WO1995032003A1 - Facteurs de croissance proches de l'insuline modifies - Google Patents
Facteurs de croissance proches de l'insuline modifies Download PDFInfo
- Publication number
- WO1995032003A1 WO1995032003A1 PCT/US1995/006540 US9506540W WO9532003A1 WO 1995032003 A1 WO1995032003 A1 WO 1995032003A1 US 9506540 W US9506540 W US 9506540W WO 9532003 A1 WO9532003 A1 WO 9532003A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- igf
- mutein
- peg
- muteins
- conjugate
- Prior art date
Links
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 title claims abstract description 37
- 102000013275 Somatomedins Human genes 0.000 title abstract description 11
- 229920001223 polyethylene glycol Polymers 0.000 claims abstract description 103
- 239000002202 Polyethylene glycol Substances 0.000 claims abstract description 70
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 claims abstract description 35
- 238000000034 method Methods 0.000 claims abstract description 30
- 235000018417 cysteine Nutrition 0.000 claims abstract description 24
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims abstract description 24
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 11
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 claims description 24
- 241000588724 Escherichia coli Species 0.000 claims description 13
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 13
- 230000003213 activating effect Effects 0.000 claims description 11
- 229920001184 polypeptide Polymers 0.000 claims description 11
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 11
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 claims description 7
- 210000004897 n-terminal region Anatomy 0.000 claims description 7
- 125000003396 thiol group Chemical group [H]S* 0.000 claims description 7
- 150000003573 thiols Chemical class 0.000 claims description 7
- -1 tresylate Chemical compound 0.000 claims description 7
- 239000003937 drug carrier Substances 0.000 claims description 6
- 210000004899 c-terminal region Anatomy 0.000 claims description 5
- 125000004938 5-pyridyl group Chemical group N1=CC=CC(=C1)* 0.000 claims description 4
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical compound C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 claims description 4
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 claims description 4
- 238000004519 manufacturing process Methods 0.000 claims 1
- 150000001413 amino acids Chemical group 0.000 abstract description 32
- 230000004048 modification Effects 0.000 abstract description 8
- 238000012986 modification Methods 0.000 abstract description 8
- 230000004071 biological effect Effects 0.000 abstract description 4
- 230000001225 therapeutic effect Effects 0.000 abstract description 4
- 230000000144 pharmacologic effect Effects 0.000 abstract 1
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 255
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 243
- 101001055320 Myxine glutinosa Insulin-like growth factor Proteins 0.000 description 126
- 108090000623 proteins and genes Proteins 0.000 description 53
- 235000018102 proteins Nutrition 0.000 description 46
- 102000004169 proteins and genes Human genes 0.000 description 46
- 210000004027 cell Anatomy 0.000 description 32
- 235000001014 amino acid Nutrition 0.000 description 31
- 241000700159 Rattus Species 0.000 description 30
- 108020004414 DNA Proteins 0.000 description 27
- 241001465754 Metazoa Species 0.000 description 23
- 239000000203 mixture Substances 0.000 description 22
- 230000002829 reductive effect Effects 0.000 description 20
- 230000000694 effects Effects 0.000 description 19
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 18
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 18
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 17
- 239000000178 monomer Substances 0.000 description 16
- 238000006243 chemical reaction Methods 0.000 description 15
- 230000002297 mitogenic effect Effects 0.000 description 15
- 102000005962 receptors Human genes 0.000 description 15
- 108020003175 receptors Proteins 0.000 description 15
- 239000006228 supernatant Substances 0.000 description 15
- 238000002474 experimental method Methods 0.000 description 14
- 239000012634 fragment Substances 0.000 description 14
- 239000007924 injection Substances 0.000 description 14
- 238000002347 injection Methods 0.000 description 14
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 14
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 12
- 208000021017 Weight Gain Diseases 0.000 description 12
- 238000009472 formulation Methods 0.000 description 12
- 230000012010 growth Effects 0.000 description 12
- 102000028416 insulin-like growth factor binding Human genes 0.000 description 12
- 108091022911 insulin-like growth factor binding Proteins 0.000 description 12
- 239000001632 sodium acetate Substances 0.000 description 12
- 235000017281 sodium acetate Nutrition 0.000 description 12
- 230000004584 weight gain Effects 0.000 description 12
- 235000019786 weight gain Nutrition 0.000 description 12
- 108091034117 Oligonucleotide Proteins 0.000 description 11
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 11
- 238000004458 analytical method Methods 0.000 description 11
- 239000000872 buffer Substances 0.000 description 11
- 238000003752 polymerase chain reaction Methods 0.000 description 11
- 101150088952 IGF1 gene Proteins 0.000 description 10
- 239000007983 Tris buffer Substances 0.000 description 10
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 10
- 239000011541 reaction mixture Substances 0.000 description 10
- 239000003981 vehicle Substances 0.000 description 10
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 9
- 231100000350 mutagenesis Toxicity 0.000 description 9
- 238000002703 mutagenesis Methods 0.000 description 9
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 9
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 9
- 108090001061 Insulin Proteins 0.000 description 8
- 108091028043 Nucleic acid sequence Proteins 0.000 description 8
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 8
- 229920000642 polymer Polymers 0.000 description 8
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 8
- 102000014914 Carrier Proteins Human genes 0.000 description 7
- 108020004705 Codon Proteins 0.000 description 7
- 102000004877 Insulin Human genes 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 108091008324 binding proteins Proteins 0.000 description 7
- 239000003814 drug Substances 0.000 description 7
- 229940125396 insulin Drugs 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- ZRALSGWEFCBTJO-UHFFFAOYSA-N Guanidine Chemical compound NC(N)=N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 6
- 102000004375 Insulin-like growth factor-binding protein 1 Human genes 0.000 description 6
- 108090000957 Insulin-like growth factor-binding protein 1 Proteins 0.000 description 6
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 201000010099 disease Diseases 0.000 description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 6
- 238000002523 gelfiltration Methods 0.000 description 6
- 229930182817 methionine Natural products 0.000 description 6
- 239000008188 pellet Substances 0.000 description 6
- 102000004374 Insulin-like growth factor binding protein 3 Human genes 0.000 description 5
- 108090000965 Insulin-like growth factor binding protein 3 Proteins 0.000 description 5
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 5
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 5
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- 201000008968 osteosarcoma Diseases 0.000 description 5
