid receptors, mineralocorticoid receptors, thyroid hormone receptors, retinoic acid receptors, retinoid X receptors, Vitamin D receptors, COUP-TF receptors, ecdysone receptors, Nurr-I receptors, orphan receptors and variants thereof.
- Receptors of these types include, but are not limited to, estrogen receptors, progesterone receptors, glucocorticoid- ⁇ receptors, glucocorticoid- ?
- LBDs preferably are modified to alter ligand specificity so that they preferentially bind to an exogenous ligand, such as a drug, compared to an endogenous ligand.
- the ligand binding domain When intended for human gene therapy, the ligand binding domain preferably retain sufficient identity, typically at least about 90% sequence identity to a human ligand binding domain, to avoid substantial immunological response.
- a single, amino acid change in the LBD can dramatically alter performance of the protein.
- the LBD is preferably modified so that it does not bind to the endogenous ligand for the receptor from which the LBD is derived, but to a selected ligand to permit fine tuned regulation of targeted genes.
- the ligand-binding domain has been modified to change its ligand selectivity compared to its selective in the native receptor.
- the modified ligand-binding domain is not substantially activated by endogenous ligands. Any method for altering ligand specificity, including systematic sequence alteration and testing for specificity, and selection protocols (see, e.g., U.S. Patent No. 5,874,534 and Wang et al. (1994) Proc. Natl. Acad. Sci. U.S.A. 91:8180-8184) can be used.
- Nucleic acid binding domain To achieve targeted and specific transcriptional regulation the DBD includes at least one zinc finger modular unit and is engineered to bind to targeted genes.
- the zinc finger nucleic acid binding domain contains at least two zinc finger modules that bind to selected sequences of nucleotides. Any zinc finger or modular portions thereof can be used.
- the DBD replaces or supplements the naturally-occurring zinc finger domain in the receptor from which the ligand binding domain is derived.
- the nucleic acid binding domain (DBD) includes at least one, preferably at least two, modular units of a zinc finger nucleic acid binding polypeptide, each modular unit specifically recognizing a three nucleotide sequence of bases. The resulting DBD binds to a contiguous sequence of nucleotides of from 3 to about 1 8 nucleotides.
- the DBD contains modular zinc-finger units, where each unit is specific for a trinucleotide. Modular zinc protein units can be combined so that the resulting domain specifically binds to any targeted sequence, generally DNA, such that upon binding of the fusion protein to the targeted sequence transcription of the targeted gene is modulated.
- the zinc finger-nucleotide binding portion of the fusion protein can be derived or produced from a wild type zinc finger protein by truncation or expansion, or as a variant of a wild type-derived polypeptide by a process of site directed mutagenesis, or by combination of a variety of modular units or by a combination of procedures.
- Cys 2 His 2 (C2H2) type zinc finger proteins are exemplary of the zinc fingers that can replace the naturally occurring DNA binding domain in an intracellular receptor, such as the C4-C4 type domian in a steroid receptor, to form a functional ligand-responsive transcription factor fusion protein.
- an intracellular receptor such as the C4-C4 type domian in a steroid receptor
- the resulting fusion protein exhibits altered DNA binding specificity compared to the unmodified intracellular receptor.
- the optimal portion of the ligand binding domain (LBD) of the receptor to use, the zinc finger array and extent thereof and the stoichiometry and orientation of DNA binding can be empirically determined as exemplified herein for a steroid receptor.
- the zinc-finger portion of the fusion protein binds to a nucleotide sequence of the formula (GNN) n , where G is guanidine, N is any nucleotide and n is an integer from 1 to 6, and typically n is 3 to 6.
- the zinc-finger modular unit is derived from C2H2 zinc-finger peptide. More preferably, the zinc-finger peptide is a C2H2 zinc-finger peptide has at least 90% sequence identity to a human zinc-finger peptide.
- Transcription Regulating Domain TRD
- the fusion proteins also can include transcription regulating domains.
- the transcription regulating domain includes a transcription activation domain.
- the transcription regulating domain has at least 90% sequence identity to a mammalian, including human if the fusion protein is intended for human gene therapy, transcription regulating domain to avoid inducing undesirable immunological responses.
- the transcription regulating domain can be any such domain known to regulator or prepared to regulate eukaryotic transcription.
- TRDs are known, and include, but are not limited to, VP16, VP64, TA2, STAT- 6, p65, and derivatives, multimers and combinations thereof that exhibit transcriptional regulation properties.
- the transcription regulating domain can be derived from an intracellular receptor, such as a nuclear hormone receptor transcription activation (or repression) domain, and is preferably a steroid hormone receptor transcription activation domain or variant thereof that exhibits transcriptional regulation properties.
- Transcription domains include, but are not limited to, TAF-1 , TAF-2, TAU-1 , TAU-2, and variants thereof.
- the transcription regulating domain may be a viral transcription activation domain or variant thereof.
- the viral transcription regulating domain comprises a VP16 transcription activation domain or variant thereof.
- the transcription regulating domain can include a transcription repression domain.
- Such domains are known, and include, but are not limited to, transcription repression domains selected from among ERD, KRAB, SID, Deacetylase, and derivatives, multimers and combinations thereof, such as KRAB-ERD, SID-ERD, (KRAB) 2 , (KRAB) 3 , KRAB-A, (KRAB- A) 2 , (SID) 2 (KRAB-A)-SID and SID-(KRAB-A).
- Nucleic acid constructs are known, and include, but are not limited to, transcription repression domains selected from among ERD, KRAB, SID, Deacetylase, and derivatives, multimers and combinations thereof, such as KRAB-ERD, SID-ERD, (KRAB) 2 , (KRAB) 3 , KRAB-A, (KRAB- A) 2 , (SID) 2 (KRAB-A)
- nucleic acid molecules that encode the resulting fusion proteins.
- the nucleic acids can be included in vectors, suitable for expression of the proteins and/or vectors suitable for gene therapy.
- Cell containing the vectors are also provided. Typically the cell is a eukaryotic cell. In other embodiments, the cell is a prokaryotic cell.
- expression cassettes that contain a gene of interest, particularly a gene encoding a therapeutic product, such as an angiogenesis inhibitor, operatively linked to a transcriptional regulatory region or response element, including sequences oT ucleic acids to which a fusion proteins provided herein binds and controls transcription, particularly upon binding of a ligand to the LBD of the fusion polypeptide.
- a therapeutic product such as an angiogenesis inhibitor
- Such expression cassettes can be included in a vector for gene therapy, and are intended for administration with, before or after, administration of the fusion protein or nucleic acid encoding the fusion protein.
- Genes of interest for exogenous delivery typically encode therapeutic proteins, such as growth factors, growth factor inhibitors or antagonists, tumor necrosis factor (TNF) inhibitors, anti-tumor agents, angiogenesis agents, anti- angiogenesis agents, clotting factors, apoptotic and other suicide genes.
- therapeutic proteins such as growth factors, growth factor inhibitors or antagonists, tumor necrosis factor (TNF) inhibitors, anti-tumor agents, angiogenesis agents, anti- angiogenesis agents, clotting factors, apoptotic and other suicide genes.
- TNF tumor necrosis factor
- compositions that contain the fusion proteins or the vectors that encoded the fusion proteins. Combinations of the fusion proteins or nucleic acids encoding the proteins and nucleic acid encoding a targeted gene with regulatory regions selected for activation by the fusion protein are also provided.
- compositions particularly pharmaceutical compositions containing the fusion polypeptides in a pharmaceutically acceptable carrier are also provided.
- Combinations of the expression cassette and fusion polypeptide or nucleic acid molecules, particularly expression vectors that encode the fusion polypeptide are provided.
- the combinations may include separate compositions or a single composition containing both elements. Kits containing the combinations and optionally instructions for administration thereof and other reagents used in preparing and administering the combinations are also provided.
- compositions suitable for gene therapy that contain nucleic acid encoding the fusion protein, typically in a vector suitable for gene therapy are provided.
- Preferred vectors include viral vectors, preferably adenoviral vectors, and lentiviral vectors.
- non-viral delivery systems including DNA-ligand complexes, adenovirus-ligand- DNA complexes, direct injection of DNA, CaPO 4 precipitation, gene gun techniques, electroporation, liposomes and lipofection are provided.
- compositions suitable for regulating gene expression contain an effective amount of the fusion protein or a polynucleotide encoding the ligand activated transcriptional regulatory fusion protein and a pharmaceutically acceptable excipient.
- Such compositions can further include a regulatable expression cassette encoding a gene and at least one response element for the gene recognized by the nucleotide binding domain of the fusion polypeptide.
- the regulatable expression cassette is designed to include a sequence of nucleic acids with which the nucleic acid binding domain of the ligand activated transcriptional regulatory fusion protein interacts. It also preferably includes operatively linked transcriptional regulatory sequences that are regulatable by the TRD of the fusion protein. Typically, the regulatable expression cassette includes 3 to 6 response elements.
- Methods for regulating expression of endogenous and exogenous genes are provided.
- the methods are practiced by administering to a cell a composition that contains an effective amount or concentration of the fusion protein or of nucleic acid molecule, such as a vector that encodes the fusion protein.
- the nucleic acid binding domain (DBD) of the fusion protein is selected to bind to a targeted nucleic acid sequence in the genome of the cell or in an exogenously administered nucleic acid molecule, and the transcription regulating domain (TRD) is selected to regulate transcription from a selected promoter, which typically is operatively linked the targeted nucleic acid binding domain.
- the exogenously administered nucleic acid molecule comprises an expression cassette encoding a gene of interest and operatively linked to a regulatory region that contains elements, such as a promoter and response elements.
- a regulatory region that contains elements, such as a promoter and response elements.
- the targeted regulatory region and gene of interest may be endogenously present in the cell or separately administered as part of an expression cassette encoding the gene of interest. If separately administered, it is administered as part of a regulatable expression cassette that includes a gene and at least one response element for the gene recognized by the nucleotide binding domain of the fusion protein.
- a composition containing comprising a ligand that binds to the ligand binding domain of the fusion protein is also administered.
- the ligand can be administered in the same composition as the fusion protein (or encoding nucleic acid molecule) or in a separate composition.
- the ligand and fusion protein may be administered sequentially, simultaneously or intermittently.
- gene therapy is effected by administering a ligand that binds to the LBD of the fusion protein.
- the ligand is a non-natural ligand and the LBD has been modified from the native form present in native intracellular receptors to preferentially and selectively interact with the non-natural ligand.
- the ligand binds to the ligand binding domain of the fusion protein, whereby the DBD of the fusion protein, either as a monomer or dimer, interacts with a targeted gene and transcription of the targeted gene is repressed or activated.
- the targeted gene may be an endogenous gene or an exogenously administered gene.
- the methods for regulating gene expression in a cell are effected by administering to the cell a composition containing an effective amount of the nucleic acid molecule that encodes the ligand activated transcriptional regulatory fusion protein, a regulatable expression cassette containing a gene operatively linked to at least one response element for the gene recognized by the nucleotide binding domain of the polypeptide encoded by the polynucleotide, and a pharmaceutically acceptable excipient; and administering to the cell a ligand that binds to the ligand binding domain of the encoded polypeptide, where the nucleotide binding domain of the encoded polypeptide to binds to the response element and activates or represses transcription of the gene.
- Cellular proliferative disorder include disorders associated with transcription of a gene at reduced or increased levels.
- Administration can of the composition(s) can be effected in vitro, in vivo or ex vivo.
- One such method includes the removal of a tissue sample from a subject with a disorder, such as a cell proliferative disorder, isolating hematopoietic or other cells from the tissue sample, and contacting isolated cells with the fusion protein or a nucleic acid molecule encoding the fusion protein, and, optionally, a target specific gene.
- the cells can be treated with a growth factor, such as interleukin-2 for example, to stimulate cell growth, before reintroducing the cells into the subject. When reintroduced, the cells specifically target the cell population from which they were originally isolated.
- the trans-repressing activity of the zinc finger-nucleotide binding polypeptide may be used to inhibit or suppress undesirable cell proliferation in a subject.
- the subject is a human.
- Results exemplified herein demonstrate ligand activated transcription of a targeted gene and demonstrate the utility of the fusion protein containing a zinc finger DNA binding domain, such as a mammalian C2H2 DNA binding domain, a ligand binding domain from an intracellular receptor, such as an estrogen receptor, and, optionally, a heterologous transcription regulating domain for the purpose of obtaining ligand- dependent control of expression of a transgene introduced into mammalian cells.
- a heterologous zinc finger domains can be combined with an intracellular receptor to achieve ligand- dependent gene expression of a targeted gene.
- FIGURE 1 is a schematic for the selection strategy for the in vitro evolution of the 3 finger protein Zif268, recognizing its natural 9 bp target site (top), into a 6 finger protein, recognizing a desired 18 bp target sequence (bottom).
- FIGURE 2 is a schematic depiction of the functional domains (A-F) of the human estrogen receptor.
- FIGURE 3 is a schematic depiction of the cloning strategy for the construction of the recombinant molecular constructs.
- FIGURE 4 is a schematic map of the expression vector for C7LBDAS based on the plasmid pCDNA3.1 .
- FIGURE 5 is a schematic map of the expression vector for C7LBDBS based on the plasmid pCDNA3.1 .
- FIGURE 6 is a schematic map of the expression vector for C7LBDCS based on the plasmid pCDNA3.1 .
- FIGURE 7 is a schematic map of the expression vector for C7LBDAL based on the plasmid pCDNA3.1 .
- FIGURE 8 is a schematic map of the expression vector for C7LBDBL based on the plasmid pCDNA3.1 .
- FIGURE 9 is a schematic map of the expression vector for C7LBDCL based on the plasmid pCDNA3.1.
- FIGURE 10 is a schematic summary of the structure of several embodiments of the recombinant molecular construct and the nucleotide sequences of the DNA binding regions of zinc finger domains C7, E2C and 2C7.
- FIGURE 1 1 is a schematic map of the expression vector for
- E2CLBDAS based on the plasmid pCDNA3.1 .
- FIGURE 12 is a schematic map of the expression vector for E2CLBDBS based on the plasmid pCDNA3.1 .
- FIGURE 13 is a schematic diagram of the constructs C7LBDASTA2, C7LBDBSTA2, C7LBDBS-STAT6, C7LBDBSVP16 (SEQ ID NO: 16), AND
- FIGURE 14 is a schematic restriction map of constructs comprising RXR and ecdysone (EcR) ligand binding domains used in heterodimers.
- FIGURE 15 is a schematic depiction of the cloning strategy for the construction of the 2C7LBD recombinant molecular constructs.
- FIGURE 16 is a schematic map of the expression vector for 2C7LBDAS based on the plasmid pCDNA3.1 .
- FIGURE 17 is a schematic map of the expression vector for 2C7LBDBS based on the plasmid pCDNA3.1 .
- FIGURE 18 is a schematic map of the expression vector for
- FIGURE 19 is a schematic map of the expression vector for LBDASNLSVP16 (SEQ ID NO: 1 3), based on the plasmid pCDNA3.1 .
- FIGURE 20 is a schematic map of the expression vector for C7LBDBSVP16 based on the plasmid pCDNA3.1 .
- FIGURE 21 is a schematic map of the expression vector for C7LBDBSG521 R (SEQ ID NO: 15), based on the plasmid pCDNA3.1 .
- FIGURE 22 is a schematic map of the expression vector for C7LBDBSG400V (SEQ ID NO: 14), based on the plasmid pCDNA3.1 .
- FIGURE 23 shows A: an inducible promoter based on binding sites for the 3 Finger protein N1. The promoter contains 5 direct repeats of N1 sites spaced by 3 bp; the spacing between the .5 repeats is 6 bp.
- Bottom Luciferase assay. HeLa cells were cotransfected with plasmids encoding the indicated fusion proteins and the N 1 reporter construct. Twenty four hours later, the cells were treated with 10 nM RU486 (B) or 1 0OnM Tamoxifen, C respectively. Forty-eight hours posttransfection, cell extracts were assayed for luciferase activity.
- FIGURE 24 shows an inducible promoter based on binding sites for the 3 Finger protein B3.
- A The promoter contains 5 direct repeats of B3 sites spaced by 3 bp; the spacing between the 5 repeats is 6 bp.
- HeLa cells were cotransfected with plasmids encoding the indicated fusion proteins and the B3 reporter construct. At 24 h later, the cells were treated with 10 nM RU486 (B), or 100 nM Tamoxifen (C), respectively. At 48 h post transfection, cell extracts were assayed for luciferase activity.
- FIGURE 25 is a graphical depiction of the results of luciferase assay showing the RU486-induced formation of functional VP64-C7-PR/VP64-CF2- PR heterodimers.
- HeLa cells were cotransfected with the corresponding effector plasmids and TATA reporter plasmids (C7/CF2-drO, C7 site 5' to a CF2 site, direct "repeat", no spacing; C7/C7-dr0, 2 C7 sites, direct repeat, no spacing).
- the cells were treated with 10 nM RU486.
- FIGURE 26 shows a restriction map for the plasmid designated pAvCVIx.
- FIGURE 27 shows a restriction map for the plasmid designated pSQ3.
- the ligand binding domain (LBD) of the fusion proteins refers to the portion of the fusion protein responsible for binding to a selected ligand.
- the LBD optionally and preferably includes dimerization and inactivation functions.
- the LBDs in the proteins herein are derived from the 300 amino acid carboxyl-terminal half of intracellular receptors, particularly those that are members of the steroid hormone nuclear receptor superfamily. It is the portion of the receptor protein with which a ligand interacts thereby inducing a cascade of events leading to the specific association of an activated receptor with regulatory elements of target genes.
- the LDB includes the hormone binding function, the inactivation funciton, such as through interactions with heat shock proteins (hsp), and dimerization function.
- the LBDs used herein include such LBDs and modified derivatives thereof, particularly forms with altered ligand specificity.
- the transcription regulating domain refers to the portion of the fusion polypeptide provided herein that functions to regulate gene transcription.
- exemplary and preferred transcription repressor domains are ERD, KRAB, SID, Deacetylase, and derivatives, multimers and combinations thereof such as KRAB-ERD, SID-ERD, (KRAB) 2 , (KRAB) 3 , KRAB-A, (KRAB-A) 2 , (SID) 2 (KRAB-A)-SID and SID- ( KRAB-A).
- the DNA binding domain refers to the portion of the fusion polypeptide provided herein that provides specific nucleic acid binding capability.
- the use of the abbreviation DBD is not meant to limit it to DNA binding domains, but is also intented to include polypeptides that bind to RNA.
- the nucleic acid binding domain functions to target the protein to specific genes by virtue of the specificity of the interaction of the TRD region for nucleotide sequences operatively linked to the transcriptional apparatus of a gene.
- the DBD targets the fusion protein to the selected targeted gene or genes, which gene(s) may be endogenous or exogenously added.
- operatively linked means that elements of the fusion polypeptide, for example, are linked such that each perform or functionos as intended.
- the repressor is attached to the binding domain in such a manner that, when bound to a target nucleotide via that binding domain, the repressor acts to inhibit or prevent transcription.
- Linkage between and among elements may be direct or indirect, such as via a linker. The elements are not necessarily adjacent.
- a repressor domain of a TRD can be linked to a DNA binding domain using any linking procedure well known in the art. It may be necessary to include a linker moiety between the two domains. Such a linker moiety is typically a short sequence of amino acid residues that provides spacing between the domains. So long as the linker does not interfere with any of the functions of the binding or repressor domains, any sequence can be used.
- a fusion protein is a protein that contains portions or fragments of two or more naturally-occurring proteins operatively joined or linked to form the fusion protein in which each fragment retains a function or a modified function exhibited by the naturally occurring proteins.
- the fragments from the naturally occurring protein may be modified to alter the original properties.
- modified, modification, mutant or other such terms refers to an alteration of the domain in question from its naturally occurring wild-type form, and includes primary sequence changes.
- steroid hormone receptor superfamily refers to the superfamily of intracellular receptors that are steroid receptors. Representative examples of such receptors include, but are not limited to, the estrogen, progesterone, glucocorticoid- ⁇ , glucocorticoid- ?, mineralocorticoid, androgen, thyroid hormone, retinoic acid, retinoid X,
- Vitamin D Vitamin D, COUP-TF, ecdysone, Nurr-I and orphan receptors.
- amino acids which occur in the various amino acid sequences appearing herein, are identified according to their well-known, three-letter or one-letter abbreviations.
- the nucleotides, which occur in the various DNA fragments, are designated with the standard single-letter designations used routinely in the art.
- a delivery plasmid is a plasmid vector that carries or delivers nucleotide acids encoding a therapeutic gene or gene that encodes a therapeutic product or a precursor thereof or a regulatory gene or other factor that results in a therapeutic effect when delived in vivo in or into a cell line, such as, but not limited to a packaging cell line, to propagate therapeutic viral vectors.
- recombinant expression vector or "expression vector” refers to a plasmid, virus or other vehicle known in the art that has been manipulated by insertion or incorporation of heterologous DNA, such as nucleic acid encoding the fusion proteins herein or expression cassettes provided herein.
- Such expression vectors contain a promotor sequence for efficient transcription of the inserted nucleic acid in a cell.
- the expression vector typically contains an origin of replication, a promoter, as well as specific genes that permit phenotypic selection of transformed cells.
- a DNA or nucleic acid homolog refers to a a nucleic acid that includes a preselected conserved nucleotide sequence, such as a sequence encoding a therapeutic polypeptide.
- substantially homologous is meant having at least 80%, preferably at least 90%, most preferably at least 95% homology therewith or a less percentage of homology or identity and conserved biological activity or function.
- host cells are cells in which a vector can be propagated and its DNA expressed.
- the term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. Such progeny are included when the term "host cell” is used. Methods of stable transfer where the foreign DNA is continuous- ly maintained in the host are known in the art.
- homology and “identity” are often used interchangeably.
- percent homology or identity may be determined, for example, by comparing sequence information using a GAP computer program.
- the GAP program uses the alignment method of Needleman and Wunsch ((1 970) J. Mol. Biol. 48:443), as revised by Smith and Waterman
- the GAP program defines similarity as the number of aligned symbols (i.e., nucleotides or amino acids) which are similar, divided by the total number of symbols in the shorter of the two sequences.
- the preferred default parameters for the GAP program may include: (1 ) a unary comparison matrix (containing a value of 1 for identities and 0 for non-identities) and the weighted comparison matrix of Gribskov et al. (1986) Nucl. Acids Res. 14:6745, as described by Schwartz and Dayhoff, eds., ATLAS OF PROTEIN SEQUENCE AND STRUCTURE, National Biomedical Research Foundation, pp.
- nucleic acid molecules have nucleotide sequences that are at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% "identical” can be determined using known computer algorithms such as the "FAST A” program, using for example, the default parameters as in Pearson et al. ( 1 988) Proc. Natl. Acad. Sci. USA 85:2444. Alternatively the BLAST function of the National Center for Biotechnology Information database may be used to determine identity
- sequences are aligned so that the highest order match is obtained. "Identity" per se has an art-recognized meaning and can be calculated using published techniques. (See, e.g. : Computational
- identity is well known to skilled artisans (Carillo et al. (1 988) SI AM J Applied Math 48: 1073) . Methods commonly employed to determine identity or similarity between two sequences include, but are not limited to, those disclosed in Guide to Huge Computers, Martin J. Bishop, ed., Academic Press, San Diego, 1994, and Carillo et al. (1988) SIAM J Applied Math 45: 1073. Methods to determine identity and similarity are codified in computer programs.