- 239000000546 pharmaceutical excipient Substances 0.000 description 5
- 239000002953 phosphate buffered saline Substances 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 229910000162 sodium phosphate Inorganic materials 0.000 description 5
- 230000004936 stimulating effect Effects 0.000 description 5
- 108010001857 Cell Surface Receptors Proteins 0.000 description 4
- 241000672609 Escherichia coli BL21 Species 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 229930182816 L-glutamine Natural products 0.000 description 4
- 229930182555 Penicillin Natural products 0.000 description 4
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 4
- 239000012506 Sephacryl® Substances 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 230000037396 body weight Effects 0.000 description 4
- 238000010276 construction Methods 0.000 description 4
- 206010012601 diabetes mellitus Diseases 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 102000044162 human IGF1 Human genes 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 102000006240 membrane receptors Human genes 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 229940049954 penicillin Drugs 0.000 description 4
- 230000003285 pharmacodynamic effect Effects 0.000 description 4
- 230000036515 potency Effects 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 229960005322 streptomycin Drugs 0.000 description 4
- 206010013883 Dwarfism Diseases 0.000 description 3
- 210000000712 G cell Anatomy 0.000 description 3
- 102000018997 Growth Hormone Human genes 0.000 description 3
- 108010051696 Growth Hormone Proteins 0.000 description 3
- CHJJGSNFBQVOTG-UHFFFAOYSA-N N-methyl-guanidine Natural products CNC(N)=N CHJJGSNFBQVOTG-UHFFFAOYSA-N 0.000 description 3
- 108010079246 OMPA outer membrane proteins Proteins 0.000 description 3
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 3
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 239000012505 Superdex™ Substances 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- SWSQBOPZIKWTGO-UHFFFAOYSA-N dimethylaminoamidine Natural products CN(C)C(N)=N SWSQBOPZIKWTGO-UHFFFAOYSA-N 0.000 description 3
- 238000004090 dissolution Methods 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 239000003102 growth factor Substances 0.000 description 3
- 239000000122 growth hormone Substances 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 230000014759 maintenance of location Effects 0.000 description 3
- 230000011164 ossification Effects 0.000 description 3
- 230000006320 pegylation Effects 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- 238000010600 3H thymidine incorporation assay Methods 0.000 description 2
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 206010006895 Cachexia Diseases 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 108010053070 Glutathione Disulfide Proteins 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 208000001132 Osteoporosis Diseases 0.000 description 2
- 108010002747 Pfu DNA polymerase Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 239000012614 Q-Sepharose Substances 0.000 description 2
- 239000012722 SDS sample buffer Substances 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 239000004098 Tetracycline Substances 0.000 description 2
- 239000007984 Tris EDTA buffer Substances 0.000 description 2
- 229920004890 Triton X-100 Polymers 0.000 description 2
- 239000013504 Triton X-100 Substances 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 239000011543 agarose gel Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 125000003275 alpha amino acid group Chemical group 0.000 description 2
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 2
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 2
- 235000011130 ammonium sulphate Nutrition 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 239000012148 binding buffer Substances 0.000 description 2
- 230000008468 bone growth Effects 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 239000007795 chemical reaction product Substances 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 150000002019 disulfides Chemical class 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 238000001641 gel filtration chromatography Methods 0.000 description 2
- 229960003180 glutathione Drugs 0.000 description 2
- YPZRWBKMTBYPTK-BJDJZHNGSA-N glutathione disulfide Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@H](C(=O)NCC(O)=O)CSSC[C@@H](C(=O)NCC(O)=O)NC(=O)CC[C@H](N)C(O)=O YPZRWBKMTBYPTK-BJDJZHNGSA-N 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000036512 infertility Effects 0.000 description 2
- 239000003999 initiator Substances 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 238000005567 liquid scintillation counting Methods 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 231100000219 mutagenic Toxicity 0.000 description 2
- 230000003505 mutagenic effect Effects 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 210000000963 osteoblast Anatomy 0.000 description 2
- 230000003239 periodontal effect Effects 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000011533 pre-incubation Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000012679 serum free medium Substances 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 229960002180 tetracycline Drugs 0.000 description 2
- 229930101283 tetracycline Natural products 0.000 description 2
- 235000019364 tetracycline Nutrition 0.000 description 2
- 150000003522 tetracyclines Chemical class 0.000 description 2
- 210000002303 tibia Anatomy 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- 108700026220 vif Genes Proteins 0.000 description 2
- GUPXYSSGJWIURR-UHFFFAOYSA-N 3-octoxypropane-1,2-diol Chemical compound CCCCCCCCOCC(O)CO GUPXYSSGJWIURR-UHFFFAOYSA-N 0.000 description 1
- 101100295756 Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) omp38 gene Proteins 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 102100023995 Beta-nerve growth factor Human genes 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 208000020446 Cardiac disease Diseases 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 241001524679 Escherichia virus M13 Species 0.000 description 1
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 1
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 1
- 241000976806 Genea <ascomycete fungus> Species 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 101001081567 Homo sapiens Insulin-like growth factor-binding protein 1 Proteins 0.000 description 1
- 206010062767 Hypophysitis Diseases 0.000 description 1
- 102000004372 Insulin-like growth factor binding protein 2 Human genes 0.000 description 1
- 108090000964 Insulin-like growth factor binding protein 2 Proteins 0.000 description 1
- 102100027636 Insulin-like growth factor-binding protein 1 Human genes 0.000 description 1
- 102000004883 Insulin-like growth factor-binding protein 6 Human genes 0.000 description 1
- 108090001014 Insulin-like growth factor-binding protein 6 Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 239000006142 Luria-Bertani Agar Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 102000008934 Muscle Proteins Human genes 0.000 description 1
- 108010074084 Muscle Proteins Proteins 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 108010025020 Nerve Growth Factor Proteins 0.000 description 1
- 108091006006 PEGylated Proteins Proteins 0.000 description 1
- 108010050808 Procollagen Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000003743 Relaxin Human genes 0.000 description 1