- identity represents a comparison between a test and a reference polypeptide or polynucleotide.
- a test polypeptide may be defined as any polypeptide that is 90% or more identical to a reference polypeptide.
- at least "90% identical to” refers to percent identities from 90 to
- Differences are defined as nucleic acid or amino acid substitutions, or deletions.
- primer refers to an oligonucleotide containing two or more deoxyribonucleotides or ribonucleotides, preferably more than three, from which synthesis of a primer extension product can be initiated.
- a primer of interest is one that is substantially complementary to a zinc finger-nucleotide binding protein strand, but also can introduce mutations into the amplification products at selected residue sites.
- Experimental conditions conducive to synthesis include the presence of nucleoside triphosphates and an agent for polymerization and extension, such as DNA polymerase, and a suitable buffer, temperature and pH.
- genetic therapy involves the transfer of heterologous DNA to the certain cells, target cells, of a mammal, particulaly a human, with a disorder or conditions for which such therapy is sought.
- the DNA is introduced into the selected target cells in a manner such that the heterologous DNA is expressed and a therapeutic product encoded thereby is produced.
- the heterologous DNA may in some manner mediate expression of DNA that encodes the therapeutic product, or it may encode a product, such as a peptide or RNA that in some manner mediates, directly or indirectly, expression of a therapeutic product.
- Genetic therapy may also be used to deliver nucleic acid encoding a gene product that replaces a defective gene or supplements a gene product produped by the mammal or the cell in which it is introduced.
- the introduced nucleic acid may encode a therapeutic compound, such as a growth factor inhibitor thereof, or a tumor necrosis factor or inhibitor thereor, such as a receptor therefor, that is not normally produced in the mammalian host or that is not produced in therapeutically effective amounts or at a therapeutically useful time.
- the heterologous DNA encoding the therapeutic product may be modified prior to introduction into the cells of the afflicted host in order to enhance or otherwise alter the product or expression thereof.
- Genetic therapy may also involve delivery of an inhibitor or repressor or other modulator of gene expression.
- heterologous DNA is DNA that encodes RNA and proteins that are not normally produced in vivo by the cell in which it is expressed or that mediates or encodes mediators that alter expression of endogenous DNA by affecting transcription, translation, or other regulatable biochemical processes.
- Heterologous DNA may also be referred to as foreign DNA. Any DNA that one of skill in the art would recognize or consider as heterologous or foreign to the cell in which is expressed is herein encompassed by heterologous DNA.
- heterologous DNA include, but are not limited to, DNA that encodes traceable marker proteins, such as a protein that confers drug resistance, DNA that encodes therapeutically effective substances, such as anti- cancer agents, enzymes and hormones, and DNA that encodes other types of proteins, such as antibodies.
- Antibodies that are encoded by heterologous DNA may be secreted or expressed on the surface of the cell in which the heterologous DNA has been introduced.
- heterologous DNA or foreign DNA includes a DNA molecule not present in the exact orientation and position as the counterpart DNA molecule found in the genome. It may also refer to a
- DNA molecule from another organism or species i.e. , exogenous.
- a therapeutically effective product is a product that is encoded by heterologous nucleic acid, typically DNA, that, upon introduction of the nucleic acid into a host, a product is expressed that ameliorates or eliminates the symptoms, manifestations of an inherited or acquired disease or that cures the disease.
- DNA encoding a desired gene product is cloned into a plasmid vector and introduced by routine methods, such as calcium- phosphate mediated DNA uptake (see, (1981 ) Somat. Cell. Mol. Genet. 7:603-616) or microinjection, into producer cells, such as packaging cells.
- routine methods such as calcium- phosphate mediated DNA uptake (see, (1981 ) Somat. Cell. Mol. Genet. 7:603-616) or microinjection, into producer cells, such as packaging cells.
- the vectors that contain the heterologous DNA are introduced into selected target cells.
- an expression or delivery vector refers to any plasmid or virus into which a foreign or heterologous DNA may be inserted for expression in a suitable host cell — i.e., the protein or polypeptide encoded by the DNA is synthesized in the host cell's system.
- Vectors capable of directing the expression of DNA segments (genes) encoding one or more proteins are referred to herein as "expression vectors.” Also included are vectors that allow cloning of cDNA (complementary DNA) from mRNAs produced using reverse transcriptase.
- a gene refers to a nucleic acid molecule whose nucleotide sequence encodes an RNA or polypeptide.
- a gene can be either RNA or DNA. Genes may include regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons).
- isolated with reference to a nucleic acid molecule or polypeptide or other biomolecule means thatthe nucleic acid or polypeptide has separated from the genetic environment from which the polypeptide or nucleic acid were obtained. It may also mean altered from the natural state.
- a polynucleotide or a polypeptide naturally present in a living animal is not “isolated,” but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is “isolated”, as the term is employed herein.
- a polypeptide or polynucleotide produced and/or contained within a recombinant host cell is considered isolated. Also intended as an "isolated polypeptide" or an
- isolated polynucleotide are polypeptides or polynucleotides that have been purified, partially or substantially, from a recombinant host cell or from a native source.
- a recombinantly produced version of a compounds can be substantially purified by the one-step method described in Smith et al. (1988) Gene 6V.-31 -40.
- the terms isolated and purified are sometimes used interchangeably.
- Isolated DNA is free of the coding sequences of those genes that, in a naturally-occurring genome immediately flank the gene encoding the nucleic acid of interest.
- Isolated DNA may be single-stranded or double-stranded, and may be genomic DNA, cDNA, recombinant hybrid DNA, or synthetic DNA. It may be identical to a native DNA sequence, or may differ from such sequence by the deletion, addition, or substitution of one or more nucleotides.
- Isolated or purified as it refers to preparations made from biological cells or hosts means any cell extract containing the indicated DNA or protein including a crude extract of the DNA or protein of interest.
- a purified preparation can be obtained following an individual technique or a series of preparative or biochemical techniques and the DNA or protein of interest can be present at various degrees of purity in these preparations.
- the procedures may include for example, but are not limited to, ammonium sulfate fractionation, gel filtration, ion exchange change chromatography, affinity chromatography, density gradient centrifugation and electrophoresis.
- a preparation of DNA or protein that is "substantially pure” or “isolated” should be understood to mean a preparation free from naturally occurring materials with which such DNA or protein is normally associated in nature. "Essentially pure” should be understood to mean a “highly” purified preparation that contains at least 95% of the DNA or protein of interest.
- a cell extract that contains the DNA or protein of interest should be understood to mean a homogenate preparation or cell-free preparation obtained from cells that express the protein or contain the DNA of interest.
- the term "cell extract” is intended to include culture media, especially spent culture media from which the cells have been removed.
- module refers to the suppression, enhancement or induction of a function.
- zinc finger-nucleic acid binding domains and variants thereof may modulate a promoter sequence by binding to a motif within the promoter, thereby enhancing or suppressing transcription of a gene operatively linked to the promoter cellular nucleotide sequence.
- modulation may include inhibition of transcription of a gene where the zinc finger-nucleotide binding polypeptide variant binds to the structural gene and blocks DNA dependent RNA polymerase from reading through the gene, thus inhibiting transcription of the gene.
- the structural gene may be a normal cellular gene or an oncogene, for example.
- modulation may include inhibition of translation of a transcript.
- a transcriptional regulatory region refers to a region that drives gene expression in the target cell.
- Transcriptional regulatory regions suitable for use herein include but are not limited to the human cytomegalovirus (CMV) immediate-early enhancer/promoter, the SV40 early enhancer/promoter, the JC polyomavirus promoter, the albumin promoter, PGK and the ⁇ -actin promoter coupled to the CMV enhancer.
- CMV human cytomegalovirus
- a promoter region of a gene includes the regulatory elements that typically lie 5' to a structural gene. If a gene is to be activated, proteins known as transcription factors attach to the promoter region of the gene. This.assembly resembles an "on switch" by enabling an enzyme to transcribe a second genetic segment from DNA into RNA. In most cases the resulting RNA molecule serves as a template for synthesis of a specific protein; sometimes RNA itself is the final product.
- the promoter region may be a normal cellular promoter or, for example, an onco-promoter.
- An onco-promoter is generally a virus- derived promoter.
- Viral promoters to which zinc finger binding polypeptides may be targeted include, but are not limited to, retroviral long terminal repeats (LTRs), and Lentivirus promoters, such as promoters from human T-cell lymphotrophic virus (HTLV) 1 and 2 and human immunodeficiency virus (HIV) 1 or 2.
- LTRs retroviral long terminal repeats
- HTLV human T-cell lymphotrophic virus
- HAV human immunodeficiency virus
- effective amount includes that amount that results in the deactivation of a previously activated promoter or that amount that results in the inactivation of a promoter containing a zinc finger-nucleotide binding motif, or that amount that blocks transcription of a structural gene or translation of RNA.
- the amount of zinc finger derived-nucleotide binding polypeptide required is that amount necessary to either displace a native zinc finger-nucleotide binding protein in an existing protein/promoter complex, or that amount necessary to compete with the native zinc finger-nucleotide binding protein to form a complex with the promoter itself.
- the amount required to block a structural gene or RNA is that amount which binds to and blocks RNA polymerase from reading through on the gene or that amount which inhibits translation, respectively.
- the method is performed intracellularly. By functionally inactivating a promoter or structural gene, transcription or translation is suppressed. Delivery of an effective amount of the inhibitory protein for binding to or "contacting" the cellular nucleotide sequence containing the zinc finger-nucleotide binding protein motif, can be accomplished by one of the mechanisms described herein, such as by retroviral vectors or liposomes, or other methods well known in the art.
- truncated refers to a zinc finger-nucleotide binding polypeptide derivative that contains less than the full number of zinc fingers found in the native zinc finger binding protein or that has been deleted of non-desired sequences.
- truncation of the zinc finger-nucleotide binding protein TFIIIA which naturally contains nine zinc fingers, might be a polypeptide with only zinc fingers one through three.
- Expansion refers to a zinc finger polypeptide to which additional zinc finger modules have been added.
- TFIIIA may be extended to 12 fingers by adding 3 zinc finger domains.
- a truncated zinc finger-nucleotide binding polypeptide may include zinc finger modules from more than one wild type polypeptide, thus resulting in a "hybrid” zinc finger-nucleotide binding polypeptide.
- mutagenized refers to a zinc finger derived- nucleotide binding polypeptide that has been obtained by performing any of the known methods for accomplishing random or site-directed mutagenesis of the DNA encoding the protein. For instance, in TFIIIA, mutagenesis can be performed to replace nonconserved residues in one or more of the repeats of the consensus sequence. Truncated zinc finger- nucleotide binding proteins can also be mutagenized.
- a polypeptide “variant” or “derivative” refers to a polypeptide that is a mutagenized form of a polypeptide or one produced through recombination but that still retains a desired activity, such as the ability to bind to a ligand or a nucleic acid molecule or to modulate transcription.
- a zinc finger-nucleotide binding polypeptide “variant” or “derivative” refers to a polypeptide that is a mutagenized form of a zinc finger protein or one produced through recombination.
- a variant may be a hybrid that contains zinc finger domain(s) from one protein linked to zinc finger domain(s) of a second protein, for example.
- the domains may be wild type or mutagenized.
- a "variant " or “derivative” includes a truncated form of a wild type zinc finger protein, which contains less than the original number of fingers in the wild type protein.
- Examples of zinc finger-nucleotide binding polypeptides from which a derivative or variant may be produced include TFIIIA and zif268.
- a "zinc finger-nucleotide binding motif” refers to any two or three-dimensional feature of a nucleotide segment to which a zinc finger-nucleotide binding derivative polypeptide binds with specificity. Included within this definition are nucleotide sequences, generally of five nucleotides or less, as well as the three dimensional aspects of the DNA double helix, such as, but are not limited to, the major and minor grooves and the face of the helix.
- the motif is typically any sequence of suitable length to which the zinc finger polypeptide can bind. For example, a three finger polypeptide binds to a motif typically having about 9 to about 14 base pairs.
- the recognition sequence is at least about 1 6 base pairs to ensure specificity within the genome. Therefore, zinc finger- nucleotide binding polypeptides of any specificity are provided.
- the zinc finger binding motif can be any sequence designed empirically or to which the zinc finger protein binds.
- the motif may be found in any DNA or RNA sequence, including regulatory sequences, exons, introns, or any non- coding sequence.
- pharmaceutically acceptable As used herein, the terms "pharmaceutically acceptable",
- compositions, carriers, diluents and reagents are used interchangeably and represent that the materials are capable of administration to or upon a human without the production of undesirable physiological effects such as nausea, dizziness, gastric upset and the like which would be to a degree that would prohibit administration of the composition.
- vector refers to a nucleic acid molecule capable of transporting between different genetic environments another nucleic acid to which it has been operatively linked.
- Preferred vectors are those capable of autonomous replication and expression of structural gene products present in the DNA segments to which they are operatively linked. Vectors, therefore, preferably contain the replicons and selectable markers described earlier.
- operatively linked means the sequences or segments have been covalently joined, preferably by conventional phosphodiester bonds, into one strand of DNA, whether in single or double stranded form such that operatively linked portions functions as intended.
- the choice of vector to which transcription unit or a cassette provided herein is operatively linked depends directly, as is well known in the art, on the functional properties desired, e.g., vector replication and protein expression, and the host cell to be transformed, these being limitations inherent in the art of constructing recombinant DNA molecules.
- a sequence of nucleotides adapted for directional ligation i.e., a polylinker, is a region of the DNA expression vector that
- a directional polylinker is a sequence of nucleotides that defines two or more restriction endonucleaser recognition sequences, or restriction sites.
- the two sites Upon restriction cleavage, the two sites yield cohesive termini to which a translatable DNA sequence can be ligated to the DNA expression vector.
- the two restriction sites provide, upon restriction cleavage, cohesive termini that are non-complementary and thereby permit directional insertion of a translatable DNA sequence into the cassette.
- the directional ligation means is provided by nucleotides present in the upstream translatable DNA sequence, downstream translatable DNA sequence, or both.
- the sequence of nucleotides adapted fpr directional ligation comprises a sequence of nucleotides that defines multiple directional cloning means. Where the sequence of nucleotides adapted for directional ligation defines numerous restriction sites, it is referred to as a multiple cloning site.
- a secretion signal is a leader peptide domain of a protein that targets the protein to the periplasmic membrane of gram negative bacteria.
- a preferred secretion signal is a pelB secretion signal.
- the predicted amino acid residue sequences of the secretion signal domain from two pelB gene product variants from Erwinia carotova are described in Lei, et al. (Nature, 331 :543-546. 1988).
- the leader sequence of the pelB protein has previously been used as a secretion signal for fusion proteins (Better et al. (1 988) Science 240:1041 - 1043,-Sastry et al. (1989) Proc. Natl. Acad. Sci. USA 56:5728-5732; and
- ligand refers to any compound interacts with the ligand binding domain of a receptor and modulate its activity; ligands typically activate receptors. Ligand can also include compounds that activate the receptor without binding. A natural ligand is a compound that normally interacts with the receptor.
- anti-hormones are compounds that are antagonists of the naturally-occurring receptor. The anti-hormone is opposite in activity to a hormone.
- non-natural ligands or non-native ligands refer to compounds that are normally are not found in mammals, such as humans, that bind to or interact with the ligand binding domain of a receptor.
- non-native ligands refers to those ligands that are not naturally found in the specific organism (man or animal) in which gene therapy is contemplated.
- certain insect hormones such as ecdysone are not found in humans.
- ecdysone is non-native hormone to an animal, such as a human.
- cell-proliferative disorder denotes malignant as well as non-malignant disorders in which cell populations morphologically appear to differ from the surrounding tissue.
- the cell-proliferative disorder may be a transcriptional disorder that results in an increase or a decrease in gene expression level.
- the cause of the disorder may be of cellular origin or viral origin.
- Gene therapy using a zinc finger-nucleotide binding polypeptide can be used to treat a virus-induced cell proliferative disorder in a human, for example, as well as in a plant. Treatment can be prophylactic in order to make a plant cell, for example, resistant to a virus, or therapeutic, in order to ameliorate an established infection in a cell, by preventing production of viral products.
- cellular nucleotide sequence refers to a nucleotide sequence that is present within a cell. It is not necessary that the sequence be a naturally occurring sequence of the cell. For example, a retroviral genome that is integrated within a host's cellular DNA, would be considered a "cellular nucleotide sequence".
- the cellular nucleotide sequence can be DNA or RNA and includes introns and exons, DNA and RNA.
- the cell and/or cellular nucleotide sequence can be prokaryotic or eukaryotic, including a yeast, virus, or plant nucleotide sequence.
- administration of a therapeutic composition can be effected by any means, and includes, but is not limited to, subcutaneous, intravenous, intramuscular, intrasternal, infusion techniques, intraperitoneally administration and parenteral administration. II. Fusion Protein
- the fusion protein is constructed to include a ligand binding domain and a nucleic acid binding domain;, the nucleic acid binding domain is not derived from the same receptor as the ligand binding domain. Inclusion of these two domains permits sequence specific binding to target nucleic acid sequences present in endogenous or exogenous nucleic acid molecules. It also provides ligand-dependent control of such sequence- specific binding.
- the fusion protein can also include a transcription regulating domain that serves to enhance, suppress or activate expression of an endogenous or exogenous gene. Such transcriptional control is also ligand dependent.
- the nucleic acid binding domain includes one or more zinc finger peptide modular units, and typically a plurality of such units joined to provide a peptide designed to bind to the regulatory region in a targeted gene.
- Zinc fingers provide a means to design DBDs of a desired specificity.
- the fusion protein also includes a LBD that derived from an intracellular receptor, preferably a hormone receptor, more preferably a steroid receptor.
- the LBD can be modified to have altered ligand specificity so that endogenous or natural ligands do not interact with it, but non-natural ligands do.
- the fusion protein also can include a transcription regulating domain (TRD) that regulates transcription of the targeted gene(s).
- TRD transcription regulating domain
- the TRD can repress transcription of an endogenous gene; in others it can activate expression of an endogenous or exogenous gene.
- the fusion protein is made by operably linking a LBD domain from an intacellular receptor to a one or more zinc finger domains, selected to bind to a targeted gene.
- a transcription regulating domain can also be operably linked. This is accomplished by any method known to those of skill in the art. Generally the fusion protein is produced by expressing nucleic acid encoding the fusion protein. 1 .
- the ligand binding domain is derived from an intracellular receptor, and is preferably derived from a nuclear hormone receptor.
- the LBD of an intracellular receptor includes the approximately 300 amino acids from the carboxy terminal, which can be used with or without modification.
- ligand specificity By mutation of a small number of residues ligand specificity can be altered.
- the ligand binding domain can be modified, such as by truncation or point mutation to alter its ligand specificity permitting gene regulation by non-natural or non-native ligands.
- Exemplary hormone receptors are steroid receptors, which are well known in the art.
- Exemplary and preferred steroid receptors include estrogen and progesterone receptors and variants thereof.
- ligand binding domains that exhibit altered ligand specificity so that the LBD does not respond to the natural hormone, but rather to a drug, such as RU486, or other inducer.
- Means to modify and test the specificity of ligand binding domains and to identify ligands therefor are known (see, U.S. Patent No. 5,874,534; U.S. Patent No. 5,935,934; and International PCT application No. 98/18925, which is based on U.S. provisional application Serial No. 60/029,964; International PCT application No. 96/4091 1 , which is based on U.S. application Serial No. 08/479,913).
- the LBD can be modified by deletion of from about 1 up to about 1 50, typically 120, amino acids on the carboxyl terminal end of the receptor from which the LBD derives.
- Systematic deletion of amino acids and subsuqent testing of the ligand specificity and of the resulting LBD can be used to empirically identify mutations that lead to modified LBDs that have desired properties, such as preferential interaction with non- natural ligands.
- Exemplary mutations are described in the Examples herein, and also are known to those of skill in the art (see, e.g. , U.S. Patent No. 5,874,534; U.S. Patent No. 5,935,934; U.S. Patent No.
- Zinc fingers are modular nucleic acid binding peptides.
- the zinc fingers, or modules thereof, or variant thereof can be used to construct fusion proteins that specifically interact with targeted sequences.
- Zinc fingers are ubiquitous proteins, and many are well-characterized.
- methods and rules for preparation and selection of zinc fingers based upon the C2H2 class of zinc fingers with unique specificity are known (see, e.g. , International PCT application No. WO 98/5431 1 and International PCT application No. 95/19431 ; see, also U.S. Patent No.
- Zinc fingers and modular units thereof can be obtained or prepared by any method known to those of skill in the art.
- zinc fingers including synthetic zinc fingers having a variety of sequence specificities are known, as are means for combining the modular domains to produce a resulting peptide that binds to any desired target sequence of nucleic acids.
- Rules for creating zinc fingers of desired specificity are known and can be deduced by methods used by those of skill in the art (see, e.g. , (see, e.g. , International PCT application No. WO 98/5431 1 , which is based on U.S. application Serial No. 08/863,813; International PCT application No. 95/19431 , which is based on U.S. application Serial Nos. 08/183,1 19 and 08/312,604).
- zinc finger variants can be prepared by identifying a zinc finger or modular unit thereof, creating an expression library, such as a phage display library (see, e.g. , International PCT application No. WO 98/5431 1 , Barbas et al. (1 991 ) Methods 2:1 1 9; Barbas et al. (1992) Proc. Natl. Acad. Sci. U.S.A. 55:4457), encoding polypeptide variants of the zinc finger or modular unit therof, expressing the library in a host and screening for variant peptides having a desired specificity.
- an expression library such as a phage display library
- Zinc fingers may also be constructed by combining amino acids (or encoding nucleic acids) according to the known rules of binding specificity and, if necessary, testing or screening the resulting peptides to ensure the peptide has a desired specificity. Because of the modular nature of zinc fingers, where each module can be prepared to bind to three nucleotide squence, peptides of any specificity can be prepared from the modules. The number of modules used depends upon the specificity of gene targeting desired. Modular units are combined; spacers (i.e. TGEKP, TGQKP) required to maintain spacing and conformational features of the modular domains are included in the peptide (see, e.g. , WO 98/5431 1 ). a.
- spacers i.e. TGEKP, TGQKP
- the nucleic acid binding domain in the fusion protein includes zinc finger modular domains and is designed to bind to a target nucleic acid sequence present in an endogenous gene or in an exogenous gene that is administered in combination with the fusion protein or nucleic acid encoding the fusion protein.
- Zinc fingers are among the most common and ubiquitous nucleic acid binding proteins. Any zinc finger polypeptide or modular unit thereof is contemplated; preferably the domain is non-immunogenic in the host for which the fusion protein is intended.
- the zinc finger DBD preferably is selected from human zinc protein modular units or variants thereof.
- the zinc finger used generally is other than the naturally-occurring zinc finger present in the intracellular receptor from which the ligand binding domain is derived.
- the fusion protein is produced by replacing the native zinc finger present in the receptor with the selected zinc finger designed to interact with a targeted nucleic acid regulatory region.
- the zinc fingers can be designed by selection of appropriate modular units to have specificity for a targeted gene, thereby providing a precise means to modulate expression of a targeted gene.
- Naturally occurring zinc finger proteins generally contain multiple repeats of the zinc finger motif. This modular nature is unique among the different classes of DNA binding proteins. Wild type zinc finger proteins are made up of from two to as many as 37 modular tandem repeats, with each repeat forming a "finger" holding a zinc atom in tetrahedral coordination by means of a pair of conserved cysteines and a pair of conserved histidines. Generally each finger also contains conserved hydrophobic amino acids that interact to form a hydrophobic core that helps the module maintain its shape. Polydactyl arrays of as many as 37 zinc finger domains allow this recognition domain to recognize extended asymmetric sequences. Any such zinc finger or combinations of modular units thereof is intended for use herein.
- a zinc finger-nucleotide binding peptide domain contains a unique heptamer (contiguous sequence of 7 amino acid residues) within the ⁇ -helical domain of the polypeptide, which heptameric sequence determines binding specificity to a target necleotide.
- the heptameric sequence can be located anywhere within the ⁇ -helical domain but it is preferred that the heptamer extend from position -1 to position 6 as the residues are conventionally numbered in the art.
- a peptide nucleotide-binding domain can include any yS-sheet and framework sequences known in the art to function as part of a zinc finger protein.
- WO 98/5431 1 Rules for constructing Zinc finger arrays that bind to a particular DNA sequence are known (see, e.g., International PCT application No. WO 98/5431 1 , which is based on U.S. application Serial
- Zinc finger-nucleotide binding polypeptide variants can be constructed from known motifs.
- the variants include at least two and preferably at least about four zinc finger modules that bind to a cellular nucleotide sequence, such as DNA, RNA or both, and specifically bind to and modulate the function of a cellular nucleotide sequence.
- zinc finger- nucleotide binding motif be known in order to obtain a zinc-finger nucleotide binding variant polypeptide. It is contemplated that zinc finger- nucleotide binding motifs can be identified in non-eukaryotic DNA or RNA, especially in the native promoters of bacteria and viruses by the binding thereto of the modified nucleic acid binding peptides. Modified nucleic acid binding peptides should preserve the well known structural charac- teristics of the zinc finger, but differ from zinc finger proteins found in nature by their amino acid sequences and three-dimensional structures.
- C2H2 Cys 2 -His 2
- zinc fingers are preferred for use in the fusion proteins.
- C2H2 zinc fingers There are well-defined rules for C2H2 zinc finger binding to DNA that allow the DNA binding specificity of the fusion proteins containing the zinc fingers to be adjusted in order to reduce nonspecific interactions with genes other than the targeted genes.
- These proteins can be selected or engineered to bind to diverse sequences. Further, the sequence specificity of these proteins can be modified to be different from their naturally occurring targets.
- Examples of zinc finger proteins from which a polypeptide can be produced include TFIIIA and Zif268.
- the murine Cys 2 -His 2 zinc finger protein Zif268 has been used for construction of phage display libraries (Wu et al. (1995) Proc. Natl. Acad. Sci. U.S.A. 52:344-348).
- Zif268 is structurally the most well characterized of the zinc-finger proteins (Pavletich, et al. (1991 ) Science 252:809-817; Elrod-Erickson et al. (1996) Structure 4:1 171 -1 180; Swirnoff et al. (1995) Mol. Cell. Biol. 75:2275-2287).
- DNA recognition in each of the three zinc finger domains of this protein is mediated by residues in the N-terminus of the ⁇ -helix contacting primarily three nucleotides on a single strand of the DNA.
- the operator binding site for this three finger protein is 5'-GCGJGGGCG-'3 (finger-2 subsite is underlined).
- Structural studies of Zif268 and other related zinc finger- DNA complexes have shown that residues from primarily three positions on the ⁇ -helix, -1 , 3, and 6, are involved in specific base contacts. Typically, the residue at position -1 of the ⁇ -helix contacts the 3' base of that finger's subsite while positions 3 and 6 contact the middle base and the 5' base, respectively.
- a zinc finger-nucleotide binding polypeptide that binds to DNA, and specifically, the zinc finger domains that bind to DNA, can be identified by examination of the "linker" region between two zinc finger domains.
- the linker amino acid sequence TGEK(P) (SEQ ID NO: 19) is typically indicative of zinc finger domains that bind to a DNA. Therefore, one can determine whether a particular zinc finger-nucleotide binding polypeptide preferably binds to DNA or RNA by examination of the linker amino acids.
- Synthetic zinc fingers can be assembled based upon known sequence specificities.
- a large number of zinc finger-nucleotide binding polypeptides were made and tested for binding specificity against target nucleotides containing a GNN triplet.
- the data show that a striking conservation of all three of the primary DNA contact positions (-1 , 3, and 6) was observed for virtually all the clones of a given target (see, Example 1 , see, also.
- U.S. application Serial No. 09/173,941 filed 16 October, 1998, published as International PCT application No. WO 00/23464).
- Library 1 was constructed by randomization of positions -1 , 1 ,2,3,5,6 using a NNK doping strategy while library 2 was constructed using a VNS doping strategy with randomization of positions -2,-1 , 1 ,2,3,5,6.
- the NNK doping strategy allows for all amino acid combinations within 32 codons while VNS precludes Tyr, Phe, Cys and all stop codons in its 24 codon set.
- the libraries contained 4.4 x 10 9 and 3.5 x 10 9 members, respectively, each capable of recognizing sequences of the 5'- GCGNNNGCG-3' type.
- NNK library ensured that it could be surveyed with 99% confidence while the VNS library was highly diverse but somewhat incomplete.
- These libraries are, however, significantly larger than previously reported zinc finger libraries (International PCT application No. WO 09/5431 1 ; Choo et al. (1 994) Proc Natl Acad Sci U S A 91: ⁇ ⁇ 63-7; Greisman et al. ( 1 997) Science 275:657-661 ; Rebar et al. (1 994) Science 263:671 -673; Jamieson et al. (1 994) Biochemistry 53:5689-5695; Jamieson et al. 1996) Proc. Natl.
- His3 or Lys3 are selected for the recognition of a middle guanine.
- Ser3 and Ala3 are selected to recognize a middle thymine.
- Thr3, Asp3, and Glu3 are selected to recognize a middle cytosine.
- Asp and Glu were are selected in position -1 to recognize a 3' cytosine, while Thr-1 and Ser-1 are selected to recognize a 3' thymine.
- motifs rather than a single amino acid.
- the best specification of a 3' guanine is achieved using the combination of Arg-1 , Ser1 , and Asp2 (the RSD motif).
- Val5 and Arg6 to specify a 5' guanine, recognition of subsites GGG, GAG, GTG, and GCG can be accomplished using a common helix structure (SRSD-X-LVR) differing only in the position 3 residue (Lys3 for GGG, Asn3 for GAG, Glu3 for GTG, and Asp3 for GCG).
- 3' thymine is specified using Thr-1 , Serl , and Gly2 in the final clones(the TSG motif).
- a 3' cytosine can be specified using Asp-1 , Pro1 , and Gly2 (the DPG motif) except when the subsite is GCC; Pro1 is not tolerated by this subsite.
- Specification of a 3' adenine is with Gln-1 , Ser1 , Ser2 in two clones (QSS motif).
- the zinc finger-nucleotide binding peptide domain can be derived or produced from a wild type zinc finger protein by truncation or expansion, or as a variant of the wild type-derived polypeptide by a process of site directed mutagenesis, or by a combination of the procedures (see, e.g., U.S. Patent No. 5,789.538, which describes methods for design and construction of zinc finger peptides). Mutagenesis can be performed to replace non-conserved residues in one or more of the repeats of the consensus sequence. Truncated zinc finger-nucleotide binding proteins can also be mutagenized.
- DNA encoding the zinc finger-nucleotide binding proteins can be obtained by several methods.
- the DNA can be isolated using hybridization procedures which are well known in the art. These include, but are not limited to: (1 ) hybridization of probes to genomic or cDNA libraries to detect shared nucleotide sequences; (2) antibody screening of expression libraries to detect shared structural features; and (3) synthesis by the polymerase chain reaction (PCR).
- RNA can be obtained by methods known in the art (seem e.g. , Current Protocols in Molecular Biology, 1 988, Ed. Ausubel, et al., Greene Publish. Assoc. & Wiley Interscience).
- DNA encoding zinc finger-nucleotide binding proteins also can be obtained by: (1 ) isolation of a double-stranded DNA sequence from the genomic DNA; (2) chemical manufacture of a DNA sequence to provide the necessary codons for the polypeptide of interest; and (3) in vitro synthesis of a double-stranded DNA sequence by reverse transcription of mRNA isolated from a eukaryotic donor cell. In the latter case, a double- stranded DNA complement of mRNA is eventually formed which is generally referred to as cDNA.
- the isolation of genomic DNA is the least common. This is especially true when it is desirable to obtain the microbial expression of mammalian polypeptides due to the presence of introns.
- the synthesis of DNA sequences is frequently the method of choice when the entire sequence of amino acid residues of the desired polypeptide product is known.
- the direct synthesis of DNA sequences is not possible and the method of choice is the formation of cDNA sequences.
- the standard procedures for isolating cDNA sequences of interest is the formation of plasmid-carrying cDNA libraries which are derived from reverse transcription of mRNA which is abundant in donor cells that have a high level of genetic expression. When used in combination with polymerase chain reaction technology, even rare expression products can be cloned.
- the production of labeled single or double-stranded DNA or RNA probe sequences duplicating a sequence putatively present in the target cDNA may be employed in DNA/DNA hybridization procedures which are carried out on cloned copies of the cDNA which have been denatured into a single-stranded form (Jay, et al.. Nucleic Acid Research ⁇ X ⁇ ⁇ 2325, 1 983).
- Hybridization procedures are useful for the screening of recombinant clones by using labeled mixed synthetic oligonucleotide probes where each probe is potentially the complete complement of a specific DNA sequence in the hybridization sample which includes a heterogeneous mixture of denatured double-stranded DNA.
- hybridization is preferably performed on either single-stranded DNA or denatured double-stranded DNA.
- Hybridization is particularly useful in the detection of cDNA clones derived from sources where an extremely low amount of mRNA sequences relating to the polypeptide of interest are present.
- Oligonucleotide probes which correspond to a part of the sequence encoding the protein in question, can be synthesized chemically. This requires that short, oligopeptide stretches of amino acid sequence must be known.
- the DNA sequence encoding the protein can be deduced from the genetic code, however, the degeneracy of the code must be taken into account. It is possible to perform a mixed addition reaction when the sequence is degenerate. This includes a heterogeneous mixture of denatured double-stranded DNA. For such screening, hybridization is preferably performed on either single-stranded DNA or denatured double-stranded DNA.
- a cDNA expression library such as lambda gt1 1
- Such antibodies can be either polyclonally or monoclonally derived and used to detect expression product indicative of the presence of zinc finger-nucleotide binding protein cDNA.
- binding of the derived polypeptides to DNA targets can be assayed by incorporated radiolabeled DNA into the target site and testing for retardation of electrophoretic mobility as compared with unbound target site.
- a preferred vector used for identification of truncated and/or mutagenized zinc finger-nucleotide binding polypeptides is a recombinant DNA molecule containing a nucleotide sequence that codes for and is capable of expressing a fusion polypeptide containing, in the direction of amino- to carboxy-terminus, (1 ) a prokaryotic secretion signal domain, (2) a heterologous polypeptide, and (3) a filamentous phage membrane anchor domain.
- the vector includes DNA expression control sequences for expressing the fusion polypeptide, preferably prokaryotic control sequences.
- DNA sequences provided herein encode essentially all or part of an zinc finger-nucleotide binding protein
- DNA fragments disclosed herein, which define the zinc finger-nucleotide binding polypeptides it is possible, in conjunction with known techniques, to determine the DNA sequences encoding the entire zinc finger-nucleotide binding protein. Such techniques are described in U.S. 4,394,443 and U.S. 4,446,235, which are incorporated herein by reference.
- the zinc finger derived polypeptide can contain more or less than the full amount of fingers contained in the wild type protein from which it is derived. Minor modifications of the primary amino acid sequence may result in proteins which have substantially equivalent activity compared t ⁇ the zinc finger derived-binding protein described herein. Such modifications may be deliberate, as by site-directed mutagenesis, or may be spontaneous. All proteins produced by these modifications are included herein as long as zinc finger-nucleotide binding protein activity exists. e. Screening of varint zinc finger and other DBD peptides
- any method known to those of skill in the art for identification of functional modular domains derived from zinc fingers and combinations thereof can be employed.
- An exemplary method for identifying variants of zinc fingers or other polypeptides that bind to zinc finger binding motifs is provided.
- Components used in the method include a nucleic acid molecule encoding a putative or modified zinc finger peptide operably linked to a first inducible promoter and a reporter gene operably linked to a second inducible promoter and a zinc finger-nucleotide binding motif, wherein the incubating is carried out under conditions sufficient to allow the components to interact, and measuring the affect of the putative DBD peptide on the expression of the reporter gene is provided.
- a first inducible promoter such as the arabinose promoter
- a second inducible promoter such as the lactose promoter
- a zinc finger derived-DNA binding motif followed by a reporter gene, such as ?-galactosidase.
- Incubation of the components may be in vitro or in vivo. In vivo incubation may include prokaryotic or eukaryotic systems, such as E.coli ox COS cells, respectively.
- Conditions that allow the assay to proceed include incubation in the presence of a substance, such as arabinose and lactose, which activate the first and second inducible promoters, respectively, thereby allowing expression of the «nucleotide sequence encoding the putative trans-modulating protein nucleotide sequence. Determination of whether the putative modulating protein binds t the zinc finger- nucleotide binding motif, which is operably linked to the second inducible promoter, and affects its activity is measured by the expression of the reporter gene. For example, if the reporter gene is 5-galactosidase, the presence of blue or white plaques indicates whether the putative modulating protein enhances or inhibits, respectively, gene expression from the promoter.
- a substance such as arabinose and lactose
- CAT chloramphenicol acetyl transferase
- Prokaryote and eukaryote systems can be used.
- Example 1 provides an illustration of modification of Zif268 as described above. Therefore, in another embodiment, a ligand activated transcriptional regulator polypeptide variant containing at least two zinc finger modules that bind to an HIV sequence and modulates the function of the HIV sequence, for example, the HIV promoter sequence is provided.
- zinc finger proteins can be manipulated to recognize and bind to extended target sequences.
- zinc finger proteins containing from about 2 to 20 zinc fingers Zif(2) to Zif(20), and preferably from about 2 to 12 zinc fingers may be fused to the leucine zipper domains of the Jun/Fos proteins, prototypical members of the bZIP family of proteins (O'Shea et al. (1991 ) Science 254:539).
- zinc finger proteins can be fused to other proteins which are capable of forming heterodimers and contain dimerization domains. Such proteins are known to those of skill in the art.
- Jun/Fos leucine zippers are described for illustrative purposes and preferentially form heterodimers and allow for the recognition of 1 2 to 72 base pairs.
- Jun/Fos refer to the leucine zipper domains of these proteins.
- Zinc finger proteins are fused to Jun, and independently to Fos by methods commonly used in the art to link proteins. Following purification, the Zif-Jun and Zif-Fos constructs, the proteins are mixed to spontaneously form a Zif-Jun/Zif-Fos heterodimer.
- heterodimeric Zif constructs are advantageous since they allow for recognition of palindromic sequences (if the fingers on Jun and Fos recognize the same DNA/RNA sequence) or extended asymmetric sequences (if the fingers on Jun and Fos recognize different DNA/RNA sequences).
- palindromic sequence 5' - GGC CCA CGC ⁇ N ⁇ x GCG TGG GCG - 3' 3' - GCG GGT GCG ⁇ N ⁇ x CGC ACC CGC - 5' is recognized by the Zif268-Fos/Zif268 Jun dimer (x is any number).
- the spacing between subsites is determined by the site of fusion of Zif with the Jun or Fos zipper domains and the length of the linker between the Zif and zipper domains. Subsite spacing is determined by a binding site selection method as is common to those skilled in the art (Thiesen et al.
- Example of the recognition of an extended asymmetric sequence is shown by the Zif(C7) 6 -Jun/Zif-268-Fos dimer.
- This protein includes 6 fingers of the C7 type (EXAMPLE 1 1 ) linked to Jun and three fingers of Zif268 linked to Fos, and recognizes the extended sequence: 5' - CGC CGC CGC CGC CGC ⁇ N ⁇ x GCG TGG GCG - 3'
- attachment of chelating groups to Zif proteins is preferably facilitated by the incorporation of a Cysteine (Cys) residue between the initial Methionine (Met) and the first Tyrosine (Tyr) of the protein.
- Cys is then alkylated with chelators known to those skilled in the art, for example, EDTA derivatives as described (Sigman (1990) Biochemistry, 29:9097).
- chelators known to those skilled in the art, for example, EDTA derivatives as described (Sigman (1990) Biochemistry, 29:9097).
- the sequence Gly-Gly-His can be made as the most amino terminal residues since an amino terminus composed of the residues has been described to chelate Cu +2
- Preferred metal ions include Cu +2 , Ce +3 (Takasaki and Chin (1994) J. Am. Chem. Soc. 775:1 121 , 1994) Zn +2 , Cd +2 , Pb +2 , Fe +2 (Schnaith et al. (1994) Proc. Natl. Acad. Sci., USA 37:569, 1994), Fe +3 , Ni +2 , Ni +3 , La +3 , Eu +3 (Hallef al. (1994) Chemistry and Biology 7:185), Gd +3 , Tb +3 , Lu +3 , Mn + 2 , Mg +2 .
- Cleavage with chelated metals is generally performed in the presence of oxidizing agents such as O 2 , hydrogen peroxide H 2 O 2 and reducing agents such as thiols and ascorbate.
- oxidizing agents such as O 2
- hydrogen peroxide H 2 O 2 and reducing agents
- thiols and ascorbate The site and strand ( + or - site) of cleavage is determined empirically (Mack et al. (1988) J. Am. Chem. Soc 7 70:7572, 1 988) and is dependent on the position of the Cys between the Met and the Tyr preceding the first finger. In the protein Met (AA) Tyr-(Zif),.
- Dimeric zif constructs of the type Zif-Jun/Zif-Fos are preferred for cleavage at two sites within the target oligonucleotide or at a single long target site.
- Jun and Fos containing proteins are labelled with chelators and cleavage is performed by methods known to those skilled in the art. In this case, a staggered double-stranded cut analogous to that produced by restriction enzymes is generated.
- proteins carrying multiple copies of the finger may be constructed using the TGEKP linker sequence by methods known in the art.
- the C7 finger may be constructed according to the scheme: MKLLEPYACPVESCDRRFSKSADLKRHIRHJGEKP- (SEQ ID NO: 22)
- Fingers used need not be identical and may be mixed and matched to produce proteins which recognize a desired target sequence. These may also be used with leucine zippers
- the entire three finger Zif268 and modified versions therein may be fused using the consensus linker TGEKP to produce proteins with extended recognition sites.
- the protein Zif268-Zif268 can be produced in which the natural protein has been fused to itself using the TGEKP linker. This protein now binds the sequence GCG-TGG-GCG-GCG-TGG-GCG. Therefore modifications within the three fingers of Zif268 or other zinc finger proteins known in the art may be fused together to form a protein which recognizes extended sequences. These new zinc proteins may also be used in combination with leucine zippers if desired. 3.
- TRD Transcription regulating domain
- the TRD is selected to regulate transcription of the gene targeted by the DBD and to effect regulation of expression thereof.
- the TRD can be selected to regulate expression of an endogenous gena in a cell or in an exogenously added construct.
- the regulatory region of the gene can be selected to interact with a desired TRD. Identification, preparation and testing of TRDs in combination with DBDs is exemplified herein for ERB-2 and integrin 5 3 . a. Selection of the TRD
- Transcription regulating domains are well known in the art.
- Exemplary and preferred transcription repressor domains are ERD, KRAB,
- SID Deacetylase, and derivatives, multimers and combinations thereof such as KRAB-ERD, SID-ERD, (KRAB) 2 , (KRAB) 3 , KRAB-A, (KRAB-A) 2 , (SID) 2 (KRAB-A)-SID and SID-(KRAB-A).
- Repressors Transcriptional repressors are well known in the art, and any such repressor can be used herein.
- the repressor is a polypeptide that is operatively linked to the nucleic acid binding domain as set forth above.
- the repressor in operatively linked ot the binding domain in that it is attached to the binding domain in such a manner that, when bound to a target nucleotide via that binding domain, the repressor acts to inhibit or prevent transcription.
- the repressor domain can be linked to the binding domain using any linking procedure well known in the art. It may be necessary to include a linker moiety between the two domains. Such a linker moiety is typically a short sequence of amino acid residues that provides spacing between the domains. So long as the linker does not interfere with any of the functions of the binding or repressor domains, any sequence can be used .
- Transcriptional repressors have been generated by attaching either of three human-derived repressor domains to the zinc finger protein.
- the first repressor protein was prepared using the ERF repressor domain (ERD)
- ERF ets2 repressor factor
- the second repressor protein was prepared using the Kruppel- associated box (KRAB) domain (Margolin et al. (1994) Proc. Natl. Acad. Sci. USA 57:4509-4513). This repressor domain is commonly found at the N-terminus of zinc finger proteins and presumably exerts its repressive activity on TATA-dependent transcription in a distance- and orientation- independent manner (Pengue et al. (1996) Proc. Natl. Acad. Sci. USA 53:1015-1020), by interacting with the RING finger protein KAP-1 (Friedman et al. (1996) Genes & Dev. 70:2067-2078).
- KRAB Kruppel- associated box
- the KRAB domain found between amino acids 1 and 97 of the zinc finger protein KOX1 (Margolin et al. (1994) Proc. Natl. Acad. Sci. USA 37:4509-4513) was used. In this case an N-terminal fusion with the six-finger protein was constructed.
- Histone deacetylation as a means for repression can be employed.
- amino acids 1 to 36 of the Mad mSIN3 interaction domain (SID) have been fused to the N-terminus of a zinc finger protein (Ayer et al. (1996) Mol. Cell. Biol. 76:5772-5781 ).
- This small domain is found at the N-terminus of the transcription factor Mad and is responsible for mediating its transcriptional repression by interacting with mSIN3, which in turn interacts the co-repressor N-CoR and with the histone deacetylase mRPD1 (Heinzel et al. (1997) Nature 357:43-46).
- Exemplary and preferred transcription activation domains include any protein or factor that regulates transcription.
- Examplary transcriptional regulation domains include, but are not limited to, VP1 6, TA2, VP64, STAT6 amd relA.
- Integrin ⁇ 3 as a target for cancer gene therapy Integrin ⁇ i 3 is the most promiscous member of the integrin family and has been identified as a marker of angiogenic vascular tissue. For instance, integrin ⁇ ff 3 shows enhanced expression on blood vessels in human wound granulation tissue but not in normal skin.
- integrin ⁇ 9 3 blocks cytokine- or tumor-induced angiogenesis on the chick chorioallantoic membrane. Therefore, inhibition of integrin ⁇ -? 3 expression provides an approach to block tumor-induced angiogenesis.