- 108090000103 Relaxin Proteins 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- RZCIEJXAILMSQK-JXOAFFINSA-N TTP Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 RZCIEJXAILMSQK-JXOAFFINSA-N 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 230000001195 anabolic effect Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000005349 anion exchange Methods 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 101150042295 arfA gene Proteins 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 230000001713 cholinergic effect Effects 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 210000003022 colostrum Anatomy 0.000 description 1
- 235000021277 colostrum Nutrition 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 1
- SUYVUBYJARFZHO-UHFFFAOYSA-N dATP Natural products C1=NC=2C(N)=NC=NC=2N1C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-UHFFFAOYSA-N 0.000 description 1
- RGWHQCVHVJXOKC-SHYZEUOFSA-J dCTP(4-) Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-J 0.000 description 1
- HAAZLUGHYHWQIW-KVQBGUIXSA-N dGTP Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 HAAZLUGHYHWQIW-KVQBGUIXSA-N 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000006334 disulfide bridging Effects 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000002124 endocrine Effects 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 229940126864 fibroblast growth factor Drugs 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 230000004190 glucose uptake Effects 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Natural products OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 1
- 239000005337 ground glass Substances 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 210000003000 inclusion body Anatomy 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 229940053128 nerve growth factor Drugs 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 101150087557 omcB gene Proteins 0.000 description 1
- 101150115693 ompA gene Proteins 0.000 description 1
- 238000012261 overproduction Methods 0.000 description 1
- YPZRWBKMTBYPTK-UHFFFAOYSA-N oxidized gamma-L-glutamyl-L-cysteinylglycine Natural products OC(=O)C(N)CCC(=O)NC(C(=O)NCC(O)=O)CSSCC(C(=O)NCC(O)=O)NC(=O)CCC(N)C(O)=O YPZRWBKMTBYPTK-UHFFFAOYSA-N 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 208000028169 periodontal disease Diseases 0.000 description 1
- 208000027232 peripheral nervous system disease Diseases 0.000 description 1
- 208000033808 peripheral neuropathy Diseases 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 210000003635 pituitary gland Anatomy 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 239000006215 rectal suppository Substances 0.000 description 1
- 229940100618 rectal suppository Drugs 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 1
- 238000013341 scale-up Methods 0.000 description 1
- 238000003345 scintillation counting Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 239000007974 sodium acetate buffer Substances 0.000 description 1
- 239000004290 sodium methyl p-hydroxybenzoate Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000013222 sprague-dawley male rat Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000012385 systemic delivery Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000012384 transportation and delivery Methods 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 239000006216 vaginal suppository Substances 0.000 description 1
- 229940120293 vaginal suppository Drugs 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000001993 wax Substances 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 208000016261 weight loss Diseases 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/65—Insulin-like growth factors, i.e. somatomedins, e.g. IGF-1, IGF-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
Definitions
- This invention relates to the modification of polypeptides, and more particularly to the modification of insulin-like growth factors and to methods of making and using such modified polypeptides.
- the insulin gene family comprised of insulin, relaxin, insulin-like growth factors 1 and 2, and possibly the beta subunit of 7S nerve growth factor, represents a group of structurally related polypeptides whose biological functions have diverged as reported in Dull, et al., Nature 310:777-781 (1984).
- IGF-1 and IGF-2 Insulin-like growth factors 1 and 2
- IGF-1 and IGF-2 are about 7-8 kilodalton proteins that are structurally related to each other and to insulin.
- IGF-1 and IGF-2 share about 70% amino acid identity with each other and about 30% amino acid identity with insulin.
- IGF-1 and IGF-2 are believed to have related tertiary structures as reported in PCT Application Publication No. WO 90/00569, published on January 25, 1990.
- the structural similarity between IGF-1 and IGF-2 permits both to bind to IGF receptors.
- Two IGF receptors are known to exist. IGF-1 and IGF-2 bind to the IGF type I receptor, while insulin binds with less affinity to this receptor.
- the type I receptor preferentially binds IGF-1 and is believed to transduce the mitogenic effects of IGF-1 and IGF-2.
- IGF-2 binds to the type I receptor with a 10-fold lower affinity than IGF-1.
- the second or type ⁇ IGF receptor preferentially binds IGF-2. Receptor binding is believed to be necessary for the biological activities of IGF-1 and IGF-2.
- IGF-1 and IGF-2 are mitogenic for a large number of cell types, including fibroblasts, keratinocytes, endothelial cells and osteoblasts (bone-forming cells). IGF-1 and IGF-2 also stimulate differentiation of many cell types, e.g., synthesis and secretion of collagens by osteoblasts. IGF-1 and IGF-2 exert their mitogenic and cell differentiating effects by binding to the specific IGF cell surface receptors. IGF-1 also has been shown to inhibit protein catabolism in vivo, stimulate glucose uptake by cells and to promote survival of isolated neurons in culture. These properties have led to IGF-1 being tested as a therapeutic agent for a variety of disease indications as reported in Froesch et al.
- IGFBP-1 IGF binding proteins
- IGFBP-2 IGF binding proteins
- IGF When IGF is bound to binding proteins, it is unable to bind to the IGF receptors and is therefore, no longer active in the body. Decreased affinity to binding proteins allows more of the IGF to be active in the body. Situations when this decreased affinity to binding proteins may be useful include, for example, cachexia, osteoporosis, and peripheral neuropathies.
- IGF binding proteins can vary greatly, depending upon the disease state. For example, IGFBP-1 levels are very high in diabetes patients, whereas they are nearly undetectable in normal patients as reported in Brismar et al., J. of Endocrinological Investigation. 11:599-602 (1988); Suikkari et al., J. of Clinical Endocrinology and Metabolism. 66:266-273 (1988); and Unterman et al., Biochem. Biophys. Res. Comm., 163:882-887 (1989).
- IGFBP-3 levels are reduced in severely ill patients such as those that have undergone major surgery as reported in Davies et al., . Endocrinology. 130:469-473 (1991); Davenport et al., J. Clin. Endocrin. Metab.. 75:590- 595 (1992).
- the reduced levels of IGFBP-3, and consequent shorter circulating half-life of IGF-1, may contribute to the cachexia (weight loss) seen in these patients.
- IGF-1 Insulin-like growth factor 1
- somatomedin C also known as somatomedin C
- IGF-1 insulin-deficient diabetic rats by administration of recombinantly produced human IGF-1 is reported in Scheiwiller et al., Nature. 323:169 (1986).
- IGF-1 and (desl-3)IGF-l enhance growth in rats after gut resection, as reported in Lemmey et al., Am. J. Phvsiol.. 260 (Endocrinol. Metab. 23) E213-E219 (1991).