- ErbB-2 receptor tyrosine kinases as a target for cancer gene therapy
- ErbB-2 is over- expressed as a result of gene amplification and/or transcriptional deregulation in a high percentage of human adenocarcinomas arising at numerous sites, including breast, ovary, lung, stomach, and salivary gland. Increased expression of ErbB-2 per se leads to constitutive activation of its intrinsic tyrosine kinase. Many clinical studies have shown that patients with tumors showing elevated expression of ErbB-2 have poorer prognosis. Thus, the high occurrence of its aberrant expression in human cancer, as well as the aggressive behavior of over- expressing tumors, make ErbB-2 an attractive target for therapy. Generation and construction of zinc fingers and fusion proteins targeted to erbB-2 and integrin ⁇ 3 are described in the EXAMPLES.
- the targeted gene is an exogenous gene, particularly a gene that encodes a therapeutic product
- the gene is provided as in an expression cassette operatively linked to a promoter and regulatory region with which the fusion protein specifically interacts.
- the cassette includes at least one polynucleotide domain recognized by the corresponding zinc finger domain present in the fusion protein and a suitable promoter to direct transcription of the exogenous gene.
- the regulatable expression cassette contains three to six response elements and interacts with nucleic acid binding domain of the ligand activated transcriptional regulatory fusion protein.
- the exogenous gene encodes a therapeutic product, such as a growth factor, that can supplement peptides, polypeptides or proteins encoded by endogenous expressed genes, thereby providing an effective therapy.
- the gene encodes a suitable reporter molecule that can be detected by suitable direct or indirect means.
- the cassette can be inserted into a suitable delivery vehicle for introduction into cells.
- suitable delivery vehicle include, but are not limited to, human adenovirus vectors, adeno-associated vectors, murine or lenti virus derived retroviral vectors, and a variety of non-viral compositions including liposomes, polymers, and other DNA containing conjugates.
- nucleic acids There are available to one skilled in the art multiple viral and non- viral methods suitable for introduction of a nucleic acid molecule into a target cell. Genetic modification of a cell may be accomplished using one or more techniques well known in the gene therapy field (Human Gene Therapy, April 1 994, Vol. 5, p. 543-563; Mulligan, R.C. 1 993) .
- transgene expression can be applied to a wide variety of applications for gene therapy.
- the ability to control expression of an exogenously introduced transgene is important for the safety and efficacy of most or all envisioned cell and gene therapies*
- Control of transgene expression can be used to accomplish regulation of a therapeutic protein level, ablation of a desired- cell population, either the vector containing cells or others, or activation of a recombinase or other function resulting in control of vector function within the transduced cells. Further, such control permits termination of a gene therapy treatment if necessary.
- Vectors for gene therapy include any known to those of skill in the art, and include any vectors derived from animal viruses and artificial chromosomes.
- the vectors may be designed for integration into the host cell's chromosomes or to remain as extrachromosomal elements.
- Such vectors include, but are not limited to human adenovirus vectors, adeno-associated viral vectors, retroviral vectors, such as murine retroviral vectors and lentivirus-derived retroviral vectors.
- non-viral compositions for targeting and/or delivery of genetic material, including, but are not limited to, liposomes, polymers, and other DNA containing compositions, and targeted conjugates, such as nucleic acids linked to antibodies and growth factors.
- Any delivery system is intended for use of delivery of the nucleic acid constructs encoding the fusion polypeptide and also targeted exogenous genes.
- Such vector systems can be used to deliver the ZFP-LBD fusion proteins and the inducible transgene cassette either in vitro or in vivo, depending on the vector system.
- vectors can be administered intravenously to transduce the liver and other organs, introduced directly into the lung, or into vascular compartments temporarily localized by ligation or other methods. Methods for constructing such vectors, and methods and uses thereof are known to those skilled in the field of gene therapy.
- one vector encodes the fusion protein regulator and a second vector encodes the inducible transgene cassette.
- Vectors can be mixed or delivered sequentially to incorporate into cells the regulator and transgene at the appropriate amounts. Subsequent administration of and effective amount of the ligand by standard routes would result in activation of the transgene.
- the nucleic acid encoding the fusion protein and the inducible transgene can be included in the same vector construction.
- the nucleic acid encoding the fusion protein would be positioned within the vector and expressed from a promoter in such a way that it did not interfere with the basal expression and induciblity of the transgene cassette.
- the use of cell or tissue specific promoters to express the fusion protein confers an additional level of specificity on the system. Dual component vectors and use for gene therapy are known (see, e.g. , Burcin et al. (1999) Proc. Natl. Acad. Sci. USA 96: 335-360, which describes an adenovirus vector fully deleted of viral backbone genes).
- gene therapy can be accomplished using a combination of the vectors described above.
- a retroviral vector can deliver a stably integrated, inducible transgene cassette into a population of cells either in vitro (ex vivo) or in vivo.
- the integrated transgene can be activated by transducing this same cell population with a second vector, such as an adenovirus vector capable of expressing the fusion protein, followed by the administration of the specific ligand inducing agent.
- a second vector such as an adenovirus vector capable of expressing the fusion protein
- HSV Tk herpes simplex virus thymidine kinase gene
- Suitable DNA viral vectors for use herein includes, but are not limited to an, adenovirus (Ad), adeno-associated virus (AAV), herpes virus, vaccinia virus or a polio virus.
- a suitable RNA virus for use herein includes but is not limited to a retrovirus or Sindbis virus. It is to be understood by those skilled in the art that several such DNA and RNA viruses exist that may be suitable for use herein.
- Adenoviral vectors have proven especially useful for gene transfer into eukaryotic cells and are widely available to one skilled in the art and is suitable for use herein.
- Adeno-associated virus has recently been introduced as a gene transfer system with potential applications in gene therapy. Wild- type AAV demonstrates high-level infectivity, broad host range and specificity in integrating into the host cell genome.
- Herpes simplex virus type-1 (HSV-1 ) vectors are available and are especially useful in the nervous system because of its neurotropic property.
- Vaccinia viruses, of the poxvirus family have also been developed as expression vectors. Each of the above-described vectors is widely available and is suitable for use herein.
- Retroviral vectors are capable of infecting a large percentage of the target cells and integrating into the cell genome.
- Preferred retroviruses include lentiviruses, such as but are not limited to, HIV, BIV and SIV.
- viral vectors that can be used for gene therapy as taught herein include adenovirus, herpes virus, vaccinia, adeno-associated virus (AAV), or, preferably, an RNA virus such as a retrovirus.
- the retroviral vector is a derivative of a murine or avian retrovirus, or is a lentiviral vector.
- the preferred retroviral vector is a lentiviral vector.
- retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), SIV, BIV, HIV and Rous Sarcoma Virus (RSV) .
- MoMuLV Moloney murine leukemia virus
- HaMuSV Harvey murine sarcoma virus
- MuMTV murine mammary tumor virus
- SIV BIV
- HIV Rous Sarcoma Virus
- retroviral vectors can incorporate multiple genes. All of these vectors can transfer or incorporate a gene for a selectable marker so that transduced cells can be identified and generated.
- a zinc finger derived-DNA binding polypeptide sequence of interest into the viral vector, along with another gene that encodes the ligand for a receptor on a specific target cell, for example, the vector is made target specific.
- Retroviral vectors can be made target specific by inserting, for example, a polynucleotide encoding a protein. Preferred targeting is accomplished by using an antibody to target the retroviral vector.
- Those of skill in the art know of, or can readily ascertain without undue experimentation, specific polynucleotide sequences which can be inserted into the retroviral genome to allow target specific delivery of the retroviral vector containing the zinc finger-nucleotide binding protein polynucleotide. Since recombinant retroviruses are defective, they require assistance in order to produce infectious vector particles.
- helper cell lines that contain plasmids encoding all of the structural genes of the retrovirus under the control of regulatory sequences within the LTR. These plasmids are missing a nucleotide sequence which enables the packaging mechanism to recognize an RNA transcript for encapsitation.
- Helper cell lines which have deletions of the packaging signal include but are not limited to ⁇ 2, PA317 and PA1 2, for example. These cell lines produce empty virions, since no genome is packaged. If a retroviral vector is introduced into such cells in which the packaging signal is intact, but the structural genes are replaced by other genes of interest, the vector can be packaged and vector virion produced.
- Nonviral Delivery systems include DNA-ligand complexes, adenovirus-ligand-DNA complexes, direct injection of DNA, CaPO 4 precipitation, gene gun techniques, electroporation, liposomes and lipofection. Any of these methods.are available to one skilled in the art and would be suitable for use herein. Other suitable methods are available to one skilled in the art, and it is to be understood .that the herein may be accomplished using any of the available methods of transfection.
- colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil- in-water emulsions, micelles, mixed micelles, and liposomes, which are preferred.
- Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo. It has been shown that large unilamellar vesicles (LUV), which range in size from 0.2-4.0 ⁇ m can encapsulate a substantial percentage of an aqueous buffer containing large macromolecules. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (Fraley, et al., Trends Biochem. Sci., 6:77, 1981 ).
- Lipofection may be accomplished by encapsulating an isolated nucleic acid molecule within a liposomal particle and contacting the liposomal particle with the cell membrane of the target cell.
- Liposomes are self-assembling, colloidal particles in which a lipid bilayer, composed of amphiphilic molecules such as phosphatidyl serine or phosphatidyl choline, encapsulates a portion of the surrounding media such that the lipid bilayer surrounds a hydrophilic interior.
- Unilammellar or multilammellar liposomes can be constructed such that the interior contains a desired chemical, drug, or, as provide herein, an isolated nucleic acid molecule.
- Liposomes have been used for delivery of polynucleotides in plant, yeast and bacterial cells as well as mammalian cells.
- characteristics among the following should be present: (1 ) encapsulation of the genes of interest at high efficiency while not compromising their biological activity; (2) preferential and substantial binding to a target cell in comparison to non- target cells; (3) delivery of the aqueous contents of the vesicle to the target cell cytoplasm at high efficiency; and (4) accurate and effective expression of genetic information (Mannino, et al., Biotechniques, 6:682, 1988).
- composition of the liposome is usually a combination of phospholipids, particularly high-phase-transition-temperature phospholipids, usually in combination with steroids, especially cholesterol.
- phospholipids or other lipids may also be used.
- the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations.
- lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides. Particularly useful are diacylphosphatidylglycerols, where the lipid moiety contains from 14-18 carbon atoms, particularly from 1 6-18 carbon atoms, and is saturated.
- Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine and distearoylphosphatidylcholine.
- the targeting of liposomes has been classified based on anatomical and mechanistic factors.
- Anatomical classification is based on the level of selectivity, for example, organ-specific, cell-specific, and organelle- specific.
- Mechanistic targeting can be distinguished based upon whether it is passive or active. Passive targeting uses the natural tendency of liposomes to distribute to cells of the reticulo-endothelial system (RES) in organs which contain sinusoidal capillaries.
- RES reticulo-endothelial system
- Active targeting involves alteration of the liposome by coupling the liposome to a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein, or by changing the composition or size of the liposome in order to achieve targeting to organs and cell types other than the naturally occurring sites of localization.
- a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein
- the surface of the targeted delivery system may be modified in a variety of ways.
- lipid groups can be incorporated into the lipid bilayer of the liposome in order to maintain the targeting ligand in stable association with the liposomal bilayer.
- Various linking groups can be used for joining the lipid chains to the targeting ligand.
- the compounds bound to the surface of the targeted delivery system are ligands and receptors perimitting the targeted delivery system to find and "home in” on the desired cells.
- a ligand may be any compound of interest that interacts with another compound, such as a receptor.
- TAAs tumor-associated antigens
- a targeted delivery system offers a significant improvement over randomly injecting nonspecific liposomes.
- a number of procedures can be used to covalently attach either polyclonal or monoclonal antibodies to a liposome bilayer.
- Antibody-targeted liposomes can include monoclonal or polyclonal antibodies or fragments thereof such as Fab, or F(ab') 2 , as long as they bind efficiently to an the antigenic epitope on the target cells. Liposomes may also be targeted to cells expressing receptors for hormones or other serum factors. 2. Administration a. Delivery of constructs to cells The cells may be transfected in vivo, ex vivo or in vitro. The cells may be transfected as primary cells isolated from a patient or a cell line derived from primary cells, and are not necessarily autologous to the patient to whom the cells are ultimately administered. Following ex vivo or in vitro transfection, the cells may be implanted into a host.
- Genetic modification of the cells may be accomplished using one or more techniques well known in the gene therapy field (see, e.g., (1994) Human Gene Therapy 5:543-563).
- Administration of a nucleic acid molecules provided herein to a target cell in vivo may be accomplished using any of a variety of techniques well known to those skilled in the art.
- the vectors of the herein may be administered orally, parentally, by inhalation spray, rectally, or topically in dosage unit formulations containing conventional pharmaceutically acceptable carriers, adjuvants, and vehicles.
- Suppositories for rectal administration of the drug can be prepared by mixing the drug with a suitable non-irritating excipient such as cocoa butter and polyethylene glycols that are solid at ordinary temperatures but liquid at the rectal temperature and therefore melt in the rectum and release the drug.
- a suitable non-irritating excipient such as cocoa butter and polyethylene glycols that are solid at ordinary temperatures but liquid at the rectal temperature and therefore melt in the rectum and release the drug.
- the dosage regimen for treating a disorder or a disease with the vectors and/or compositions provided is based on a variety of factors, including the type of disease, the age, weight, sex, medical condition of the patient, the severity of the condition, the route of administration, and the particular compound employed. Thus, the dosage regimen may vary widely, but can be determined empirically using standard methods.
- the pharmaceutically active compounds i.e., vectors
- the pharmaceutical composition may be in the form of, for example, a capsule, a tablet, a suspension, or liquid.
- the pharmaceutical composition is preferably made in the form of a dosage unit containing a given amount of DNA or viral vector particles (collectively referred to as "vector").
- vector may contain an amount of vector from about 10 3 -10 15 viral vector particles, preferably from about 10 6 -10 12 viral particles.
- a suitable daily dose for a human or other mammal may vary widely depending on the condition of the patient and other factors, but, once again, can be determined using routine methods.
- the vector may also be administered by injection as a composition with suitable carriers including saline, dextrose, or water.
- nucleic acids and /or vectors herein can be administered as the sole active pharmaceutical agent, they can also be used in combination with one or more vectors or other agents.
- the therapeutic agents can be formulated as separate compositions that are given at the same time or different times, or the therapeutic agents can be given as a single composition.
- Deliver ligand Ligands similarly may be delivered by any suitable mode of administration, including by oral, parenteral, intravenous, intramuscular and other known routes. Any known pharmaceutical formulations is contemplated.
- Ligands As noted, the ligands may be naturally-occurring ligands, but are preferentially non-natural ligands with which the LBD is modified to specificallly interact. Methods for modifying the LBD are known, as are methods for screening for such ligands. Ligands include, non-natural ligands, hormones, anti-hormones, synthetic hormones, and other such compounds.
- non- natural ligands, anti-hormones and non-native ligands include, but are not limited to, the following: 1 15-4-dimethylaminophenyl)-1 7 ⁇ -hydroxy-1 7 ⁇ - propinyl-4,9-e stradiene-3-one (RU38486 or Mifepestone); 1 1 ?-(4-di- methylaminophenyl)-1 7 ⁇ -hydroxy-1 7 ?-(3-hydroxypropyl)-1 3 ⁇ -methy 1-4,9- gonadiene-3-one (ZK98299 or Onapristone); 1 15-(4-acetylphenyl)-1 75- hydroxy-1 7 ⁇ -(1 -propinyl)-4,9-estr adiene-3-one (ZK1 1 2993); 1 15-(4- dimethylaminophenyD-175-hydroxy-17 ⁇ -(3-hydroxy-1 (Z)-propenyl-estra- 4,9-diene-3-one
- Additional non-natural ligands include, in general, synthetic non-steroidal estrogenic or anti-estrogenic compoun ⁇ s, broadly defined as selective estrogen receptor modulators (SERMS).
- SERMS selective estrogen receptor modulators
- coumpounds include, but are not limited to, tamoxifen and raloxifen.
- compositions and combinations Also provided is a pharmaceutical composition containing a therapeutically effective amount of the fusion protein, or a nucleic acid molecule encoding the fusion protein in a pharmaceutically acceptable carrier.
- Pharmaceutical compositions containing one or more fusion proteins with different zinc finger-nucleotide binding domains are contemplatd.
- Combinations containing a plurality of compositions are also provided. Preparation of the compositions The preparation of a pharmacological composition that contains active ingredients dissolved or dispersed therein is well known.
- compositions are prepared as sterile injectables either as liquid solutions or suspensions, aqueous or non-aqueous, however, solid forms suitable for solution, or suspensions, in liquid prior to use can also be prepared .
- the preparation can also be emulsified. Tablets and other solid forms are contemplated.
- the active ingredient can be mixed with excipients that are pharmaceutically acceptable and compatible with the active ingredient and in amounts suitable for use in the therapeutic methods described herein. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol or the like and combinations thereof.
- the composition can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, as well as pH buffering agents and the like which enhance the effectiveness of the active ingredient.
- the therapeutic pharmaceutical composition can include pharma- ceutically acceptable salts of the components therein.
- Pharmaceutically acceptable salts include the acid addition salts (formed with the free amino groups of the polypeptide) that are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, tartaric, mandelic and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine and others.
- Physiologically tolerable carriers are well known in the art.
- Exemplary of liquid carriers are sterile aqueous solutions that contain no materials in addition to the active ingredients and water, or contain a buffer such as sodium phosphate at physiological pH value, physiological saline or both, such as phosphate-buffered saline.
- aqueous carriers can contain more than one buffer salt, as well as salts such as sodium and potassium chlorides, dextrose, propylene glycol, polyethylene glycol and other solutes.
- Liquid compositions can also contain liquid phases in addition to and to the exclusion of water. Exemplary of such additional liquid phases are glycerin, vegetable oils such as cottonseed oil, organic esters such as ethyl oleate, and water-oil emulsions. D. Methods of gene regulation
- the nucleic acid binding domain of the fusion protein binds to a portion of the target nucleic acid moleucule and the ligand binds to the ligand binding domain of the fusion protein. Exposure can occur in vitro, in situ or in vivo.
- the amount of zinc finger derived-nucleotide binding polypeptide required is that amount necessary to either displace a native zinc finger- nucleotide binding protein in an existing protein/promoter complex, or that amount necessary to compete with the native zinc finger-nucleotide binding protein to form a complex with the promoter itself.
- the amount required to block a structural gene or RNA is that amount which binds to and blocks RNA polymerase from reading through on the gene or that amount which inhibits translation, respectively.
- the method is performed intracellularly. By functionally inactivating a promoter or structural gene, transcription or translation is suppressed.
- a method for inhibiting or suppressing the function of a cellular gene or regulatory sequence that includes a zinc finger-nucleotide binding motif is effected by contacting the zinc finger-nucleotide binding motif with an effective amount of a fusion protein that includes zinc finger-nucleotide binding polypeptide derivative that binds to the motif.
- the method includes inhibiting the transcriptional transactivation of a promoter containing a zinc finger-DNA binding motif.
- the zinc finger-nucleotide binding polypeptide derivative may bind to a motif within a structural gene or within an RNA sequence.
- the fusion proteins are administered either as a protein or as a nucleic acid encoding the protein and delivered to cells or tissues in a mammal, such as a human.
- the fusion protein is targeted either to a specific sequence in the genome (an endogenous gene) or to an exogenously added gene, which is administerd as part of an expression cassette.
- a ligand that specifically interacts with the LBD in the fusion protein is adminstered.
- the expression cassette which can be present in a vector, is administered, simultaneous with or subsequent to adminstration of the fusion protein.
- fusion protein that includes the zinc finger-nucleotide binding polypeptide, either as the fusion or protein or encoded by a nucleic acid molecule that is expressed in the cells, into cells of animals having the disorder.
- Delivery of the fusion protein or nucleic acid molecule can be effected by any method known to those of skill in the art, including methods described herein. For example, it can be effected using a recombinant expression vector such as a chimeric virus or a colloidal dispersion system.
- the fusion proteins provided herein can be used for treating a variety of disorders.
- the proteins can be used for treating malignancies of the various organ systems, including but are not limited to, lung, breast, lymphoid, gastrointestinal, and genito-urinary tract adenocarcinomas, and other malignancies such as most colon cancers, renal-cell carcinoma, prostate cancer, non-small cell carcinoma of the lung, cancer of the small intestine, and cancer of the esophagus.
- a polynucleotide encoding the zinc finger-nucleotide binding polypeptide is also useful in treating non-malignant cell-proliferative diseases such as psoriasis, pemphigus vulgaris, Behcet's syndrome, and lipid histiocytosis.
- non-malignant cell-proliferative diseases such as psoriasis, pemphigus vulgaris, Behcet's syndrome, and lipid histiocytosis.
- any disorder that is etiologically linked to the activation of a zinc finger-nucleotide binding motif containing promoter, structural gene, or RNA would be considered susceptible to treatment with a polynucleotide encoding a derivative or variant zinc finger derived- nucleotide binding polypeptide.
- Variant zinc finger proteins have been designed and constructed to selectively bind to specific DNA sequences (Table 1 ).
- Table 1 summarizes the sequences (SEQ ID NO: 77-92) showing the highest selectivity for the sixteen embodiment of GNN target triplets.
- Table 1
- Biotinylated, hairpin-structured target site oligos for panning of finger 2 (“F2") libraries had the following sequence: F2XXX:
- Non-biotinylated, hairpin structured specific competitor oligos had the following sequence: F2NNN:
- the pre-binding was carried out in 400 ⁇ Zinc buffer A containing 1 % Blotto, 5mM DTT, 4 ⁇ g sheared herring sperm DNA and 100 ⁇ l phage preparation. Typically, 10 times less specific competitor than target oligo was used for the first round of panning. For the subsequent panning rounds, the amount of specific competitor was gradually increased, up to a maximum of 12 ⁇ g in the last panning round(s). Following 30 minutes at room temperature, 100 ⁇ Zinc buffer A containing 0.4 ⁇ g biotinylated target hairpin oligo were added. After 2.5 to 3.5 hours at RT, phage bound to the target oligo was collected by the addition of 50 ⁇
- Dynabeads M-280 suspension (Dynal) and incubation for one hour at RT.
- the beads were collected with a magnet, washed 10 times with Zinc buffer A (10 mM Tris, pH 7.5 / 90 mM KCI / 1 mM MgCI 2 / 90 ⁇ M ZnCI 2 ) containing 2% Tween-20 and 5mM DTT, and once with Zinc buffer A containing 5mM DTT. Phage was eluted for 30 minutes at RT with 25 ⁇ l of TBS containing 10 mg/ml trypsin. Following the addition of 75 ⁇ l Super Broth, eluted phage was allowed to infect 5ml of E.
- Carbenicillin 50 ⁇ g/ml
- ZnCI 2 90 ⁇ M
- the culture was incubated at 37 degrees Celsius for two hours.
- Kanamycin 50 ⁇ g/ml
- ZnCI 2 90 ⁇ M
- Phage was purified from culture supernatants by PEG precipitation and resuspended in 2 ml Zinc buffer A containing 1 % BSA and 5 mM DTT for further rounds of panning.
- the number of phage was determined by using various dilutions of the phage prep for infection of E. coli ER2537, followed by plating onto Carbenicillin-containing LB-agar places.
- zinc finger cDNAs were subcloned into the bacterial expression vector pMal-CSS, a derivative of pMal-C2 (New England Biolabs), allowing for expression of the zinc finger proteins as maltose binding protein (MBP) fusions.