- (desl-3)IGF-l when given by continual subcutaneous infiision, is more potent than IGF-1 in stimulating a number of anabolic functions, such as growth, reported in Cascieri et al., J. Endocrinology. 123:373- 381 (1988) and Gillespie et al., J. Endocrinology. 127:401-405 (1990).
- the enhanced properties of (desl-3)IGF-l are believed to result from its reduced affimty for IGF binding proteins, reported in Carlsson-Skwirut et al., Biochim. Biophys. Acta. 1101:192-197 (1989).
- (desl-3)IGF-l The reduced affinity of (desl-3)IGF-l for IGF binding proteins results in (desl- 3)IGF-1 having a shorter circulating half-life than wild type IGF-1 as reported in Cascieri et al., J. Endocrinology. 123:373-381 (1988). Therefore, (desl-3)IGF-l must be administered by continual infiision or by multiple daily injections in order to effect its enhanced potency.
- IGF- 1 and (desl-3) IGF-1 are limited by their short circulating half-lives to situations when the proteins can be administered by continual infiision or by multiple daily injections to achieve their maximum therapeutic potential.
- Woodall et al. Horm. Metab. Res.. 23: 581-584 (1991) reports that the same total dose of IGF- 1 administered four times daily by subcutaneous injection was far superior in stimulating growth in mutant lit/lit mice (growth hormone deficient mice) than was the same total dose administered once daily.
- IGF-1 insulin growth factor-1
- injectable drugs patient compliance is expected to be higher for drugs that can be administered once a day rather than several times a day.
- IGF-1 In order for IGF-1 to be therapeutically effective when given once a day or once every few days, methods must be developed to increase its circulating half-life.
- the present invention satisfies this need by increasing the molecular weight of the IGF. This is accomplished by providing muteins of IGF suitable for thiol-specific attachment of PEG to IGF and PEG conjugates formed from such muteins.
- the invention relates to various modified forms of IGF.
- modified IGF One type of modified IGF, referred to as muteins, is produced by replacing cysteine residues for specific amino acids in the wild type molecule, or by inserting cysteine residues adjacent to or between amino acids in the wild type molecule. Cysteine residues which are not involved in intramolecular disulfide bonds are considered to be "free". Cysteine residues can be substituted or inserted in regions of the IGF molecule that are exposed on the protein's surface. For example, the non-native cysteine can be inserted or substituted within the first or last twenty amino acids of wild-type IGF-1.
- This non-native cysteine is expected to be free and to serve as the attachment site for the polyethylene glycol (PEG) molecules to IGF, resulting in PEGylated molecules.
- PEG polyethylene glycol
- the non-native cysteine can become involved in a disulfide bond and thereby free a native cysteine for PEGylation.
- Attachment of the PEG molecule to a mutein creates a further modified form of IGF, or IGF-PEG conjugate of defined structure, where the PEG is attached to the IGF at a free cysteine residue.
- the present invention is directed to a polyethylene glycol (PEG) conjugate comprising PEG and a mutein of IGF, and particularly IGF-1 , where the PEG is attached to the mutein at a non-native cysteine.
- PEG can be attached to the free cysteine through a thiol-specific activating group including, for example, maleimide, sulfhydryl, thiol, triflate, tresylate, aziridine, exirane and 5-pyridyl.
- a suitable PEG can have a molecular weight of 5 kDa, 8.5 kDa, 10 kDa or 20 kDa.
- the PEG conjugate of the present invention can also contain a second protein to form a dumbbell. Methods of making the PEG conjugates are also provided.
- IGF is known to increase the circulating half-life of a protein in the body.
- IGF can be administered to patients less frequently with equal or better effectiveness than in the past.
- the present invention is further directed to muteins of IGF particularly those having a non-native cysteine in the N-terminal or C-terminal region of the mutein.
- the muteins can be produced by recombinant methods.
- compositions comprising the IGF-PEG conjugate and methods of using the IGF-PEG conjugate to treat a patient having or potentially having an IGF associated condition.
- the present invention is directed to modified forms of insulin-like growth factors
- IGF insulin growth factor
- modified forms of IGF include muteins of these growth factors, containing at least one free cysteine.
- Conjugates containing the IGF muteins attached to polyethylene glycol (PEG) are also considered modified forms of IGF.
- IGF refers to any polypeptide that binds to the IGF type I Receptor, including, for example, IGF-1, IGF-2, (desl-3)IGF-l, (R3)IGF-1 which is a mutein having a non-native arginine at residue number 3, and insulin.
- IGF-1 IGF-1
- IGF-2 IGF-2
- R3IGF-1 a mutein having a non-native arginine at residue number 3
- insulin insulin.
- This hormone family is described in Blundell and Humbel, Nature. 287:781-787 (1980). Due to this common receptor binding, the teachings of the present invention which are described with respect to IGF-1 are intended to encompass IGF-2, des(l-3) IGF-1, (R3)IGF-1, and insulin also.
- wild type IGF refers to the unmodified or naturally occurring IGF. This term is used interchangeably with “IGF,” “naturally occurring IGF,” or “native IGF.” The term “wild type IGF” also refers to native IGF to which a methionine residue has been added at the N-terminus.
- wild type IGF-1 refers to the unmodified or naturally-occurring 70 amino acid form of IGF-1. This term is used interchangeably with “IGF-1,” “naturally occurring IGF-1,” and “native IGF-1.” The term “wild type IGF-1” also refers to native IGF-1 to which a methionine residue has been added at the N-terminus.
- non-native refers to that which is not found in the native molecule.
- IGF-PEG conjugate refers to an IGF molecule attached to a polyethylene glycol molecule. This is also referred to as a "Peg conjugate”.
- N-terminal region refers to approximately the first twenty amino acids from the N-terminus of IGF or an IGF mutein, and up to twelve amino acids preceding the first amino acid of the N-terminus of IGF.
- N-terminus refers to the first amino acid at the N-terminal region in the sequence of wild-type IGF, for example, glycine in IGF-1.
- C-terminal region refers to aproximately the last twenty amino acids from the C-terminus of IGF or an IGF mutein and up to twelve amino acids following the last amino acid of the C-terminus of IGF.
- C-terminus refers to the last amino acid at the C-terminal region in the sequence of wild-type IGF, for example, alanine in IGF-1.
- mutant refers to a modified form of IGF, which has been modified to contain a non-native cysteine.
- retain biological activity refers to having at least 10% of the mitogenic activity of wild type recombinant IGF as measured by the relative amount of 3 H-thymidine incorporated into UMR106 rat osteosarcoma cells, in the absence of IGF binding protein- 1, using the assay described herein.
- the muteins and the conjugates of the present invention retain biological activity.
- activating group refers to a site on the PEG molecule which attaches to the mutein.
- pharmaceutically acceptable carrier refers to a physiologically- compatible, aqueous or non-aqueous solvent.
- IGF associated condition refers to an existing or potential adverse physiological condition which results from an over-production or underproduction of IGF, IGF binding protein or IGF receptor, inappropriate or inadequate binding of IGF to binding proteins or receptors and any disease in which IGF administration alleviates disease symptoms.
- An IGF associated condition also refers to a condition in which administration of IGF to a normal patient has a desired effect.
- patient refers to any human or animal in need of treatment for an IGF associated condition.
- the IGF muteins of the present invention are produced by modifying wild-type IGF, particularly at the N-terminal or C-terminal region of the protein. Such modifications can be substitutions or additions of at least one cysteine residue.
- An IGF mutein can be produced by replacing a specific amino acid with a cysteine, such as, for example, substituting one of the first or last four amino acids of IGF-1 with a cysteine residue.
- the amino acid sequence of wild type IGF-1 starting from the N-terminal end is: G P E T L CGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTG IVDECCFRSCDLRRLEMYCAPLKPAKSA (SEQ ID NO.1).
- modifications include, for example, adding at least one cysteine residue in front of the first or after the last amino acid of IGF.
- a cysteine residue can be inserted in front of and adjacent to the first amino acid of IGF.
- the non-native cysteine can appear between Met and the first amino acid of IGF.
- a free cysteine residue can also appear in a group of about twelve or less amino acids inserted before the first or after the last amino acid of IGF to form a longer IGF mutein.
- the non-native cysteine residues are located in regions of the IGF-1 molecule exposed to the protein's surface.
- the N-terminal region for example, is involved in the binding of the IGF to binding proteins, but is not involved in binding of IGF to cell surface IGF receptors.
- An IGF-1 mutein of the present invention is also referred to as "a cysteine mutein of IGF-1.”
- the non-native cysteine residue can act as the attachment site for covalent linkage of the activating group on the polyethylene glycol.
- the non-native cysteine can become involved in disulfide bonding thereby freeing a native cysteine residue for thiol-specific attachment to PEG.
- the newly created molecule comprising the cysteine mutein of IGF with the PEG attached is referred to as a "PEG conjugate of IGF".
- the IGF muteins of the present invention can be prepared by methods well known to one skilled in the art.
- Such methods include mutagenic techniques for replacement or insertion of an amino acid residue, as described, for example, in U.S. Patent 4,518,584, incorporated herein by reference.
- the muteins produced by mutagenic techmques can then be expressed as recombinant products according to procedures known to those skilled in the art.
- the muteins can alternatively be synthesized by conventional methods known in the art.
- the IGF muteins can also be prepared according to the methods and techniques described in the examples set forth below.
- the present invention also provides IGF-PEG conjugates and methods of making such conjugates by attaching the IGF muteins to polyethylene glycol to increase the circulating half-life of the molecule in the body as well as decrease its affinity to IGF binding proteins.
- long chain polymer units of polyethylene glycol are bonded to the mutein via a covalent attachment to the sulfhydryl group of a free cysteine residue on the IGF mutein.
- PEG polyethylene glycol
- Various PEG polymers with different molecular weights 5.0 kDa (PEG 5000 ), 8.5 kDa (PEG 85(X> ), 10 kDa (PEG 10000 ), and 20 kDa (PEG 20000 ) can be used to make the IGF-PEG conjugates.
- functionalized polymer units that will react specifically with sulfhydryl or thiol groups.
- the functional or reactive group attached to the long chain polyethylene glycol polymer is the activating group to which the IGF mutein attaches at a free cysteine site.
- Useful activating groups include, for example, maleimide, sulfhydryl, thiol, triflate, tresylate, aziridine, exirane, or 5-pyridyl.
- polyethylene glycol (PEG) polymers containing two activating groups can be used to create "dumbbell” type molecules containing two IGF muteins attached to one molecule of PEG at each end of the PEG molecule.
- PEG bis-malemide a polyethylene glycol polymer containing a maleimide activating group on each end of the PEG molecule
- dumbbell molecules can also comprise a single IGF mutein covalently attached via PEG to a second protein or peptide of different structure.
- the second protein or peptide can be, for example, a growth factor such as platelet-derived growth factor, or fibroblast growth factor.
- One skilled in the art can readily determine the appropriate pH, concentration of protein, and ratio of protein: PEG necessary to produce a useful yield of either mono- pegylatedIGF-1 (IGF-PEG), or dumbbell IGF- 1 (IGF-PEG-IGF, IGF-PEG-PDGF, or IGF- PEG-FGF) using conventional methods known to one skilled in the art for making these determinations.
- IGF-PEG mono- pegylatedIGF-1
- dumbbell IGF- 1 IGF-PEG-IGF, IGF-PEG-PDGF, or IGF- PEG-FGF
- the invention present also includes pharmaceutical compositions.
- the IGF muteins and PEG conjugates can be in a pharmaceutically-acceptable carrier to form the pharmaceutical compositions of the present invention.
- pharmaceutically acceptable carrier means a non-toxic, generally inert vehicle for the active ingredient, which does not adversely affect the ingredient or the patient to whom the composition is administered. Suitable vehicles or carriers can be found in standard pharmaceutical texts, for example, in Remington's Pharmaceutical Sciences. 16th ed. , Mack
- Such carriers include, for example, aqueous solutions such as bicarbonate buffers, phosphate buffers, Ringer's solution and physiological saline.
- the carrier can contain other pharmaceutically-acceptable excipients for modifying or maintaining the pH, osmolarity, viscosity, clarity, color, sterility, stability, rate of dissolution, or odor of the formulation.
- the pharmaceutical compositions can be prepared by methods known in the art, including, by way of an example, the simple mixing of reagents. Those skilled in the art will know that the choice of the pharmaceutical carrier and the appropriate preparation of the composition depend on the intended use and mode of administration.
- the carrier and the IGF mutein or conjugate constitutes a physiologically-compatible, slow-release formulation.