- pMal-CSS bacterial expression vector
- MBP maltose binding protein
- F2 coding regions were PCR amplified from selected or designed F2 variants and assembled by PCR overlap extension.
- DNAs encoding three-finger proteins with a Zif 268 or Sp1 C framework were synthesized from 8 or 6 overlapping oligonucleotides, respectively.
- Sp1 C framework constructs were generated as follows. In the case of E2C-HS1 (Sp1 ), 0.4 pmole each of oligonucleotides
- SPE2-3 (5'-GCG AGC AAG GTC GCG GCA GTC ACT AAA AGA TTT GCC GCA CTC TGG GCA TTT ATA CGG TTT TTC ACC-3' (SEQ ID NO: 26) and SPE2-4 (5'GTG ACT GCC GCG ACC TTG CTC GCC ATC AAC GCA CTC ATA CTG GCG AGA AGC CAT ACA AAT GTC CAG AAT GTG GC-3') (SEQ ID NO: 27) were mixed with 40 pmole each of oligonucleotides SPE2-2 (5'-GGT AAG TCC TTC TCT CAG AGC TCT CAC CTG GTG CGC CAC CAG CGT ACC CAC ACG GGT GAA AAA CCG TAT AAA TGC CCA GAG-3') (SEQ ID NO: 28) and SPE2-5 (5'-ACG CAC CAG CTT GTC AGA GCG GCT GAA AGA CTT GCC ACA TTC TGG ACA T
- the E2C-HS2(Sp1 ), B3B-HS1 (Sp1 ), B3B-HS2(Sp1 ), B3C2- HS1 (Sp1 ), and B3C2-HS2(Sp1 ) DNAs were generated in the same way, using analogous sets of oligonucleotides differing only in the recognition helix coding regions. All assembled three-finger coding regions were digested with the restriction endonuclease Sfi1 and cloned into pMal-CSS, a derivative of the bacterial expression vector pMal-C2 (New England Biolabs), allowing for expression of the zinc finger proteins as MBP fusions.
- DNAs encoding six-finger proteins with each of the different frameworks were assembled in pMal-CSS using Xma 1 and BsrF1 restriction sites included in the sequences flanking the three-finger coding regions (Beerli er a/. (1998) Proc. Natl. Acad. Sci. U. S.A.95: 14628- 14633).
- Streptavidin at a concentration of 0.2 ⁇ g/25 ⁇ l in PBS was added to each well of a 96 well plate, then incubated for 1 hour at 37 degrees
- the plate was washed 2x with water, then biotinylated oligo at 0.1 ⁇ g/25 ⁇ l in PBS, or just PBS, was added to the appropriate wells and incubated for 1 hour at 37 degrees Celsius.
- the plate was washed 2x with water, then each well was filled with 3% BSA in PBS and incubated for 1 hour at 37 degrees Celsius.
- the BSA was removed without washing, and 25 ⁇ l of the appropriate extract diluted in Zinc buffer A containing 5mM DTT was added to the appropriate wells. The binding reaction was allowed to proceed for 1 hour at room temperature.
- the plate was washed 8x with water, then ⁇ -MBP mAb in Zinc buffer A and 1 % BSA was added to the wells followed by incubation for 30 minutes at room temperature.
- the plate was washed 8x with water, then anti-mouse mAb conjugated to alkaline phosphatase in Zinc buffer A was added, and the plate was incubated for 30 minutes at room temperature.
- 25 ⁇ l of alkaline phosphatase substrate and developer was added to each well. Incubation was performed at room temperature, and the OD 405 of each well was determined at 30 minute and 1 hour time points.
- the VP64 DNA encoding a tetrameric repeat of VP1 6's minimal activation domain, comprising amino acids 437 to 447 (Seipel et al. (1 992) EMBO 73:4961 ), was generated from two pairs of complementary oligonucleotides. All resulting effector domain-encoding fragments were fused to zinc finger coding regions by standard cloning procedures, such that each resulting construct contained an internal SV40 nuclear localization signal, as well as a C-terminal HA decapeptide tag. Fusion constructs were cloned into pcDNA3 for expression in mammalian cells.
- integrin ⁇ 3 and erbB-2 luciferase reporter plasmids An integrin 53 promoter fragment encompassing nucleotides -584 to -1 (with respect to the ATG codon) was PCR amplified from human genomic DNA, using the primers b3p(Nhe1 )-f (5'-GAG GAG GAG GCT AGC GGG ATG TGG TCT TGC CCT CAA CAG GTA GG-3') (SEQ ID NO: 32) and b3p(Hind3)-b (5'-GAG GAG GAG AAG CTT CTC GTC CGC CTC CCG CGG CGC TCC GC-3') (SEQ ID NO: 33), and Taq Expand DNA Polymerase mix (Boehringer). The cycling conditions were: 30 minutes at
- PCR amplified under the same conditions using the primers e2p(Nhe1 )-f (5'-GAG GAG GAG GCT AGC CGA TGT GAC TGT CTC CTC CCA AAT TTG TAG ACC-3') (SEQ ID NO: 34) and e2p(Hind3)-b (5'-GAG GAG GAG AAG CTT GGT GCT CAC TGC GGC TCC GGC CCC ATG-3') (SEQ ID NO: 35).
- PCR products were purified with the Qiagen PCR prep kit, digested with the restriction endonucleases Nhe1 and Hind3, and cloned into pGL3basic (Promega) .
- erbB-2 promoter fragment encompassing nucleotides -1 571 to - 24 was excised from pSVOAL ⁇ 57erbB-2(N-N) by Hind3 digestion and subcloned into pGL3basic.
- pSVOAL ⁇ 57erbB-2(N-N) was a gift from
- Luciferase assays For all transfections, HeLa cells were plated in 24 well dishes and used at a confluency of 40-60%. Typically, 200 ng reporter plasmid (pGL3- promoter constructs or, as negative control, pGL3basic) and 20 ng effector plasmid (zinc finger constructs in pcDNA3 or, as negative control, empty pcDNA3) were transfected using the lipofectamine reagent (Gibco BRL). Cell extracts were prepared approximately 48 hours after transfection. Luciferase activity was measured with the Promega luciferase assay reagent, in a MicroLumat LB96P luminometer (EG&G)
- FIGURE 1 in vitro evolution of a six-finger protein binding an 18bp target sequence can follow the strategy outlined in FIGURE 1 .
- the target sequence is divided into six 3bp sub-sites, A-F.
- A-F 3bp sub-sites
- a Zif268- based zinc finger phage display library in which the central finger 2 is randomized is selected against all 6 subsites in the context of the 2 wild type fingers.
- cDNAs encoding three-finger proteins recognizing either half-site 1 (ABC) or half-site 2 (DEF) are constructed via
- three-and six-finger proteins can be produced by "helix grafting".
- the framework residues of the zinc finger domains those residues that support the presentation of the recognition helix, vary between proteins.
- the framework residues play a role in affinity and specificity.
- amino acid positions -2 to 6 of the DNA recognition helices are either grafted into a Zif268 (Pavletich et al. (1991 ) Science 252:809-817) or an Sp1 C framework (Desjarlais et al. (1993) Proc. Natl. Acad. Sci. U.S.A.
- erbB-2 target site B2 was designed to overlap with the AP-2 binding site GCTGCAGGC, with the intention of inhibiting expression of ErbB-2 not only as a result of active transcriptional repression, but also by competition with an important transcription factor.
- erbB-2 target sites C and D zinc finger proteins binding the other erbB-2 target sites (i.e. erbB-2 target sites C and D), affect transcription as a result of their effector domains.
- Integrin ⁇ 3 target sequences B and C2 were chosen at various distances from the transcription start site, to allow for a comparison of the efficacy of transcriptional regulation. Since the selected zinc finger proteins are fused to transcriptional effector domains (Sadowski et al., ( 1 988) Nature 335:563-564; Margolin et al. (1 994) Proc. Natl. Acad. Sci. USA 37:4509-4513) ; Sgouras et al. (1995) EMBO 74:4781 -4793; Ayer et al. (1996) Mol. Cell. Biol. 76:5772-5781 ), binding of a zinc finger protein per se have an effect on the level of transcription.
- a list of chosen target sequences for the selection of zinc finger proteins is given in Table 2, below. Since zinc finger proteins make base contacts predominantly with one strand of the DNA double helix, only the relevant strand of the target sequence is listed and designated +/- with respect to the coding strand. The location of the target sequences and position relative to the major transcription start site(s) is given.
- the sublibraries contain approximately 4x10 9 independent clones each.
- the top line shows the wild type sequence of finger 2.
- the NNK randomized codon provides all 20 amino acids in 32 codons.
- the VNS randomized codon provides 16 amino acids in 24 codons, excluding Phe, Trp, Tyr, Cys and all stops.
- Table 3 Mutagenesis strategy for randomization of finger 2 of Zif268-C7, showing helix positions -3 to 7.
- VNS VNS
- VNS VNS
- VNS VNS
- VNS VNS
- VNS VNS
- VNS VNS
- VNS VNS
- H VNS
- a 5'- and 3'-G selected an arginine at helix positions 6 and -1 , respectively, while a central G selected an a histidine or lysine at position 3 of the recognition helix.
- a central A selected an asparagine, a 3'-A a glutamine, a central T a serine or alanine, a 3'-T a threonine or serine, a central C an aspartate or threonine, and a 3'-C an aspartate or glutamate at the corresponding helix positions.
- Two different strategies for generating three-finger proteins recognizing 9 bp of DNA sequence were used. Each strategy is based on the modular nature of the zinc finger domain, and takes advantage of a family of zinc finger domains recognizing triplets of the 5'-GNN-3' type defined in Table 1 . Two three-finger proteins recognizing half sites (HS) 1 and 2 of the 5'-(GNN) 6 -3' erbB-2 target site e2c were generated in the first strategy by fusing the pre-defined finger 2 (F2) domain variants together using a PCR assembly strategy.
- HS three-finger proteins recognizing half sites
- F2c pre-defined finger 2
- helix grafting As an alternative to the serial connection of F2 domain variants, in the second strategy, three-finger proteins specific for the two halfsites of the erbB-2 target site e2c (Table 4, below), were produced by "helix grafting.”
- the framework residues may play a role in affinity and specificity.
- amino acid positions -2 to 6 of the DNA recognition helices were either grafted into a Zif268 (Pavletich et at. (1991 ) Science 252:809-817) or an Sp1 C framework (Desjarlais et al. (1993) Proc. Natl. Acad. Sci. U.S.A. 50:2256-2260).
- the Sp1 C protein is a designed consensus protein shown to have enhanced stability towards chelating agents.
- the proteins were expressed from DNA templates prepared by a rapid PCR-based gene assembly strategy. In each case, ELISA analysis of MBP fusion proteins showed that the DNA binding specificities and affinities (Table 4, below) observed with the F2 framework constructs were retained. Three finger proteins recognizing HS1 and HS2 of the integrin 53 target sites b3b and b3c2 have also been generated, using the Sp1 C backbone. Preliminary ELISA data showed that these proteins bind their respective targets with good specificity. Further characterization of proteins can be made, such as determination of their affinities by gel shift analysis. See Table 4, below.
- GIG > 1 , ,400 pGGA SQRAHLER GGA 3 0.3 pmGGT STSGHLVR GGT 15 1.5 ⁇ GGC > 2,400 pmGGC SDPGHLVR GGC 40 4.0 pmGAG SRSDNLVR GAG 1 0.1 n GGG 45 4.5 pmGAA SQSSNLVR GAA 0.5 0.05 pGAT STSGNLVR GAT 3 0.3 pmGAC SDPGNLVR GAC 3 0.3 ⁇ n GCC 90 9.0 pGTG SRKDSLVR GTG 3 0.3 pmGTG SRSDELVR GTG 15 1.5 ⁇ ⁇ GAG 30 3.0 pGTA SQSSSLVR GTA 25 2.5
- E2C(Sp 1 ), B3B(Sp1 ), and B3C2(Sp1 ) six- finger proteins were fused to a number of effector domains (Beerli et al. ( 1 998) Proc. Natl. Acad. Sci. U.S.A.95: 14628-1 4633).
- Transcriptional repressors were generated by attaching either of three human-derived repressor domains to the zinc finger protein.
- the first repressor protein was prepared using the ERF repressor domain (ERD) (Sgouras et al.
- ERF ets2 repressor factor
- the second repressor protein was prepared using the Kr ⁇ ppel- associated box (KRAB) domain (Margolin et al. (1994) Proc. Natl. Acad. Sci. USA 57:4509-4513).
- KRAB Kr ⁇ ppel- associated box
- This repressor domain is commonly found at the N-terminus of zinc finger proteins and presumably exerts its repressive activity on TATA-dependent transcription in a distance- and orientation- independent manner, by interacting with the RING finger protein KAP-1 .
- the KRAB domain found between amino acids 1 and 97 of the zinc finger protein KOX1 was used. In this case an N-terminal fusion with the six- finger protein was constructed.
- transcriptional activators were generated by fusing the zinc finger protein to amino acids 41 3 to 489 of the herpes simplex virus VP1 6 protein (Sadowski et al. ( 1 988) Nature 335:563-564), or to an artificial tetrameric repeat of VP1 6's minimal activation domain, DALDDFDLDML (SEQ ID NO: 36) (Seipel et al. ( 1 992)
- Reporter constructs containing fragments of the erbB-2 promoter coupled to a luciferase reporter gene were generated to test the specific activities of the erbB-2 specific synthetic transcriptional regulators.
- the target reporter plasmid contained nucleotides -758 to -1 with respect to the ATG initiation codon, whereas the control reporter plasmid contained nucleotides -1 571 to -24, thus lacking all but one nucleotide of the E2C binding sfte encompassed in positions -24 to -7. Both promoter fragments displayed similar activities when transfected transiently into HeLa cells, in agreement with previous observations.
- HeLa cells were transiently co-transfected with each of the zinc finger expression vectors and the luciferase reporter constructs (Beerli et al., (1998) Proc. Natl. Acad. Sci. U.S.A.95: 14628- 14633). Significant repression was observed with each construct.
- the ERD and SID fusion proteins produced approximately 50% and 80% repression, respectively.
- the most potent repressor was the KRAB fusion protein. This protein caused complete repression of erbB-2 promoter activity. The observed residual activity was at the background level of the promoter-less pGL3 reporter.
- erbB-2 specific zinc finger proteins to mediate activation of transcription was demonstrated.using the same two reporter constructs.
- the VP1 6 fusion protein was found to stimulate transcription approximately 5-fold, whereas the VP64 fusion protein produced a 27- fold activation.
- This dramatic .stimulation of promoter activity caused by a single VP16-based transcriptional activator is exceptional in view of the fact that the zinc finger protein binds in the transcribed region of the gene. This again demonstrates that mere binding of a zinc finger protein, even with one with sub-nanomolar affinity, in the path of RNA polymerase II need not necessarily negatively affect gene expression.
- a reporter plasmid was constructed containing the luciferase open reading frame under control of the integrin 53 promoter.
- the integrin 53 promoter fragment had a very low activity. In fact; in some experiments no activation of luciferase expression over background was detected, preventing an analysis of the effects of the KRAB fusion proteins.
- the VP64 fusion proteins were tested an efficient activation of the integrin 53 promoter was observed.
- B3B(SpD- VP64 and B3C2(Sp1 )-VP64 stimulated transcription 12 and 22fold, respectively. Activation of transcription was specific, since no effect on the activity of the erbB-2 promoter was detected.
- EXAMPLE 3 Fusion Protein Construct Comprising Progesterone Receptor Variant Amino acid sequence comparisons of steroid receptor family members indicates that they generally comprise a number of defined domains, including an N-terminal DNA binding domain and a more C- terminally located ligand binding domain. Importantly, these domains are modular and the DNA binding domain of progesterone receptor (PR) has been successfully exchanged for the Gal4 DNA binding domain.
- PR progesterone receptor
- the addition of a VP16 activation or a KRAB repressor domain to the N- or C- terminus of this construct yielded proteins that could regulate a Gal4 responsive reporter in a ligand dependent manner.
- ligand binding domain used in these studies is that it is derived from a mutant PR with a small C-terminal deletion. This mutant fails to respond to progesterone and is responsive only to progesterone antagonists such as RU486, making this system suitable for in vivo applications.
- the original PR DNA binding domain can be replaced by engineered zinc finger proteins.
- the three finger protein Zif268(C7) was fused to the N-terminus of the PR ligand binding domain (PBD) (aa 640 to
- steroid receptor dimers Since naturally occurring steroid receptors bind DNA as dimers, an important prerequisite for the application of this approach is the presence of suitable target sequences in the promoter of interest. Fortunately, the spacing and orientation of the two half-sites targeted by steroid receptor dimers is flexible. While a steroid response element usually includes an inverted repeat, or palindrome, also direct repeats or even everted repeats of the half-sites in variable spacing are tolerated (Aumais et al. (1996) J.
- promoter targeting is possible using a homodimer, for example by targeting the sequence 5'-GCC GGA GCC ATGGG GCC GGA GCC-3' (SEQ ID NO: 38), which is also found in the erbB-2 promoter and overlaps with the target sequence e2c
- the human estrogen receptor is shown in FIG. 2 as an example of a steroid receptor protein.
- the numbers below the rectangle indicate the position of the amino acid residues defining the borders of each domain.
- A/B is the domain of the amino terminus activation function 1 (AF-1 ), C is the DNA binding domain, D is called the hinge region, E is the ligand binding domain, which also contains the activation function 2 (AF-2) and F is the portion closest the carboxyl terminal, a domain whose function has not been fully established.
- the regions of the protein that participate and stabilize the homodimerized complex are distributed in the C, D and E domains. Regions throughout the steroid receptor ligand binding domain (region E in FIG. 2) as well as regions in the native DBD and hinge region (regions C and D respectively) contribute to homodimerization of the receptor.
- proteins containing three different length LBD fragments were constructed. These differing length LBD constructs are designated A, B, and C (FIG. 3).
- LBD fragment A represents what is generally referred to as the "minimal" LBD fragment.
- the native C or DNA binding region of estrogen receptor contains two zinc fingers of the C4-C4 class.
- the 5' or amino terminus finger contributes to DNA specific contacts; the 3' finger contributes to stabilizing the DNA binding domain dimer complex.
- LBD fragment C where the 3' native zinc finger is retained and fused directly to the C2H2 zinc finger array, was included. In order to optimize the ability of the fusion proteins to regulate gene expression, it may be necessary to add additional heterologous transactivating domains to the receptor.
- fusion proteins were constructed either with the full length LBD extending to estrogen receptor residue 595, or with LBD fragments truncated at amino acid (aa) 554 to remove the F region.
- the full-length constructs are referred to as long (L), the truncated versions as short (S) .
- All constructs contain a heterologous transactivation domain (TA) comprised of a VP1 6 minimal domain, unless otherwise noted, fused to the carboxy terminus of the ligand binding domain.
- VP16 minimal domain trimer has the amino acid residue sequence 3 x (PADALDDFDLDML) (SEQ ID NO: 36), and is the tetracycline controlled transactivator (tTA) TA2 (Baron et al. (1997)
- FIG. 3 provides a schematic summary of the cloning strategy and nomenclature related to the C2H2 DNA binding domain - ER ligand binding domain fusion proteins.
- the final construct contains three components: a C2H2 zinc finger domain (ZFP) at the amino end, a steroid receptor ligand binding domain (LBD) fragment in the middle, and a heterologous transactivation domain (TA) appended onto the carboxyl end.
- ZFP C2H2 zinc finger domain
- LBD steroid receptor ligand binding domain
- TA heterologous transactivation domain
- FIG. 4 Maps of specific examples constructed in the expression vector pcDNA3.1 are shown in FIG. 4 (C7LBDAS) (SEQ ID NO: 6), FIG. 5 (C7LBDBS) (SEQ ID NO: 8), FIG. 6 (C7LBDCS) (SEQ ID NO: 10), FIG. 7 (C7LBDAL) (SEQ ID NO: 7), FIG. 8 (C7LBDBL) (SEQ ID NO: 1 ), and FIG. 9
- C7LBDCL C7LBDCL
- ZFP Zn finger
- LBD human estrogen receptor ligand binding domain
- NR6 (43) tat ggg ggg etc age ate caa caa ggc act NR7 (44) cct act act agt gac cga aga gga ggg aga atg ttg aaa cac aag cgc
- the C2H2 DNA binding protein C7 was then excised from pcDNAC7VP16 by BgJII and Spel digestion and ligated into the BamHI and Spel site of each of the 3 constructions (pLBDASTA2, pLBDBSTA2 and pLBDCSTA2), which resulted in pC7LBDASTA2, pC7LBDBSTA2 and pC7LBDCSTA2.
- Cassettes of C7LBDASTA2, C7LBDBSTA2 and C7LBDCSTA2 were then removed from the pCR-Script vector by EcoRI-
- pcDNAE2CVP1 6 was first constructed by replacing the Sfil fragment containing C7 in pcDNAC7VP1 6 with the E2C(hs1 ) fragment isolated from pMal/E2C(hs1 ) after Sfil digestion.
- pcDNAE2CVP1 6 was digested with Spel and a 1 kb fragment was isolated. This Spel fragment was ligated to the large Spel fragment of pcDNAC7LBDASTA2, which created pcDNA-E2CLBDASTA2. Similar steps were performed to construct pcDNAE2CLBDBSTA2.
- fusion proteins were produced by in vitro transcription and translation using the TNT Coupled Reticulocyte Lysate System (Promega,
- each expression reaction was set up in a total volume of 50 ⁇ which contained 25 ⁇ of TNT rabbit reticulocyte lysate, 2 ⁇ of TNT Reaction Buffer, 2 ⁇ of RNasin ribonuclease inhibitor (20 U/ ⁇ l), 1 ⁇ l each of amino acid mixture minus leucine, amino acid mixture minus methionine and TNT T7 RNA polymerase, 2 ⁇ of expression plasmid (1 ⁇ g/ ⁇ l) and water. The reaction mixture was incubated at 30° C for 90 minutes.
- Binding of the expressed protein to duplex oligonucleotides was performed as follows, using the gel shift assay systems (Promega, Cat # E3050): 5 ⁇ l of in vitro translation product was co-incubated with 4 ⁇ l of
- This palindromic configuration mimics the composition of the native estrogen receptor response element (ERE), except that the natural 6 bp half site of ERE is replaced by the 9 bp half site specified by C7.
- ERE estrogen receptor response element
- C7VP16 can bind once or twice to the oligonucleotide, creating two specific gel shift bands.
- 2C7VP16 binds only once to the oligonucleotide containing two inverted C7 sites.
- C7LBDA and C7LBDB bind strongly to yield one major species, which runs higher than any of the control bands.
- the relative size of the complexes suggest the protein bound for C7LBD is larger than for C7VP or 2C7VP. The size of the band and presence of only one major species indicate that the fusion protien ZFP-LBD is binding to the oligonucleotide as a dimer.
- Oligo I gat cca aag teg cgt ggg cgc age gcc cac gcg ate aaa ga (SEQ ID NO: 48)
- Oligo2 gat cca aag tec agg cga gcg cgt ggg egg cag ate aaa ga (SEQ ID NO: 49)
- Fusion proteins C7LBDA and C7LBDB bound to the probe containing a palindrome (two inverted half sites) as a single form and in equal amount to the C7VP control, while C7LBDC showed no detectable bind- ing. In contrast, the fusion proteins C7LBDA and C7LBDB did not bind to the oligonucleotide containing only one C7 site, while C7VP bound only once, as expected. C7LBDA and C7LBDB bound equally to the oligo 1 and oligo 3, which contain two sites as inverted repeats with 3 intervening spaces or direct repeats with 9 intervening spaces, respectively.
- a second ZFP-LBD fusion protein was constructed using the C2H2 zinc finger domain E2C(HS1 ), which binds to a recognition sequence 5'-GGG GCC GGA g 3' that differs in six out of nine base pairs from the C7 binding site. (Note that the lower case g denotes a 10 th base that makes a minor contribution to the protein:DNA contact affinity.)
- Maps of specific examples constructed in the expression vector pcDNA3.1 are shown in FIG. 1 1 (E2CLBDAS) (SEQ ID NO: 1 1 ) and FIG. 12 (E2CLBDBS) (SEQ ID NO: 1 2).
- Oligonucleotides were prepared containing an inverted repeat of two C7 sites, two E2C sites, or a mixed heterodimeric site of one C7 and one E2C half site. Two fusion proteins having different DNA binding domains (C7 or E2C) were tested for their DNA binding specificity against three oligonucleotides containing palindromic binding sites specific for C7, E2C or the combination of the two.
- C7 oligo gat cca aag teg cgt ggg cgc age gcc cac gcg ate aaa ga (SEQ ID NO: 51 )
- C7/E2C oligo gat cca aag teg cgt ggg cgc act ccg gcc ccg ate aaa ga (SEQ ID NO: 52)
- E2C oligo gat cca aag teg ggg ccg gag act ccg gcc ccg ate aaa ga (SEQ ID NO: 53)
- Gel shift assays were performed according to the standard protocol described above.
- a standard co-transfection reporter assay was performed.
- a reporter construct henceforth known as 6x2C7pGL3Luc, containing six copies of a directly repeated C7 binding site (6x2C7) inserted upstream of an SV40 promoter fragment and reporter gene encoding firefly luciferase (pGL3Pro; Promega) was transfected along with the designated fusion protein and assayed as described below.
- HeLa, Cos, Hep3B or other were seeded at 5 x 10 4 cells/well in a 24 well plate prior to the day of transfection in DMEM Phenol-free media, supplemented with L-glutamine and 5% (v/v) charcoal- dextran stripped Fetal Bovine serum (sFBS). Cells were transfected using the Qiagen Superfect Transfection method.
- luciferase reporter plasmid (6X2C7pGL3proluc), 0.1 ⁇ g of chimeric activator DNA (e.g., C7LBDA, C7LBDB, or C7LBDC) unless otherwise indicated, and 0.4 ⁇ g of an inert carrier plasmid DNA
- DMEM phenol-free 5% sFBS media were washed once with Dulbecco's phosphate buffered saline (DPBS) and the transfection mixture placed on the cells. Cells were washed once with DPBS following a 2.5 hour incubation at 37 degrees Celsius, and re-fed with DMEM Phenol-free 5% sFBS media.
- DPBS Dulbecco's phosphate buffered saline
- cells were treated with an inducing agent, 1 7 5-Estradiol or 4 OH-Tamoxifen as indicated, each at 100nM final concentration in DMEM Phenol-free 5% sFBS.
- Cells were harvested 24 hours later by washing once with DPBS and adding 200 ⁇ L 1 X reporter lysis buffer (Promega). Plates were frozen at -80 ° C and thawed at room temperature for 1.5 hours on an orbital shaker at
- All three ZFP-LBD fusion proteins had an estrogen dependent effect on the luciferase reporter gene.
- the characteristic pattern is that A has greater total activity than B and B has greater total activity than C.
- the basal or ligand-independent effect of these proteins on the reporter gene follows a similar pattern; A > B> C.
- the estrogen dependent effect on gene expression ranged from two-fold to nine-fold in these experiments.
- the regulation of luciferase reporter gene by the C7LBD long and short form fusion proteins was compared in Cos cells.
- the results indicate that the long form fusion proteins, which contain the estrogen receptor F region, have a higher basal and ligand-independent effect on the reporter gene than the short form.
- the long fusion proteins give lower fold induction. This result may be due to an enhanced, but ligand-independent, transactivation activity in the F region that works synergistically with the heterologous VP minimal domain trimer. Alternatively, this result could be due to the difference in spacing, as a result of the intervening F region, between the VP activation domain and the estrogen receptor ligand binding domain of the recombinant proteins.
- the VP minimal domain trimer was replaced with either the carboxy terminal activation domain from human STAT-6 (amino acids 660 — 847) or the full length VP16 activation domain of approximately 77 amino acids (residues 413 - 490) (FIG. 13).
- the transactivation domain was added either native, or in conjunction with an SV40 nuclear localization peptide sequence at the amino terminus of the VP16.
- C7LBD fusion proteins A or B containing different transactivation domains were constructed and evaluated for their effects on gene activation and ligand induction.
- the construct shown schematically and abbreviated above, includes the following: 1 .
- C7BS-STAT C7LBDB short form with the STAT6 carboxy activation domain.
- C7BS VP16 C7LBDB short form with full length VP1 6 activation domain.
- C7AS nlsVP16 C7LBDA short with full length VP16 preceded by a nls.
- C7ASnlsVP1 6 greatly increased the folding induction compared to TA2 or VP1 6 without the NLS, but the total activity was significantly decreased.
- the full length VP16 domain was used, it gave about 2 fold higher total activity, but high basal activity resulting in weaker ligand dependent induction (3-fold).
- C7-PBD-VP16 was compared to the original, Gal4-based construct GL914VPc', which reportedly had a very low basal activity.
- GL914VPc' protein was tested on a
- 6xGal4-SV40 promoter-luciferase reporter it displayed even higher basal activity than C7-PBD-VP16. Variation of effector/reporter ratios had no effect on the basal activities in both systems. It was discovered, however, that the ratios for optimal induction were different for GL914VPc' and C7-PBD-VP16, namely 1 /30 and 1 /10, respectively.
- FCS fetal calf serum
- the reporter p1 7x4TATA-luc used in the original studies on Gal4, contains four Gal4 dimer binding sites upstream of a TATA box.
- GL914VPc' had a very low basal activity on this reporter, and was inducible by RU486.
- An equivalent reporter, pGL3TATA/10xC7 was therefore constructed to test C7-PBD-VP1 6. While the basal activity using a reporter construct having TATA reporter was still higher than in the Gal4 system, basal activity was clearly lower than using the SV40 promoter-containing pGL3prom/10xC7.
- Two additional reporters with minimal CMV promoters, pGL3minCMV/6xGal4 and pGL3minCMV/10xC7 were also constructed. The basal activity of the corresponding switch proteins was as high on these reporters as on the SV40 promoter containing reporters.
- GL914VPc' and C7-PBD-VP16 were constitutively located in the nucleus and able to bind to their target sites, either as monomers or as dimers.
- the fusion proteins are only able to activate transcription in the context of more than a TATA box, i.e. a SV40 promoter or a minimal CMV promoter. If there is only a TATA box, ligand binding presumably associated with a conformational change is required for efficient activation of transcription.
- C7-PBD-VP1 6 had an even lower basal activity on the TATA reporter in NIH/3T3 cells than it had in HeLa cells. Since C7-PBD-VP16 appears to be constitutively translocated to the nucleus, the SV40 nuclear localization signal (NLS) between PBD and VP1 6 domains was removed in the hope of making nuclear translocation more ligand dependent. The resulting construct, C7-PBD-VP1 6noNLS, was then tested on the pGL3prom/1 0xC7 reporter. However, transcriptional activation was no more RU486-dependent than in the case of C7-PBD-VP1 6 as shown by an unchanged basal activity. The construct
- C7-PBD ⁇ NLS-VP1 6noNLS was made in which the small remaining part of a natural SV40-like NLS at the N-terminus of the PBD (aa 640-644) is also removed.
- Naturally occurring steroid hormone receptors typically bind to an inverted repeat, or palindromic SRE. However, it has been shown in several cases that there is some flexibility in binding. Direct repeats and everted repeats can also serve as response elements.
- To determine the optimal spacing and orientation of the two half-sites for binding of a steroid receptor-based switch construct a total of eighteen C7 dimer TATA-lucif erase reporter constructs were prepared. Six C7 dimers each in direct, inverted and everted repeat orientation, with spacers of 0 to 5 intervening bases.
- C7-PBD was fused to a number of repressor domains (Table 10, below) . When tested in luciferase reporter assays, many repressor constructs had no significant activity.
- the C7-PBD-VP16 switch protein was able to regulate 10xC7 reporter constructs, which contain 10 direct repeats of C7 sites with a spacing of 5bp (see above), indicating that a switch dimer can bind to direct repeats with this specific spacing.
- the promoter region was screened for the presence of (GNN) 3 N 5 (GNN) 3 motifs.
- dimer target sites E2E, E2F, E2G, and E2H were identified. E2E overlaps with the 18bp E2C target sequence and could serve as a binding site for a homodimer.
- the other three sites have the potential to serve as heterodimer binding sites.
- the seven required three finger proteins were generated by F2 stitchery and analyzed for binding by ELISA (Table 1 1 , below).
- ero3-2-specific switch constructs were then generated by fusion of each three finger protein to PBD-VP64, and tested for their ability to regulate erbB-2 promoter activity. The values are mean and standard deviation of duplicate measurements. Only the heterodimeric E2F-PBD- VP64 switch led to a detectable regulation of the erbB-2 promoter. This regulation was not RU486-dependent, consistent with the high basal activities of C7-PBD-VP1 6 and C7-PBD--VP64 proteins.
- Recombinant ligand-responsive polypeptides were constructed using an estrogen receptor (ER) ligand binding domain (EBD).
- ER estrogen receptor
- EBD ligand binding domain
- a Myc-ER fusion construct was obtained from Eliane Muller and used as a source of the EBD coding region. Rather than containing the human wild type amino acid sequence, Myc-ER contains a point mutation (aa 282-599, G525R) mouse EBD which has been shown to no longer bind estrogen, but bind the estrogen antagonist 4-OH tamoxifen, and paradoxically becomes activated by it. This has advantages for in vivo applications and for tissue culture experiments, not only because serum contains estrogen but also because phenol red present in all tissue culture media acts as an estrogen agonist.
- the VP16-C7-ER, VP16-NLS-C7-ER, and VP16-C7-NLS-ER fusion constructs were prepared as described above.
- an analogous set of progesterone receptor (PR) variants was also prepared (VP16-C7- PR, VP16-NLS-C7-PR, and VP16-C7-NLS-PR.
- PR progesterone receptor
- the PBD in these constructs encompasses aa 640-91 4 and therefore lacks the partial natural NLS (aa 640-644) .
- the VP16 domain in VP1 6-C7-PR and VP16-C7-ER has been replaced by the following effector domains: the activator VP64, and the repressors KK (KRAB-A box dimer), MM (dimer of the Mad sin3 interaction domain) and SKD.
- the VP64 variants are useful, for example, in studies to determine the optimal spacing and orientation of the two half-sites, using the above-mentioned C7 dimer-TATA luciferase reporters
- heterodimer SEQ ID NO: 55
- PBD-VP64 protein did not activate a TATA reporter containing only a single C7 site.
- heterodimer constructs were prepared in which only one of the dimerization partners contains a DNA binding domain, while the other contains an effector domain.
- the formats were as follows: (1 ) E2C-PR // PR-VP64 (2) E2C-ER // ER-VP64
- PCR amplified from pVgRXR (Invitrogen) using the primers listed below and AmpliTaq DNA Polymerase (Hoffmann-LaRoche). Forward and backward primers were chosen to allow construction of the constructs.
- the cycling conditions were 2794° C C; 25 x (30"/94° C - 30"/60° C - 2772° C); 10772° C.
- the PCR product was purified with the Quiagen
- RXR-(Pacl) (SEQ ID NO: 59) GAGGAGGAGTTAATTAAAGTCATTTGGTGCGGCGCCTCCAGC
- HeLa cells were plated in 24-well dishes and used at a confluency of 40-60%. Typically, 175 ng reporter plasmid
- EcR was obtained from F. Gage. Bombyx mori EcR is PCR amplified from this plasmid using the primers listed below and AmpliTaq DNA Polymerase (Hoffmann-LaRoche). Forward and backward primers were chosen to allow construction of the constructs corresponding to FIG. 14 but replacing Drosohila EcR by Bombyx mori EcR.
- This heterodimeric onstruct showed 5.3 fold tamoxifen-dependent activation at ratios of 6.7/60 and 2.2/60 of the erbB-2 promoter.
- This heterodimeric construct showed 2.9 fold tamoxifen-dependent repression of the erbB-2 promoter at a ratio of 1 /10.
- This six finger heterodimeric construct showed 4.5 - 7.8 fold tamoxifen-dependent activation of the 53 promoter.
- Adenovirus vectors can be produced at very high titers, which makes them useful for gene therapy applications.
- E2C-KRAB repressor protein To demonstrate the use of the E2C-KRAB repressor protein in animal models, E2C-KRAB (and, as a control, 2C7-KRAB) encoding adenoviruses were generated. The method for adenovirus production is described in detail, for example, in He et al. (1998) Proc. Natl. Acad. Sci. U.S.A. 55:2509-2514.
- the zinc finger coding regions were excised from the pMX/E2C-KRAB and pMX/2C7-KRAB bicistronic retrovirus plasmids by BamH1 -Not1 digest. The resulting fragments were then subcloned into the Bgl2-Not1 sites of pAdTrack-CMV. After linearization with Pme1 , pAdTrack plasmids were co-electroporated with circular pAdEasy-1 into
- BJ51 83 cells This bacterial strain is not recA and therefore allows homologous recombination between the 2 plasmids. Electroporated cells were then plated onto Kan plates. Only plasmids that have recombined together provide Kanamycin resistance, because this marker is only present on pAdTrack. After screening to distinguish recombinants from background (due to incomplete linearization of pAdTrack plasmids), the linear adenovirus vector genomes were released from the recombinant pAdEasy/E2C-KRAB and pAdEasy/2C7-KRAB plasmids by Pac1 digest. The linearized vectors were then transfected into 293 cells. This cell line makes the Adeno E1A and E1 B proteins, which have been deleted from the vector and are required for replication.
- Single amino acid mutations in the estrogen receptor ligand binding domain can have a significant effect on the basal and ligand dependent level of gene activation.
- a glycine to valine substitution at estrogen receptor residue 400 has been described as a destabilizing or temperature sensitive mutation (White (1997) Adv. Pharmacol. 40:339-
- GGCACATGAGTAACAAACGCATGGAGCATCTGTAC (SEQ ID NO: 67) for the coding strand, where the nucleotide in bold represents the change from the wild type sequence.
- sequences of the oligonucleotides used for G400V mutagenesis were CCATGGAGCACCCAGTGAAGCTACTGTTTGC (SEQ ID NO: 68) for the coding strand, and t GCAAACAGTAGCTTCACTGGGTGCTCCATGG (SEQ ID NO: 69) for the noncoding strand, where the nucleotide in bold represents the change in sequence from wild type.
- Templates were added at 10 ng to 50 ng per reaction with 125 ng of each primer in 10mM KCI, 10mM (NH 4 ) 2 SO 4 , 20mM Tris-HCI (pH 8.8), 2mM MgSO 4 , 0.1 % Triton X-100, 0.1 mg/ml BSA, dNTP mix, and 2.5U Pfu TurboTM DNA polymerase.
- the reactions were carried out on a Perkin
- PCR samples were treated with 10U Dpn ⁇ for 1 hr at 37 degrees Celsius to digest the non-mutagenized parent template.
- DH5or supercompetent Epicurean Coli ® XL-1 cells were transformed by combining 1 ⁇ L of the Dpn ⁇ treated PCR samples with 50 ⁇ L of the cells in chilled Falcon 2059 tubes, incubated on ice for 30 minutes, heat shocked at 42 degrees Celsius for 45 seconds and chilled on ice for 2 minutes. A 500 ⁇ L aliquot of SOC media pre-warmed to 42 degrees Celsius was added to the transformation reaction and incubated for 1 hour at 37 degrees Celsius with shaking. The transformed cells were plated onto LB plates containing 100 ⁇ g/ml ampicillin and incubated for at least 1 6 hours.
- Mutation efficiency was determined by altering a nonsense codon in a 5-galactosidase expression plasmid to glutamine and determining expression of 5-galactosidase, as evidenced by IPTG/X-Gal plates. Approximately three clones for each mutation were selected for restriction enzyme digestion to check for template integrity, followed by dideoxynucleotide sequencing of the entire coding frame to confirm the desired mutation.
- C7LBD (short) chimeric regulators A, B, and C with and without the G400V mutation in the estrogen receptor LBD were compared for their ability to induce expression of the 6x2C7pGL3Luc.
- the total activity of the three fusion proteins has the relationship A> B> C; this relationship was maintained with and without the G400V mutation.
- the pattern of basal expression was dramatically altered by the G400V mutation.
- the basal or ligand independent effect of the three C7LBD regulators with the G400V mutation is reduced to nearly the level of the reporter plasmid alone.
- the fold ligand dependent induction dramatically increases, for example from 10 fold to 420 fold for C7LBDA.
- the results of the study showed the ligand-dependent regulation of a luciferase reporter gene construct in HeLa cells using three recombinant molecular constructs, C7LBDAS, C7LBDBS, C7LBDCS with and without a G400V mutation in response to estrogen (E2) and 4 hydroxytamoxifen (OHT).
- E2 estrogen
- OHT hydroxytamoxifen
- the results showed that fusion proteins C7LBD B and C are induced equally well by 100 nM tamoxifen or estrogen.
- tamoxifen appears to be approximately two-fold more active than estrogen itself.
- Another mutation of interest in estrogen receptor LBD is a glycine to arginine substitution at amino acid 521 of human estrogen receptor. This mutation has also been described in the mouse estrogen receptor homolog at the equivalent site of residue 525. This mutation ablates responsiveness of the mutated LBD to estrogen, but still allows the binding of the anti-estrogen tamoxifen (Littlewood et al. (1 995) Nucl. Acids Res. 23: 1 686-1690; Danielian et al. (1 993) Mol. Endocrinol. 7:234-240). The effect of the G521 R mutation on the activity of the
- C7LBD regulators was tested.
- C7LBDB was compared to C7LBDB (G400V) and C7LBDB (G521 R).
- estrogen E2
- DES diethyl-stilbesterol
- Ral 4- OH-tamoxifen and raloxifen
- SERMS selective estrogen receptor modulators
- E2 estrogen
- DES diethylstilbesterol
- 4- hydroxytamoxifen 4- hydroxytamoxifen
- Ralox raloxifen
- the composition of the minimal promoter used in reporter assays can dramatically effect the level of gene expression.
- the activity of natural steroid receptors varies on different gene targets depending on the composition of their promoters.
- Reporter constructs containing 6x2C7 binding sites upstream of a minimal TATA box promoter fragment derived from the c-fos gene, referred to here as TATA were constructed to show the effect on the level of regulation.
- C7LBD A and B fusions without or with the G400V or G521 R mutations were compared. As observed previously on the pGL3 SV40 promoter, the G400V and G521 R mutations significantly decrease the basal activity of the chimeras compared to those without these mutations.
- the G521 R mutant is selectively activated by tamoxifen.
- estrogen is only a weak inducer, while 4-OH-tamoxifen is significantly better. This effect is even more pronounced on C7LBD A compared to B; on chimera C7LBDA (G400V), tamoxifen is at least 10 fold more active than estrogen.
- An experiment was done to directly compare the relative activity of the C7LBD chimeras on reporter constructs containing the stronger pGL3 SV40 promoter or the weaker c-fos TATA box promoter.
- Reporter constructs with 3 copies of direct repeats of the C7 binding site (GCG TGG GCG) or E2C binding site (GGG GCC GGA g) inserted upstream of the promoter region in pGL3Luc were used to evaluate target specificity two different ZFP-LBDBs fusion protein regulators.
- ZFP-LBDB short fusions were constructed containing either the C7 DNA binding domain or the E2C DNA binding domain and tested on the two different reporter constructs.
- the study was designed to show the effect of three direct repeats of either C7 or E2C binding sites inserted upstream of the promoter of a luciferase reporter gene construct in HeLa cells on estrogen-dependent gene expression using recombinant molecular constructs C7LBDBS and E2CLBDBS.
- Estrogen-dependent induction only occurs when the chimera's DNA binding domain (DBD) matches the binding sites in the reporter.
- DBD DNA binding domain
- the E2CLBD chimera shows no increase of luciferase activity on the 3x2C7 Luc reporter and visa versa for C7LBD on the 3xE2C reporter.
- C7LBDBS was transfected into HeLa cells and assayed for basal and tamoxifen induced activity on a series of reporter constructs diagramed above.
- Reporter constructs were constructed by cloning double stranded oligonucleotides containing the various binding sites into the multiple cloning site of the pGL3Luc reporter. "Response elements" composed of direct, inverted (palindromic), and everted repeats of two C7 binding sites were compared; each response element was separated by two (2) bp except in the control 6 X 2C7, where spacing was 5 bp.
- FIG. 1 5 provides a schematic and description of the cloning step required to assemble 2C7LBDsho ⁇ t A, B, and C.
- the 2C7LBD band position suggests it is binding as a monomer. Furthermore, the weak level of binding compared to the 2C7VP16 control suggests the DNA binding affinity of the 2C7 domain is significantly reduced in the context of the LBD fusion protein. Results of in vitro expressed proteins by SDS-PAGE, indicated equal amounts of proteins expressed and the expected relative increase in size for the LBD A, B, and C forms.
- the ability of the 2C7LBD A, B, and C fusion protein chimeric regulators to activate expression of the 6X2C7Luc reporter gene were evaluated essentially as described previously for the C7LBD studies.
- the results of the study show the ligand-dependent regulation of a 2C7 SV40 luciferase reporter gene construct in Cos cells using three recombinant molecular constructs, 2C7LBDAS (SEQ ID NO: 1 ), 2C7LBDBS (SEQ ID NO: 2), 2C7LBDCS (SEQ ID NO: 3), and a positive control, 2C7-Vp1 6.
- Luciferase assay HeLa cells were cotransfected with plasmids encoding the indicated fusion proteins and the N1 reporter construct. At 24h later, the cells were treated with 10nM RU486 (FIG. 23B) or 100nM Tamoxifen (FIG. 23C), respectively. At 48h post transfection, cell extracts were assayed for luciferase activity.
- the promoter contains 5 direct repeats of B3 sites spaced by 3bp; the spacing between the 5 repeats is 6bp (FIG. 24A).
- the cells were treated with 10nM RU486 (FIG. 24B), or 100nM Tamoxifen (FIG. 24C), respectively.
- cell extracts were assayed for luciferase activity.
- FIG. 25 shows the results of a luciferase assay showing RU486- induced formation of functional VP64-C7-PR/VP64-CF2-PR heterodimers.
- HeLa cells were cotransfected with the corresponding effector plasmids and TATA reporter plasmids (C7/CF2-drO, C7 site 5' to a CF2 site, direct "repeat", no spacing; C7/C7-dr0, 2 C7 sites, direct repeat, no spacing).