- the primary solvent in such a carrier can be either aqueous or non-aqueous in nature.
- the carrier can contain other pharmacologically-acceptable excipients for modifying or maintaining the pH, osmolarity, viscosity, clarity, color, sterility, stability, rate of dissolution, or odor of the formulation.
- the carrier can contain still other pharmacologically-acceptable excipients for modifying or maintaining the stability, rate of dissolution, release, or absorption of the IGF mutein or conjugate.
- excipients are those substances usually and customarily employed to formulate dosages for parenteral administration in either unit dose or multi-dose form.
- the pharmaceutical composition can be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or dehydrated or lyophilized powder.
- Such formulations may be stored either in a ready to use form or requiring reconstitution immediately prior to administration.
- the preferred storage of such formulations is at temperatures at least as low as 4°C and preferably at -70°C. It is also preferred that such formulations containing the IGF mutein or conjugate are stored and administered at or near physiological pH. It is presently believed that administration in a formulation at a high pH (i.e. greater than 8) or at a low pH (i.e. less than 5) is undesirable.
- the manner of administering the formulations containing the IGF mutein or conjugate for systemic delivery can be via subcutaneous, intramuscular, intravenous, oral, intranasal, or vaginal or rectal suppository.
- the manner of administration of the formulations containing the IGF muteins or conjugates for local delivery is via intraarticular, intratracheal, or instillation or inhalations to the respiratory tract.
- the IGF muteins or conjugates are encapsulated.
- the encapsulated IGF muteins or conjugates may be formulated with or without pharmaceutically-acceptable carriers customarily used in the compounding of solid dosage forms.
- the capsule is designed so that the active portion of the formulation is released at that point in the gastro-intestinal tract when bioavailability is maximized and pre-systemic degradation is minimized. Additional excipients may be included to facilitate absorption of the IGF muteins or conjugates. Diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders may also be employed.
- the specific dose is calculated according to the approximate body weight of the patient.
- Other factors in determining the appropriate dosage can include the disease or condition to be treated or prevented, route of administration and the age, sex and medical condition of the pateint.
- the dosage and administration is designed to create a preselected concentration range of the IGF muteins or conjugates in the patient's blood stream. It is believed that the maintenance of circulating concentrations of the IGF muteins or conjugates of less than 0.01 ng per ml of plasma may not be an effective composition, while the prolonged maintenance of circulating levels in excess of 100 ⁇ g per ml may have undesirable side effects.
- IGF mutein and conjugate pharmaceutical compositions described herein may be used for veterinary as well as human applications and that the term "patient” should not be construed in a limiting manner. In the case of veterinary applications, the dosage ranges should be the same as specified above.
- the pharmaceutical composition of the present invention can be used to treat a patient having or potentially having an IGF associated condition. Some of these conditions can include, for example, dwarfism, diabetes, periodontal disease and osteoporosis.
- the pharmaceutical composition of the present invention can also be used to treat a condition in which administration of IGF to a normal patient has a desired effect; for example, using
- IGF-1 to enhance growth of a patient of normal stature.
- the IGF-1 gene was assembled in two stages. Initially, the DNA sequence encoding
- IGF-1 was joined to DNA sequences encoding the secretory leader sequence of the E. coli
- OMP A protein (ompAL). This gene fusion was constructed in order to determine whether
- IGF-1 could be efficiently secreted from E. coli.
- This DNA fragment was mixed with BamHI + Pstl-digested PUC18 DNA (commercially available from Boehringer Mannhein Biochemicals, Indianapolis, IN) and the two synthetic oligonucleotides [IGF-1 (1-14) U + L] 5'CCGGTCCGGAGACTCTGTGCGGCGCAGAACTGGTTGAC GCTCTGCA3' (SEQ ID NO. 6) and 5'GAGCGTCAACCAGTTCTGCGCCGC ACAGAGTCTCCGGACCGG3' (SEQ ID NO. 7) were Iigated together.
- the ligation mixture was used to transform E. coli strain JM109 (commercially available from New England Biolabs, Beverly, MA) and individual colonies isolated.
- These plasmids have a translational start signal followed by DNA sequences encoding the OmpA signal sequence and the first 14 amino acids of IGF-1.
- IGF-1 was created by Iigating together the two complementary pairs of oligonucleotides (IGF1U + IL and IGF2U + 2L) 5'GTTCGTATGCGGCGACCGTGGCTTC TACTTCAACAAACCGACTGGCTACGGTTCCAGCTCTCGTCGTGCACCGCAG ACTGGTATC3' (SEQ ID NO. 8) and 5'TTCGTCAACGATACCAGTCTGCGGTGC ACGACGAGAGCTGGAACCGTAGCCAGTCGGTTTGTTGAAGTAGAAGCCACG
- GTCGCCGCATACGAACTGCA3' (SEQ ID NO. 9) and cloning the DNA fragment into PstI + Hindm-digested Ml 3 mpl9 DNA (commercially available from New England Biolabs, Beverly, MA). Double-stranded DNA was purified from a phage clone and the
- the Bamffl/Hindm fragment containing the IGF-1 gene fused to the OmpAL sequence was isolated and cloned into the BamHI 4- HindlQ generated site of piasmid pT3XI-2 (described in PCT Application publication WO 91/08285 published on June 13, 1991).
- the completed piasmid containing the ompAL-IGF-1 gene fusion is called pT3XI-2 ⁇ lOC(TC3)ompALIGF-l .
- the BamHI/Hindi ⁇ fragment containing the OmpAL-IGF-1 gene fusion described above was purified from piasmid pT3XI-2 ⁇ lOC(TC3)ompALIGF-l and digested with Hinfl.
- the approximate 200 bp Hinfl/Hindm DNA fragment was mixed with the annealed, complementary synthetic oligonucleotides (MetlGFlU + IL) 5'GATCCGATCGT
- piasmid pT3XI2 DNA Iigated with BamHI + HindlH-digested piasmid pT3XI2 DNA, and used to transform E. coli JM107.
- the completed piasmid construct is called ⁇ lOC(TC3)IGF-lpT3XI-2 and contains an extra alanine residue in between the initiator methionine and the beginning of the IGF-1 sequence.
- the BamHI/Hindi ⁇ fragment containing the mutant IGF-1 gene was isolated and Iigated into the BamHI + Hindi ⁇ generated site of piasmid pT5T (described in Nature, Vol. 343, No. 6256, pp. 341-346, 1990).
- the ligation mixture was used to transform E. coli BL21/DE3 described in US Patent 4,952,496 and the resulting individual colonies were isolated. This construct was named ⁇ l0C(TC3)IGF-lpT5T.
- the oiigonucleotide used for mutagenesis had the sequence:
- the mutagenesis reaction product was used to transform E. coli strain JM109 and individual plaques picked.
- Double-stranded replicative form DNA from individual phages was isolated, digested with BamHI + HindlH and the 200 bp fragment containing the IGF-1 gene purified.
- the purified DNA was cloned into the BamHI + HindlH generated site of piasmid pT5T and used to transform E. coli strain BL21/DE3.
- One bacterial colony with the correct piasmid was named ⁇ l0(TC3)mutIGF-lpT5T.
- Several isolates were sequenced, and all were correct.
- IGF-1 insulin growth factor-1
- Three of the muteins replaced each of the first three amino acids of IGF-1 with a cysteine residue. These muteins are referred to as Cl, C2, and C3, respectively.
- a fourth mutein introduced a cysteine residue between the N-terminal methionine residue and the first amino acid of IGF-1. This mutein is referred to as -IC.
- the -IC, Cl, C2 and C3 muteins of IGF- 1 were made using the polymerase chain reaction (PCR) technique as described below.
- the starting piasmid used for the mutagenesis experiments was ⁇ lO(TC3)mutIGF-lpT5T, which is described in Example 1.
- This piasmid contains DNA sequences encoding an initiator methionine followed by the sequence of the natural human IGF-1 protein.
- Mutant IGF-1 DNA sequences were amplified from this gene using a 5' mutagenesis oiigonucleotide that contained the desired mutation and a 3' oiigonucleotide of correct sequence.
- the 5' mutagenesis oligonucleotides were designed so that they incorporated the first methionine of the gene as part of an Nde I restriction enzyme cleavage site (CATATG).
- Each mutagenesis oiigonucleotide contained the desired mutation followed by 15 to 21 nucleotides that were a perfect match to the IGF-1 gene sequences in piasmid ⁇ lO(TC3)mutIGF-lpT5T.
- the 3' oiigonucleotide was 25 nucleotides long and was designed to encode the last 6 codons of IGF-1 and to contain the Hind HI site that follows the stop codon.
- a wild type clone was made in the same manner using the Ndel site of pT5T (described above) as the first methionine.
- This wild type clone is designated 85p-ll.
- the oligonucleotides used to construct the -IC, Cl , C2 and C3 muteins and the 85p-l 1 wild type clone are set forth in Table 1.
- IGF(C2p)31 5'GGGCATATGGGTTGTGAGACTCTGTGCGGCG3'
- IGF(C3p)33 5'GGGCATATGGGTCCGTGCACTCTGTGCGGCGCA3' 3' oligo (for all of the above muteins) IGF(262p)25 5 ' CCC AAGCTTAAGCGCTTTTAGCCGG3 '
- PCR Polymerise chain reaction
- 20 mM Tris pH 8.8, 10 mM KC1, 6 mM (NH4)2SO4, 1.5 mM MgC12, 0.1 % Triton X-100 using 20 pmole of each oligo and approximately lng of piasmid ⁇ l0(TC3)mutIGF-lpT5T as template DNA.
- 0.5ul (1.25 units) of Pfu polymerase (Stratagene, San Diego, CA) was added after the first denaturation step with the tubes held at 65 °C.
- the reactions were overlayed with 2 drops of mineral oil at that time. The reactions were cycled 30 times for 1 min. at 95°C, 1 min.
- Piasmid pT5T is described in Example 1.
- the ligation reactions were used to transform E. coli strain BL21/DE3 and colonies selected on LB agar plates containing 50ug/ml of ampicillin. Mini piasmid DNA preps were made from several colonies from the transformation plates. The DNAs were digested with Eco RV and Hind
- Plasmids containing IGF-1 DNA inserts were sequenced to verify that the inserts were correctly mutated (the entire IGF gene was sequenced for each mutein).
- Isopropyl-beta-D-thiogalactopyranoside IPTG was added to 1 mM to induce expression of T7 polymerase and the subsequent transcription and translation of the IGF muteins.
- IPTG Isopropyl-beta-D-thiogalactopyranoside
- Approximately 0.1 OD unit of cells were lysed in SDS sample buffer by boiling for two minutes and electrophoresed on a 16% polyacrylamide SDS gel. The gel was stained with Coomassie blue.
- Muteins in which cysteine was substituted for the amino acids at residues 11, 12, 15, 16, 55, 64, 65, 67 and 69 of the wild type IGF-1 were also prepared using PCR.
- the PCR template was either the full-length piasmid from clone 85p-ll or the Ndel-HindHI fragment from clone 85p-ll containing the wild type IGF-I gene.
- Cll, C12, C15 and C16 5' oligonucleotides were synthesized that incorporated the first methionine as part of the Ndel site (CATATG) and each contained the mutation desired followed by 21-24 nucleotides that were a perfect match to clone 85p- 11.
- IGF(262p)25 a 25-mer oiigonucleotide that matched the last 6 codons of IGF-I plus the Hindi ⁇ site following the stop codon was used.
- IGF(262p)25 is set forth in Table 1.
- IGF(C12)S-69 5'GGGCATATGGGTCCGGAGACTCTGTGCGGCGCAGAACTGG1TTGCGCTCTGCAGTTCGTATGCGGCGAC3'
- C65 ...YCAPLC... IGF(C65)AS-55 5'CCCAAGCTTAAGCGCTTTTAGCCGGGCACAGCGGAGCGCAGTACATTTCCAGACG3'
- PCR Polymerase chain reaction
- 20 mM Tris pH 8.8, 10 mM KC1, 6 mM (NH4)2SO4, 1.5 mM MgC12, 0.1 % Triton X-100 using 20 pmole of each oligo, approximately lng of template DNA, 200uM each of dATP, dCTP, dGTP, TTP, 20pmole of each oligo primer, and lul (2.5U) of Pfu polymerase (Stratagene, San Diego, CA).
- the reactions were cycled 30 times for 1 min. at 95°C, 1 min. at 65°C and 1 min. at 72°C in a GeneA p PCR System 9600 (Perkin Elmer Cetus). After the last cycle the reactions were held at 72°C for 10 min.