- the cells were treated with 10nM RU486.
- cell extracts were assayed for luciferase activity.
- adenoviral vectors were constructed. These vectors contained either the ZFP-LBD fusion protein regulator linked to the immediate early CMV promoter or the regulatable transgene, linked to the 6 x 2C7 array of C7 binding sites and the minimal promoter from SV40 or c-fos TATA as described previously.
- the fusion protein regulator vector and regulatable transgene vector are then be mixed at various ratios and delivered to cells or animals by standard methods.
- adenovirus vector Construction of an adenovirus vector is routine and generally, the procedure involves three main steps: first a shuttle plasmid containing the viral left ITR, viral packaging signal, a promoter element, a transgene of interest linked to the promoter element and followed by a poly adenylation sequence, and some additional DNA sequences, viral or non- viral, required for recombination is prepared. Second, this left end shuttle plasmid, along with the remainder of the viral genome (i.e. the right end of the vector) are transfected into a host cell and joined through DNA recombination to form a complete vector genome.
- This recombination step may result from sequence homology between the two vector halves or may be aided by the use of site specific recombinases such as Cre and their corresponding LoxP recombination sequences.
- site specific recombinases such as Cre and their corresponding LoxP recombination sequences.
- the newly formed virus is amplified up and purified in a series of steps. The details of the construction of these vectors are briefly described below.
- ZFP-LBD DNA fragments were modified with Klenow to fill in the restriction site overhangs and blunt end ligated into the EcoRV at bp
- Two regulatable transgene cassettes were prepared.
- One contained the 6x2C7 binding sites and SV40 minimal promoter fragment linked to the Luciferase transgene as in pGL3 6x2C7-Luc (described in example 5).
- the second vector contained the 6x2C7 binding sites and c- fos TATA minimal promoter linked to a cDNA encoding murine endostatin fused to an amino terminal secretion signal.
- the complete sequence of this fusion protein is listed in SEQ ID NOs. 70 and 71 .
- These vectors were constructed in two steps. First, a fragment containing the CMV promoter and tri-partite leader sequence (TPL) of pAvCvlx (Fig.
- DNA fragments containing the Luciferase or murine endostatin transgenes were ligated into the EcoRV site of the appropriate shuttle plasmids to create pAv6x2C7SV40-Luc (lox) or pAv6x2C7TATA-mEndo (lox) .
- a plasmid containing the remainder of the viral vector genome is required.
- This plasmid referred to as pSQ3, which is shown in Fig. 27, contains a pBR322-derived backbone, ampicillin resistance gene and the adenovirus serotype 5 genome, beginning at Ad5 bp 3329, through the right ITR, with deletions in the
- this plasmid has two important features, a loxP site inserted at the Bam HI site (bp 31 569) just upstream of the Ad5 sequences, and a Cla I site at the end of the viral 5' ITR. This Cla I site is used to linearize the plasmid and expose the right ITR during vector construction.
- Av3SV-LUC and Av3TATA-Endo were constructed. Each vector was generated by a standard procedure. Briefly, for each vector construct, three plasmids, pSQ3 (pre digested with Clal), the appropriate left end shuttle plasmid (e.g. pAvCv-C7LBD As(G521 R), or pAv6X2C7SV40-Luc (lox), pre-digested with Notl and Afl II, and an expression plasmid for the
- Cre recombinase, pCMV-CRE were cotransfected at a weight ratio of 3:1 : 1 into dexamethasone induced AE1 -2a cells (Gorziglia et al.) using Promega's Profection Kit. About 1 week after transfection, cells were harvested and lysed by 4 cycles of freeze/thaw. The resulting cell lysate was passed onto fresh dexamethasone induced AE1 -2a cells and the culture maintained about a week until cytopathic effect (CPE) was observed. This process was repeated several cycles until sufficient material was obtained to purify the vector by CsCI equilibrium density centrifugation.
- CPE cytopathic effect
- vectors are quantitated by lysing in buffer containing 10mM Tris, I mM EDTA, 0.1 % SDS for 1 5 minutes at 56°C, cooling and reading the absorbance at 260 nm wavelength (OD260). The OD260 reading is converted to a virus particle concentration using 1
- OD260 unit 1 .1 x 10 12 particles/ml.
- the cells were treated where appropriate with 100 nM 4-OH-tamoxifen. Following an additional 24 hrs incubation, the cells were lysed and assayed for luciferase activity.
- the data indicate relatively low levels of luc expression in the absence of 4-OHT, a strong 4-OHT dependent induction and a dose dependent increase in luc activity as more fusion protein regulator vector is used.
- tamoxifen-specific induction of 460 to 560 fold over basal was achieved at target vector doses of 250 and 50 particles per cell, respectively.
- mice were given a total adenovirus vector dose of 2 x 10 11 particles via tail vein injection.
- animals were injected i.p. with 200 ul of sunflower seed oil containing 5% DMSO and either no, 50 ug, or 500 ug of tamoxifen (Sigma # T56448).
- Blood samples were collected daily for three days following drug administration, and on study days 8 and 10.
- murine endostatin levels were determined by ELISA (Accucyte Kit, Cytimmune Sciences, Maryland).
- the study groups included the following: Negative Control - 2 x 10 11 particles Av3Null, Ad vector with no transgene
- Groups 3 - 6 each contained no drug, 50 ug, and 500 ug tamoxifen treatment subgroups.
- endostatin expression in the animals treated with 500 ⁇ g tamoxifen was comparable to the animals treated with only 50 ⁇ g, indicating that the lower dose of tamoxifen is sufficient to fully activate the As(G521 R) and Bs(G400V) regulators.
- the comparable low basal level of endostatin observed in the As(G521 R) and Bs(G400V) groups suggests that the endogenous level of estrogen in the C57BI/6 mice is not sufficient to induce the estogen-responsive Bs(G400V) regulator.
- the data show that the basal level of expression from the 6x2C7-minimal promoter constructs tested in an adenovirus vector give relatively low levels of expression, even when the fusion protein is expressed in the same cell.
- the system is highly drug dependent and allows for substantial regulation of the vector-delivered transgene.
- Example 1 9 In order to demonstrate controlled gene expression in an integrated vector system, the regulatory system described in Example 1 9 with the adenoviral vectors were used to develop a series of lentiviral vectors.
- These vectors contained either the ZFP-LBD fusion protein linked to the immediate early CMV promoter or a regulatable transgene (either eGFP or luciferase) linked to the 6 X 2C7 array of C7 binding sites and either the minimal promoter from SV40 or C-fos TATA.
- the fusion protein-encoding vector and the regulatable transgene vector can then be used to generate lentiviral vector supernatant.
- the supernatant can be used to stably transduced human cells either singly or in parallel.
- Stable cell lines containing the integrated vectors can then be induced with the appropriate activating drug (e.g. , 4-OH-tamoxifen) and gene expression is measured as fold induction in the presence and absence of drug.
- Lentiviral Vectors encoding the ZFP-LBD fusion protein or the regulatable transgene.
- the generation of lentiviral vectors and vector supernatant involves
- a gene or region of interest is inserted into shuttle vector backbone plasmid containing all of the viral cis-elements for transcription, packaging, reverse transcription, and integration.
- the lentiviral vector shuttle plasmid is co-transfected into human 293 cells along with plasmids providing the packaging functions (gag, pol, and env).
- the transfections include 10 g of vector plasmid, 10 g of packaging plasmid and 1 ⁇ g envelope plasmid (Vesicular Stomatitis virus G envelope) using a Profection Calcium Phosphate transfection kit.
- the culture supernatant containing the lentiviral vector is harvested (between 24 and 48 hours post transfection) and used to transduce na ⁇ ve human target cells. Construction of HIV-1 based vectors
- HIV-1 -based vector system containing an internal CMV promoter was constructed from an infectious HIV-1 till 1B provirus cDNA (pHIV-IIIB)
- infectious proviral cDNA was generated by PCR from
- HIV vector containing a constitutive transactivator and DBD chimera was generated, pHIVCMV-C7VP1 6.
- a Hindlll-Notl restriction fragment from pCDNA3-C7VP16 containing the C7VP16 coding fragment was inserted downstream of the CMV promoter at the Sma site of pHIVecCMV-X.
- a BamHI-Xbal restriction fragment containing the 6X2C7TATA luciferase fragment was isolated from pTATA6X2C7Luc and cloned downstream of the RRE at the Spel-Xbal restriction sites.
- a Mlul-BstBI restriction fragment containing the 6X2C7Sv luciferase fragment was isolated from pGL3-6X2C7SvLuc and cloned downstream of the RRE at the Spe-Xbal restriction sites.
- Cells were allowed to recover from infection for 24 hours in fresh culture medium after which 4-OH-tamoxifen (100 or 1000 nm) was added to the culture for an additional 24 hours.
- Cells were lysed in a standard luciferase lysis buffer, subjected to freeze thaw and analyzed for luciferase activity using a luciferase assay kit (Promega). The results showed that cells infected with either HIV6X2C7SvLuc or
- HIV6X2C7TATALuc followed by transduction with HIVCMVAS521 R resulted in a 1 3.1 and 1 1 .7 fold stimulation in luciferase activity respectively, when given 4-OH-tamoxifen.
- HIV6X2C7SvLuc or HIV6X2C7TATALuc were carried in culture for 9 passages without exposure to any ZFP-LBD fusion protein. On passage
- HIV6X2C7SvLuc or HIV6X2C7TATALuc vector can be induced for luciferase expression by transduction of a LV containing AS521 R + tamoxifen 31 .4- and 22.5-fold, respectively.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Toxicology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Immunology (AREA)
- Wood Science & Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- General Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Physics & Mathematics (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Dermatology (AREA)
- Plant Pathology (AREA)
- Microbiology (AREA)
- Endocrinology (AREA)
- High Energy & Nuclear Physics (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NZ518218A NZ518218A (en) | 1999-10-25 | 2000-10-23 | Ligand activated transcriptional regulator proteins |
| CA002388535A CA2388535A1 (en) | 1999-10-25 | 2000-10-23 | Ligand activated transcriptional regulator proteins |
| IL14914200A IL149142A0 (en) | 1999-10-25 | 2000-10-23 | Ligand activated transcriptional regulator proteins |
| AU11438/01A AU775988B2 (en) | 1999-10-25 | 2000-10-23 | Ligand activated transcriptional regulator proteins |
| EP00972849A EP1226168A1 (en) | 1999-10-25 | 2000-10-23 | Ligand activated transcriptional regulator proteins |
| JP2001533840A JP2003512827A (ja) | 1999-10-25 | 2000-10-23 | リガンド活性化転写レギュレータータンパク質 |
| IL149142A IL149142A (en) | 1999-10-25 | 2002-04-15 | Ligand activated transcriptional regulator fusion protein, nucleic acid molecule encoding the same and use thereof |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US43304299A | 1999-10-25 | 1999-10-25 | |
| US09/433,042 | 1999-10-25 | ||
| US09/586,625 | 2000-06-02 | ||
| US09/586,625 US7329728B1 (en) | 1999-10-25 | 2000-06-02 | Ligand activated transcriptional regulator proteins |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2001030843A1 true WO2001030843A1 (en) | 2001-05-03 |
| WO2001030843A9 WO2001030843A9 (en) | 2002-09-19 |
Family
ID=27029724
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2000/010430 Ceased WO2001030843A1 (en) | 1999-10-25 | 2000-10-23 | Ligand activated transcriptional regulator proteins |
Country Status (8)
| Country | Link |
|---|---|
| US (3) | US7329728B1 (https=) |
| EP (1) | EP1226168A1 (https=) |
| JP (2) | JP2003512827A (https=) |
| AU (1) | AU775988B2 (https=) |
| CA (1) | CA2388535A1 (https=) |
| IL (2) | IL149142A0 (https=) |
| NZ (1) | NZ518218A (https=) |
| WO (1) | WO2001030843A1 (https=) |
Cited By (37)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002006463A3 (en) * | 2000-07-18 | 2002-07-25 | Novartis Ag | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches |
| WO2002026960A3 (en) * | 2000-09-29 | 2003-04-17 | Sangamo Biosciences Inc | Modulation of gene expression using localization domains |
| US6919204B2 (en) | 2000-09-29 | 2005-07-19 | Sangamo Biosciences, Inc. | Modulation of gene expression using localization domains |
| WO2005040212A3 (en) * | 2003-10-24 | 2005-07-28 | Angeletti P Ist Richerche Bio | Orthogonal gene switches |
| JP2005527227A (ja) * | 2002-05-29 | 2005-09-15 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | 誘導性の真核生物発現システム |
| US7329728B1 (en) | 1999-10-25 | 2008-02-12 | The Scripps Research Institute | Ligand activated transcriptional regulator proteins |
| US7381813B2 (en) | 2001-05-31 | 2008-06-03 | Novartis Ag | Nucleic acids encoding estrogen receptor ligand binding domain variants |
| EP1967590A2 (en) | 2001-03-13 | 2008-09-10 | Novartis AG | Lentiviral packaging constructs |
| US7741110B2 (en) | 2000-07-18 | 2010-06-22 | The Scripps Research Institute | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches |
| WO2012049332A1 (en) * | 2010-10-15 | 2012-04-19 | Fundació Privada Centre De Regulació Genòmica | Peptides and uses |
| WO2013119880A1 (en) | 2012-02-07 | 2013-08-15 | Global Bio Therapeutics Usa, Inc. | Compartmentalized method of nucleic acid delivery and compositions and uses thereof |
| US8673589B2 (en) | 2002-05-29 | 2014-03-18 | Regeneron Pharmaceuticals, Inc. | Inducible eukaryotic expression system |
| WO2017134137A1 (en) * | 2016-02-05 | 2017-08-10 | Polygene Ag | Glucocorticoid-based gene regulation system |
| WO2017181148A2 (en) | 2016-04-15 | 2017-10-19 | Alpine Immune Sciences, Inc. | Icos ligand variant immunomodulatory proteins and uses thereof |
| WO2017181152A2 (en) | 2016-04-15 | 2017-10-19 | Alpine Immune Sciences, Inc. | Cd80 variant immunomodulatory proteins and uses thereof |
| WO2018022946A1 (en) | 2016-07-28 | 2018-02-01 | Alpine Immune Sciences, Inc. | Cd155 variant immunomodulatory proteins and uses thereof |
| WO2018022945A1 (en) | 2016-07-28 | 2018-02-01 | Alpine Immune Sciences, Inc. | Cd112 variant immunomodulatory proteins and uses thereof |
| WO2018075978A1 (en) | 2016-10-20 | 2018-04-26 | Alpine Immune Sciences, Inc. | Secretable variant immunomodulatory proteins and engineered cell therapy |
| WO2018170023A1 (en) | 2017-03-16 | 2018-09-20 | Alpine Immune Sciences, Inc. | Pd-l2 variant immunomodulatory proteins and uses thereof |
| WO2018170021A1 (en) | 2017-03-16 | 2018-09-20 | Alpine Immune Sciences, Inc. | Pd-l1 variant immunomodulatory proteins and uses thereof |
| WO2018170026A2 (en) | 2017-03-16 | 2018-09-20 | Alpine Immune Sciences, Inc. | Cd80 variant immunomodulatory proteins and uses thereof |
| WO2019074983A1 (en) | 2017-10-10 | 2019-04-18 | Alpine Immune Sciences, Inc. | CTLA-4 VARIANT IMMUNOMODULATORY PROTEINS AND USES THEREOF |
| WO2019079520A2 (en) | 2017-10-18 | 2019-04-25 | Alpine Immune Sciences, Inc. | ICOS VARIANT LIGAND IMMUNOMODULATORY IMMUNOMODULATORY PROTEINS, COMPOSITIONS AND METHODS THEREOF |
| WO2019136179A1 (en) | 2018-01-03 | 2019-07-11 | Alpine Immune Sciences, Inc. | Multi-domain immunomodulatory proteins and methods of use thereof |
| WO2019241758A1 (en) | 2018-06-15 | 2019-12-19 | Alpine Immune Sciences, Inc. | Pd-1 variant immunomodulatory proteins and uses thereof |
| WO2020061376A2 (en) | 2018-09-19 | 2020-03-26 | Alpine Immune Sciences, Inc. | Methods and uses of variant cd80 fusion proteins and related constructs |
| WO2020113141A2 (en) | 2018-11-30 | 2020-06-04 | Alpine Immune Sciences, Inc. | Cd86 variant immunomodulatory proteins and uses thereof |
| WO2020112904A1 (en) | 2018-11-26 | 2020-06-04 | Massachusetts Institute Of Technology | Compositions and methods for immune tolerance |
| WO2020214867A1 (en) | 2019-04-17 | 2020-10-22 | Alpine Immune Sciences, Inc. | Methods and uses of variant icos ligand (icosl) fusion proteins |
| WO2020243164A1 (en) * | 2019-05-28 | 2020-12-03 | Octant, Inc. | Transcriptional relay system |
| US11364032B2 (en) | 2013-08-08 | 2022-06-21 | Global Bio Therapeutics, Inc. | Clamp device for minimally invasive procedures and uses thereof |
| US11471488B2 (en) | 2016-07-28 | 2022-10-18 | Alpine Immune Sciences, Inc. | CD155 variant immunomodulatory proteins and uses thereof |
| WO2023017494A1 (en) | 2021-08-13 | 2023-02-16 | Triovance Holding Llc | A skin substitute composition and methods of producing and using the same |
| AU2018375192B2 (en) * | 2017-12-01 | 2023-11-09 | Encoded Therapeutics, Inc. | Engineered DNA binding proteins |
| CN117756945A (zh) * | 2023-11-14 | 2024-03-26 | 维康平生(北京)生物科技有限公司 | 融合蛋白及其用途 |
| US12304943B2 (en) | 2020-05-08 | 2025-05-20 | Alpine Immune Sciences, Inc. | April and BAFF inhibitory immunomodulatory proteins and methods of use thereof |
| US12516350B2 (en) | 2019-05-29 | 2026-01-06 | Encoded Therapeutics, Inc. | Compositions and methods for selective gene regulation |
Families Citing this family (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2001000815A1 (en) * | 1999-05-28 | 2001-01-04 | Sangamo Biosciences, Inc. | Molecular switches |
| ATE355368T1 (de) * | 2000-01-24 | 2006-03-15 | Gendaq Ltd | Nucleinsäure bindende polypeptide gekennzeichnet durch flexible linker verbundene nucleinsäuredomäne |
| WO2002057293A2 (en) | 2001-01-22 | 2002-07-25 | Sangamo Biosciences, Inc. | Modified zinc finger binding proteins |
| EP1627046A4 (en) * | 2003-05-06 | 2008-02-13 | Scripps Research Inst | BINDING MOLECULES WITH DOMAIN EXCHANGE, USE METHOD AND METHOD OF MANUFACTURE |
| US7829528B2 (en) * | 2004-09-14 | 2010-11-09 | The Rockefeller University | Compositions and methods for treating STAT-6 associated diseases or conditions |
| US20110294135A1 (en) * | 2007-08-02 | 2011-12-01 | BioDesic, LLC | Compositions and methods for analyte detection and quantitation |
| US20130137173A1 (en) * | 2011-11-30 | 2013-05-30 | Feng Zhang | Nucleotide-specific recognition sequences for designer tal effectors |
| US10801017B2 (en) | 2011-11-30 | 2020-10-13 | The Broad Institute, Inc. | Nucleotide-specific recognition sequences for designer TAL effectors |
| US8450107B1 (en) | 2011-11-30 | 2013-05-28 | The Broad Institute Inc. | Nucleotide-specific recognition sequences for designer TAL effectors |
| RU2662672C2 (ru) * | 2012-02-02 | 2018-07-26 | ДАУ АГРОСАЙЕНСИЗ ЭлЭлСи | Пестицидные композиции и относящиеся к ним способы |
| WO2014197748A2 (en) * | 2013-06-05 | 2014-12-11 | Duke University | Rna-guided gene editing and gene regulation |
| MX2022002980A (es) | 2019-09-16 | 2022-04-06 | Amgen Inc | Metodo para la esterilizacion externa de un dispositivo de suministro de farmacos. |
| US20230174612A1 (en) * | 2020-04-09 | 2023-06-08 | The Regents Of The University Of California | Notch receptors with zinc finger-containing transcriptional effector |
| CN116802267A (zh) * | 2020-10-23 | 2023-09-22 | 斯宾德尔生物科技公司 | 用于rna合成的组合物和方法 |
| EP4698662A2 (en) * | 2023-04-17 | 2026-02-25 | AskBio Inc. | Regulatable controlled expression of a transgene in primates |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2996496A (en) | 1956-06-22 | 1961-08-15 | Central Pharmacal Company | Calcium substitution products of dextran |
| EP0540065A1 (en) * | 1987-12-02 | 1993-05-05 | The Salk Institute For Biological Studies | Retinoic acid receptor composition |
| WO1998018925A2 (en) | 1996-10-29 | 1998-05-07 | Valentis, Inc. | Modified glucocorticoid receptors, glucocorticoid receptors/progesterone receptors hybrids |
| WO1998054311A1 (en) | 1997-05-27 | 1998-12-03 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| US5874534A (en) | 1992-05-14 | 1999-02-23 | Baylor College Of Medicine | Mutated steroid hormone receptors, methods for their use and molecular switch for gene therapy |
| US9519431B1 (en) | 2010-05-24 | 2016-12-13 | Datacore Software Corporation | Collaboration between discrete systems and a shared system to consolidate shared storage-related services |
Family Cites Families (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US81614A (en) * | 1868-09-01 | Jacob erdle | ||
| US147327A (en) * | 1874-02-10 | Improvement in weft-stop mechanisms for looms | ||
| US182698A (en) * | 1876-09-26 | Improvement in machines for canceling postage-stamps and postmarking letters | ||
| US540065A (en) * | 1895-05-28 | Andrew kriegee | ||
| US4394443A (en) | 1980-12-18 | 1983-07-19 | Yale University | Method for cloning genes |
| US4446235A (en) | 1982-03-22 | 1984-05-01 | Genentech, Inc. | Method for cloning human growth hormone varient genes |
| US5317090A (en) | 1987-12-16 | 1994-05-31 | Institut Pasteur | Steroid/thyroid hormone receptor-related gene, which is inappropriately expressed in human hepatocellular carcinoma, and which is a retinoic acid receptor |
| US5217867A (en) * | 1988-11-30 | 1993-06-08 | The Salk Institute For Biological Studies | Receptors: their identification, characterization, preparation and use |
| WO1990007517A1 (en) | 1988-12-23 | 1990-07-12 | The Salk Institute For Biological Studies | Receptor transcription-repression activity compositions and methods |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| US4990607A (en) | 1989-03-14 | 1991-02-05 | The Rockefeller University | Alteration of gene expression in plants |
| US5140466A (en) * | 1990-12-20 | 1992-08-18 | Hughes Aircraft Company | Optical multiplexer |
| US5364791A (en) | 1992-05-14 | 1994-11-15 | Elisabetta Vegeto | Progesterone receptor having C. terminal hormone binding domain truncations |
| US6416998B1 (en) | 1992-09-02 | 2002-07-09 | Baylor College Of Medicine | Plasmid encoding a modified steroid hormone |
| GB9214857D0 (en) * | 1992-07-13 | 1992-08-26 | Medical Res Council | Human nucleic acid fragments and their use |
| US20050084885A1 (en) | 1994-01-18 | 2005-04-21 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| US6242568B1 (en) | 1994-01-18 | 2001-06-05 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| DE69534629D1 (de) | 1994-01-18 | 2005-12-29 | Scripps Research Inst | Derivate von zinkfingerproteinen und methoden |
| US5789538A (en) | 1995-02-03 | 1998-08-04 | Massachusetts Institute Of Technology | Zinc finger proteins with high affinity new DNA binding specificities |
| US6723531B2 (en) | 1996-04-05 | 2004-04-20 | The Salk Institute For Biological Studies | Method for modulating expression of exogenous genes in mammalian systems, and products related thereto |
| ES2341926T3 (es) | 1998-03-02 | 2010-06-29 | Massachusetts Institute Of Technology | Poliproteinas con dedos de cinc que tienen enlazadores mejorados. |
| US6140081A (en) * | 1998-10-16 | 2000-10-31 | The Scripps Research Institute | Zinc finger binding domains for GNN |
| US6599692B1 (en) | 1999-09-14 | 2003-07-29 | Sangamo Bioscience, Inc. | Functional genomics using zinc finger proteins |
| US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
| US7329728B1 (en) * | 1999-10-25 | 2008-02-12 | The Scripps Research Institute | Ligand activated transcriptional regulator proteins |
| US7151201B2 (en) | 2000-01-21 | 2006-12-19 | The Scripps Research Institute | Methods and compositions to modulate expression in plants |
| AU2964101A (en) | 2000-01-21 | 2001-07-31 | Scripps Research Institute, The | Methods and compositions to modulate expression in plants |
| AU2001295193A1 (en) | 2000-05-01 | 2001-11-12 | Novartis Ag | Vectors for ocular transduction and use thereof for genetic therapy |
| IL153853A0 (en) | 2000-07-10 | 2003-07-31 | Novartis Ag | Bifunctional molecules and vectors complexed therewith for targeted gene delivery |
| US7011972B2 (en) | 2000-07-18 | 2006-03-14 | The Scripps Research Institute | Fusion polypeptide comprising two ligand binding domains |
| IL153833A0 (en) | 2000-07-18 | 2003-07-31 | Novartis Ag | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches |
| NZ527476A (en) | 2001-02-21 | 2006-06-30 | Novartis Ag | Zinc finger binding domains for nucleotide sequence ANN |
| US7067617B2 (en) | 2001-02-21 | 2006-06-27 | The Scripps Research Institute | Zinc finger binding domains for nucleotide sequence ANN |
| EP1397382B1 (en) | 2001-05-31 | 2008-08-06 | Novartis AG | Novel estrogen receptor ligand binding domain variants and novel ligands and pharmaceutical compositions |
| JP2005500061A (ja) | 2001-08-20 | 2005-01-06 | ザ スクリップス リサーチ インスティテュート | Cnnについての亜鉛フィンガー結合ドメイン |
| EP1516055A4 (en) | 2002-01-24 | 2007-08-08 | Scripps Research Inst | FIBER OPERATING MODIFICATIONS FOR EFFICIENT TARGETS |
| US20060078880A1 (en) * | 2002-02-07 | 2006-04-13 | The Scripps Research Institute | Zinc finger libraries |
| US20060211846A1 (en) * | 2002-02-13 | 2006-09-21 | Barbas Carlos F Iii | Zinc finger binding domains for nucleotide sequence ANN |
| JP2006513694A (ja) | 2002-06-11 | 2006-04-27 | ザ スクリップス リサーチ インスティテュート | 人工転写因子 |
| PE20060574A1 (es) * | 2004-07-28 | 2006-06-24 | Glaxo Group Ltd | Derivados de arilpiperazina sulfonamida como agonistas de los receptores de secretagogos de la hormona del crecimiento (ghs) |
| EP2130838A3 (en) * | 2005-08-11 | 2010-04-07 | The Scripps Research Institute | Zinc finger binding domains for CNN |
| EP1963499A4 (en) * | 2005-11-28 | 2009-04-08 | Scripps Research Inst | ZINCFINGER BINDING DOMAIN FOR TNN |
| US20070154989A1 (en) * | 2006-01-03 | 2007-07-05 | The Scripps Research Institute | Zinc finger domains specifically binding agc |
-
2000
- 2000-06-02 US US09/586,625 patent/US7329728B1/en not_active Expired - Fee Related
- 2000-10-23 CA CA002388535A patent/CA2388535A1/en not_active Abandoned
- 2000-10-23 JP JP2001533840A patent/JP2003512827A/ja not_active Withdrawn
- 2000-10-23 NZ NZ518218A patent/NZ518218A/en unknown
- 2000-10-23 AU AU11438/01A patent/AU775988B2/en not_active Ceased
- 2000-10-23 IL IL14914200A patent/IL149142A0/xx unknown
- 2000-10-23 WO PCT/EP2000/010430 patent/WO2001030843A1/en not_active Ceased
- 2000-10-23 EP EP00972849A patent/EP1226168A1/en not_active Ceased
-
2002
- 2002-04-15 IL IL149142A patent/IL149142A/en not_active IP Right Cessation
-
2003
- 2003-04-23 US US10/422,934 patent/US7442784B2/en not_active Expired - Fee Related
-
2008
- 2008-07-22 US US12/220,328 patent/US20080318839A1/en not_active Abandoned
-
2009
- 2009-06-22 JP JP2009147520A patent/JP2009273463A/ja active Pending
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2996496A (en) | 1956-06-22 | 1961-08-15 | Central Pharmacal Company | Calcium substitution products of dextran |
| EP0540065A1 (en) * | 1987-12-02 | 1993-05-05 | The Salk Institute For Biological Studies | Retinoic acid receptor composition |
| US5874534A (en) | 1992-05-14 | 1999-02-23 | Baylor College Of Medicine | Mutated steroid hormone receptors, methods for their use and molecular switch for gene therapy |
| WO1998018925A2 (en) | 1996-10-29 | 1998-05-07 | Valentis, Inc. | Modified glucocorticoid receptors, glucocorticoid receptors/progesterone receptors hybrids |
| WO1998054311A1 (en) | 1997-05-27 | 1998-12-03 | The Scripps Research Institute | Zinc finger protein derivatives and methods therefor |
| US9519431B1 (en) | 2010-05-24 | 2016-12-13 | Datacore Software Corporation | Collaboration between discrete systems and a shared system to consolidate shared storage-related services |
Non-Patent Citations (8)
| Title |
|---|
| BARON ET AL., NUCLEIC ACIDS RESEARCH, vol. 25, 1997, pages 2723 - 2729 |
| BURCIN M M ET AL: "A REGULATORY SYSTEM FOR TARGET GENE EXPRESSION", FRONTIERS IN BIOSCIENCE, vol. 3, 1 March 1998 (1998-03-01), pages 1 - 7, XP000874619 * |
| ELROD-ERICKSON ET AL., STRUCTURE, vol. 4, 1996, pages 1171 - 1180 |
| LIU ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 5525 - 5530 |
| PAVLETICH ET AL., SCIENCE, vol. 252, 1991, pages 809 - 817 |
| SWIRNOFF ET AL., MOL. CELL. BIOL., vol. 15, 1995, pages 2275 - 2287 |
| TORA ET AL., EMBO J., vol. 8, pages 1981 - 1986 |
| WU ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 92, 1995, pages 344 - 348 |
Cited By (79)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7442784B2 (en) | 1999-10-25 | 2008-10-28 | The Scripps Research Institute | Ligand activated transcriptional regulator proteins |
| US7329728B1 (en) | 1999-10-25 | 2008-02-12 | The Scripps Research Institute | Ligand activated transcriptional regulator proteins |
| WO2002006463A3 (en) * | 2000-07-18 | 2002-07-25 | Novartis Ag | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches |
| US7741110B2 (en) | 2000-07-18 | 2010-06-22 | The Scripps Research Institute | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches |
| WO2002026960A3 (en) * | 2000-09-29 | 2003-04-17 | Sangamo Biosciences Inc | Modulation of gene expression using localization domains |
| US6919204B2 (en) | 2000-09-29 | 2005-07-19 | Sangamo Biosciences, Inc. | Modulation of gene expression using localization domains |
| EP1967590A2 (en) | 2001-03-13 | 2008-09-10 | Novartis AG | Lentiviral packaging constructs |
| EP2060582A1 (en) | 2001-05-31 | 2009-05-20 | Novartis Ag | Novel estrogen receptor ligand binding domain variants and novel ligands and pharmaceutical compositions |
| US7381813B2 (en) | 2001-05-31 | 2008-06-03 | Novartis Ag | Nucleic acids encoding estrogen receptor ligand binding domain variants |
| JP4817657B2 (ja) * | 2002-05-29 | 2011-11-16 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | 誘導性の真核生物発現システム |
| US7455988B2 (en) | 2002-05-29 | 2008-11-25 | Regeneron Pharmaceuticals, Inc. | Inducible eukaryotic expression system |
| US7514545B2 (en) | 2002-05-29 | 2009-04-07 | Regeneron Pharmaceuticals, Inc. | Inducible eukaryotic expression system |
| US9944934B2 (en) | 2002-05-29 | 2018-04-17 | Regeneron Pharmaceuticals, Inc. | Inducible eukaryotic expression system |
| JP2005527227A (ja) * | 2002-05-29 | 2005-09-15 | リジェネロン・ファーマシューティカルズ・インコーポレイテッド | 誘導性の真核生物発現システム |
| EP1531666A4 (en) * | 2002-05-29 | 2006-05-24 | Regeneron Pharma | INDUCIBLE EUCARYOTIC EXPRESSION SYSTEM |
| US8673589B2 (en) | 2002-05-29 | 2014-03-18 | Regeneron Pharmaceuticals, Inc. | Inducible eukaryotic expression system |
| US9469856B2 (en) | 2002-05-29 | 2016-10-18 | Regeneron Pharmaceuticals, Inc. | Inducible eukaryotic expression system |
| US10696973B2 (en) | 2002-05-29 | 2020-06-30 | Regeneron Pharmaceuticals, Inc. | Inducible eukaryotic expression system |
| WO2005040212A3 (en) * | 2003-10-24 | 2005-07-28 | Angeletti P Ist Richerche Bio | Orthogonal gene switches |
| WO2012049332A1 (en) * | 2010-10-15 | 2012-04-19 | Fundació Privada Centre De Regulació Genòmica | Peptides and uses |
| US9096682B2 (en) | 2010-10-15 | 2015-08-04 | Fundacio Privada Centre De Regulacio Genomica | Peptides and uses |
| US9732129B2 (en) | 2010-10-15 | 2017-08-15 | Fundacio Centre De Regulacio Genomica | Peptides and uses thereof |
| WO2013119880A1 (en) | 2012-02-07 | 2013-08-15 | Global Bio Therapeutics Usa, Inc. | Compartmentalized method of nucleic acid delivery and compositions and uses thereof |
| US9821114B2 (en) | 2012-02-07 | 2017-11-21 | Global Bio Therapeutics, Inc. | Compartmentalized method of nucleic acid delivery and compositions and uses thereof |
| EP3970734A2 (en) | 2012-02-07 | 2022-03-23 | Global Bio Therapeutics, Inc. | Compartmentalized method of nucleic acid delivery and compositions and uses thereof |
| US11364032B2 (en) | 2013-08-08 | 2022-06-21 | Global Bio Therapeutics, Inc. | Clamp device for minimally invasive procedures and uses thereof |
| WO2017134137A1 (en) * | 2016-02-05 | 2017-08-10 | Polygene Ag | Glucocorticoid-based gene regulation system |
| US11078282B2 (en) | 2016-04-15 | 2021-08-03 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| WO2017181152A2 (en) | 2016-04-15 | 2017-10-19 | Alpine Immune Sciences, Inc. | Cd80 variant immunomodulatory proteins and uses thereof |
| WO2017181148A2 (en) | 2016-04-15 | 2017-10-19 | Alpine Immune Sciences, Inc. | Icos ligand variant immunomodulatory proteins and uses thereof |
| US11498967B2 (en) | 2016-04-15 | 2022-11-15 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11479609B2 (en) | 2016-04-15 | 2022-10-25 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US12110339B2 (en) | 2016-04-15 | 2024-10-08 | Alpine Immune Sciences, Inc. | ICOS ligand variant immunomodulatory proteins and uses thereof |
| EP4706777A2 (en) | 2016-04-15 | 2026-03-11 | Alpine Immune Sciences, Inc. | Cd80 variant immunomodulatory proteins and uses thereof |
| US10882914B2 (en) | 2016-04-15 | 2021-01-05 | Alpine Immune Sciences, Inc. | ICOS ligand variant immunomodulatory proteins and uses thereof |
| US11359022B2 (en) | 2016-04-15 | 2022-06-14 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11471488B2 (en) | 2016-07-28 | 2022-10-18 | Alpine Immune Sciences, Inc. | CD155 variant immunomodulatory proteins and uses thereof |
| WO2018022946A1 (en) | 2016-07-28 | 2018-02-01 | Alpine Immune Sciences, Inc. | Cd155 variant immunomodulatory proteins and uses thereof |
| US11834490B2 (en) | 2016-07-28 | 2023-12-05 | Alpine Immune Sciences, Inc. | CD112 variant immunomodulatory proteins and uses thereof |
| WO2018022945A1 (en) | 2016-07-28 | 2018-02-01 | Alpine Immune Sciences, Inc. | Cd112 variant immunomodulatory proteins and uses thereof |
| WO2018075978A1 (en) | 2016-10-20 | 2018-04-26 | Alpine Immune Sciences, Inc. | Secretable variant immunomodulatory proteins and engineered cell therapy |
| EP3872180A1 (en) | 2016-10-20 | 2021-09-01 | Alpine Immune Sciences, Inc. | Secretable variant immunomodulatory proteins and engineered cell therapy |
| US11230588B2 (en) | 2017-03-16 | 2022-01-25 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| WO2018170026A2 (en) | 2017-03-16 | 2018-09-20 | Alpine Immune Sciences, Inc. | Cd80 variant immunomodulatory proteins and uses thereof |
| US11096988B2 (en) | 2017-03-16 | 2021-08-24 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11732022B2 (en) | 2017-03-16 | 2023-08-22 | Alpine Immune Sciences, Inc. | PD-L2 variant immunomodulatory proteins and uses thereof |
| US11117948B2 (en) | 2017-03-16 | 2021-09-14 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11117949B2 (en) | 2017-03-16 | 2021-09-14 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11117950B2 (en) | 2017-03-16 | 2021-09-14 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| US11639375B2 (en) | 2017-03-16 | 2023-05-02 | Alpine Immune Sciences, Inc. | CD80 variant immunomodulatory proteins and uses thereof |
| EP4306537A2 (en) | 2017-03-16 | 2024-01-17 | Alpine Immune Sciences, Inc. | Pd-l1 variant immunomodulatory proteins and uses thereof |
| WO2018170023A1 (en) | 2017-03-16 | 2018-09-20 | Alpine Immune Sciences, Inc. | Pd-l2 variant immunomodulatory proteins and uses thereof |
| WO2018170021A1 (en) | 2017-03-16 | 2018-09-20 | Alpine Immune Sciences, Inc. | Pd-l1 variant immunomodulatory proteins and uses thereof |
| US11753458B2 (en) | 2017-10-10 | 2023-09-12 | Alpine Immune Sciences, Inc. | CTLA-4 variant immunomodulatory proteins and uses thereof |
| WO2019074983A1 (en) | 2017-10-10 | 2019-04-18 | Alpine Immune Sciences, Inc. | CTLA-4 VARIANT IMMUNOMODULATORY PROTEINS AND USES THEREOF |
| US12358969B2 (en) | 2017-10-10 | 2025-07-15 | Alpine Immune Sciences, Inc. | CTLA-4 variant immunomodulatory proteins and uses thereof |
| EP4219540A2 (en) | 2017-10-10 | 2023-08-02 | Alpine Immune Sciences, Inc. | Ctla-4 variant immunomodulatory proteins and uses thereof |
| EP4442268A2 (en) | 2017-10-10 | 2024-10-09 | Alpine Immune Sciences, Inc. | Ctla-4 variant immunomodulatory proteins and uses thereof |
| US11613566B2 (en) | 2017-10-18 | 2023-03-28 | Alpine Immune Sciences, Inc. | Variant ICOS ligand immunomodulatory proteins and related compositions and methods |
| EP4717707A2 (en) | 2017-10-18 | 2026-04-01 | Alpine Immune Sciences, Inc. | Variant icos ligand immunomodulatory proteins and related compositions and methods |
| WO2019079520A2 (en) | 2017-10-18 | 2019-04-25 | Alpine Immune Sciences, Inc. | ICOS VARIANT LIGAND IMMUNOMODULATORY IMMUNOMODULATORY PROTEINS, COMPOSITIONS AND METHODS THEREOF |
| AU2018375192B2 (en) * | 2017-12-01 | 2023-11-09 | Encoded Therapeutics, Inc. | Engineered DNA binding proteins |
| US12083188B2 (en) | 2017-12-01 | 2024-09-10 | Encoded Therapeutics, Inc. | Engineered DNA binding proteins |
| WO2019136179A1 (en) | 2018-01-03 | 2019-07-11 | Alpine Immune Sciences, Inc. | Multi-domain immunomodulatory proteins and methods of use thereof |
| US12297253B2 (en) | 2018-01-03 | 2025-05-13 | Alpine Immune Sciences, Inc. | Multi-domain immunomodulatory proteins and methods of use thereof |
| US12065476B2 (en) | 2018-06-15 | 2024-08-20 | Alpine Immune Sciences, Inc. | PD-1 variant immunomodulatory proteins and uses thereof |
| WO2019241758A1 (en) | 2018-06-15 | 2019-12-19 | Alpine Immune Sciences, Inc. | Pd-1 variant immunomodulatory proteins and uses thereof |
| WO2020061376A2 (en) | 2018-09-19 | 2020-03-26 | Alpine Immune Sciences, Inc. | Methods and uses of variant cd80 fusion proteins and related constructs |
| WO2020112904A1 (en) | 2018-11-26 | 2020-06-04 | Massachusetts Institute Of Technology | Compositions and methods for immune tolerance |
| WO2020113141A2 (en) | 2018-11-30 | 2020-06-04 | Alpine Immune Sciences, Inc. | Cd86 variant immunomodulatory proteins and uses thereof |
| US12552853B2 (en) | 2018-11-30 | 2026-02-17 | Alpine Immune Sciences, Inc. | CD86 variant immunomodulatory proteins and uses thereof |
| EP4438054A2 (en) | 2019-04-17 | 2024-10-02 | Alpine Immune Sciences, Inc. | Methods and uses of variant icos ligand (icosl) fusion proteins |
| WO2020214867A1 (en) | 2019-04-17 | 2020-10-22 | Alpine Immune Sciences, Inc. | Methods and uses of variant icos ligand (icosl) fusion proteins |
| WO2020243164A1 (en) * | 2019-05-28 | 2020-12-03 | Octant, Inc. | Transcriptional relay system |
| US12516350B2 (en) | 2019-05-29 | 2026-01-06 | Encoded Therapeutics, Inc. | Compositions and methods for selective gene regulation |
| US12304943B2 (en) | 2020-05-08 | 2025-05-20 | Alpine Immune Sciences, Inc. | April and BAFF inhibitory immunomodulatory proteins and methods of use thereof |
| US12612447B2 (en) | 2020-05-08 | 2026-04-28 | Alpine Immune Sciences, Inc. | April and BAFF inhibitory immunomodulatory proteins and methods of use thereof |
| WO2023017494A1 (en) | 2021-08-13 | 2023-02-16 | Triovance Holding Llc | A skin substitute composition and methods of producing and using the same |
| CN117756945A (zh) * | 2023-11-14 | 2024-03-26 | 维康平生(北京)生物科技有限公司 | 融合蛋白及其用途 |
Also Published As
| Publication number | Publication date |
|---|---|
| CA2388535A1 (en) | 2001-05-03 |
| US7329728B1 (en) | 2008-02-12 |
| US20080318839A1 (en) | 2008-12-25 |
| AU1143801A (en) | 2001-05-08 |
| JP2003512827A (ja) | 2003-04-08 |
| NZ518218A (en) | 2004-04-30 |
| IL149142A (en) | 2010-05-31 |
| US20030186841A1 (en) | 2003-10-02 |
| IL149142A0 (en) | 2002-11-10 |
| EP1226168A1 (en) | 2002-07-31 |
| US7442784B2 (en) | 2008-10-28 |
| JP2009273463A (ja) | 2009-11-26 |
| AU775988B2 (en) | 2004-08-19 |
| WO2001030843A9 (en) | 2002-09-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US7442784B2 (en) | Ligand activated transcriptional regulator proteins | |
| Wang et al. | Positive and negative regulation of gene expression in eukaryotic cells with an inducible transcriptional regulator | |
| US7741110B2 (en) | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches | |
| JP3817739B2 (ja) | キメラdna結合性タンパク質 | |
| US20090029468A1 (en) | Zinc finger binding domains for cnn | |
| EP0798378B1 (en) | Estrogen receptor | |
| JP2005500061A5 (https=) | ||
| CA2543329A1 (en) | Orthogonal gene switches | |
| EP1397382B1 (en) | Novel estrogen receptor ligand binding domain variants and novel ligands and pharmaceutical compositions | |
| EP1303606B1 (en) | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches | |
| Gavva et al. | NAPP2, a peroxisomal membrane protein, is also a transcriptional corepressor | |
| JP2004500884A (ja) | 遺伝子発現の調節方法及び手段 | |
| JP2004504029A5 (https=) | ||
| AU2001272544A1 (en) | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches | |
| AU2005234684B2 (en) | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches | |
| HK1115159A (en) | Regulation of gene expression using single-chain, monomeric, ligand dependent polypeptide switches | |
| HK1001978B (en) | Estrogen receptor |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AK | Designated states |
Kind code of ref document: A1 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 2000972849 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11438/01 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 518218 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2388535 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 149142 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref country code: JP Ref document number: 2001 533840 Kind code of ref document: A Format of ref document f/p: F |
|
| WWP | Wipo information: published in national office |
Ref document number: 2000972849 Country of ref document: EP |
|
| AK | Designated states |
Kind code of ref document: C2 Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BY BZ CA CH CN CR CU CZ DE DK DM DZ EE ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT TZ UA UG UZ VN YU ZA ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: C2 Designated state(s): GH GM KE LS MW MZ SD SL SZ TZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| COP | Corrected version of pamphlet |
Free format text: PAGES 1-131, DESCRIPTION, REPLACED BY NEW PAGES 1-131; PAGES 132-138, CLAIMS, REPLACED BY NEW PAGES132-138; PAGES 1/27-27/27, DRAWINGS, REPLACED BY NEW PAGES 1/27-27/27; PAGES 1-46; SEQUENCE LISTING, REPLACED BY NEW PAGES 1-46; DUE TO LATE TRANSMITTAL BY THE RECEIVING OFFICE |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| WWP | Wipo information: published in national office |
Ref document number: 518218 Country of ref document: NZ |
|
| WWG | Wipo information: grant in national office |
Ref document number: 518218 Country of ref document: NZ |
|
| WWG | Wipo information: grant in national office |
Ref document number: 11438/01 Country of ref document: AU |