- reaction mixtures were purified by passing through ChromaSpin 100 columns (Clontech Lab. Inc., Palo Alto, CA). Purified PCR fragments were digested with Ndel and HindlH and the ⁇ 210bp bands eluted from 1.5% agarose gel using NA45 paper
- a correct construct was selected for each mutein (clones Cll-1, C12-3, C15- 1, C16-4, C55-1, C64-1, C65-1, C67-2, C69-1) and transformed into E. Coli strain BL21/DE3 for expression.
- Preliminary expression studies of the muteins were performed by growing two representative transformants for each mutein in LB + tetracycline (12ug/ml) to an approximate OD 600 Of about 0.6-0.8.
- IPTG was added to a final concentration of ImM and the cells allowed to grow for an additional 2 hrs. The IPTG induces the expression of T7 polymerase and the subsequent transcription and translation of the IGF muteins.
- Approximately 0.1 OD unit of the cells were lysed in
- E. coli cells expressing the IGF-1 C3 mutein were suspended in Buffer A (50 mM Tris, pH 7.5, 20 mM NaCI and 1 mM dithiothreitol (DTT) at a concentration of 40 ml Buffer A to 10 g cell paste, and disrupted at 1800 psi using a French pressure cell (SLM Instruments, Inc., Urbana IL). The suspension was centrifuged at 20,000 X g for 30 min, and aiiquots of the pellet and supernatant analyzed by SDS-PAGE. A major band corresponding to the IGF-1 C3 mutein was present in the pellet, but not the supernatant.
- Buffer A 50 mM Tris, pH 7.5, 20 mM NaCI and 1 mM dithiothreitol (DTT) at a concentration of 40 ml Buffer A to 10 g cell paste, and disrupted at 1800 psi using a French pressure cell (SLM
- the pellet was suspended in Buffer A at a concentration of 40 ml Buffer A to 10 g cell paste, and re-centrifuged at 20,000 X g for 30 min. This wash procedure was repeated 2 times.
- the final pellet containing the IGF-1 C3 mutein was suspended in 6 M guanidine, 50 mM Tris, pH 7.5, 6 mM DTT at a concentration of 25 ml to 10 g cells using a ground glass homogenizer. The suspension was incubated at room temperature for 15 min. The undissolved protein was removed by centrifugation at 20,000 X g for 30 min. The final concentration of the C3 mutein was 1.0 mg/ml. SDS-PAGE analysis of the pellet and supernatant following the procedure of Example 2 showed that IGF-1 C3 mutein was present in the supernatant only.
- the denatured and reduced IGF-1 mutein was subjected to the following three-step refolding procedure:
- Oxidized glutathione the mixed-disulfide producing reagent (GSSG) was added to the supernatant to a final concentration of 25 mM, and incubated at room temperature for 15 min.
- Aiiquots (50ul) of the supernatant were diluted to 200ul with Buffer B (0.05% TFA), injected onto a reverse phase column (RP-4, 1 x 250mm, Synchrom, Lafayette, IN), and eluted with 80% acetonitrile, 0.042 % TFA (Buffer C) using a linear gradient (increase of 2% Buffer C/min) at a flow rate of 0.25 ml/min.
- N-terminal sequence analysis of IGF- 1 C3 mutein eluting at 26.6 min gave the sequence: M G P C T L C (SEQ ID NO. 29) confirming that a cysteine residue has been substituted for glutamic acid in the 3 position of the N-terminal sequence of natural human IGF-1. An extra methionine residue is present at the N-terminus of the recombinant protein expressed by E coli.
- N-terminal sequence analysis of IGF-1 C2 mutein eluting at 26.0 min gave the sequence: G C E T L C (SEQ ID NO.
- the earlier eluting peak observed in the WT refold has been shown to be an isomeric form of IGF-I with S-S assignments C6-C47, C48- C52, and C18-C61; whereas the later eluting peak is correctly refolded with S-S assignments C6-C48, C47-C52, C18-C61 (See, Raschdorf et al., Biomedical & Environmental Mass Spectroscopy. Vol. 16, pp.3-8 (1988), specifically incorporated herein by reference).
- the retention time of the refolded muteins shifted to 27 min after being completely reduced and denatured in 5 M guanidine, 50 mM Tris pH 7.5, 100 mM DTT. This demonstrates that the refolded forms "collapse" to a single polypeptide after reduction of disulfides.
- the RP4 peaks therefore, represent distinct forms of IGF muteins with different disulfide bonds.
- EXAMPLE 4 Isolation of Refolded IGF-1 Mutein
- Refold mixtures (435 ml) prepared from 20g of E. coli paste containing either the refolded C3 or C2 mutein of Example 3 were concentrated to 100ml, acidified to pH 5.5 with 5M HCl, dialyzed against 20 mM sodium acetate, pH 5.5, and loaded onto an S- Sepharose (Pharmacia/LKB, Piscataway, NJ) column (1.6 X 15 cm) previously equilibrated with the sodium acetate buffer described above. The bound protein was eluted with a 300 ml linear gradient from 0 to 0.5M NaCI. Three ml fractions were collected.
- the C12 & C15 monomer fractions from Superdex 75 also contained significant amounts of apparently mis-folded material eluting after PH (21.5 - 23.0 min).
- the Cll, C15 and C16 monomer fractions contained multiple (3-6) peaks when analyzed by RP-4. The monomer peaks were collected separately and assayed for bioactivity and subjected to mass analysis (see below).
- the masses of the reduced muteins match, within experimental error, the expected masses for a polypeptide with the indicated cysteine mutation.
- the masses of the refolded monomers match the expected mass of polypeptides having 3 intramolecular disulfide bonds and a single mixed disulfide of either cysteine - glutathione (Cys-S-S-Glutathione) or cysteine - cysteine (Cys-S-S-Cys).
- the mixed disulfides form during refolding and remain intact because there is no other cysteine residue present in the molecule available to form an intramolecular disulfide.
- Buffer B Aiiquots (50 ul) of each peak were analyzed by reverse phase (RP-4, 1 X 250 mm). Fractions containing predominantly correctly refolded (determined from RP-4 analysis) C69, eluting at ⁇ 32-38 % Buffer B were pooled. Reverse phase analysis showed the correctly refolded C69 pool was 95 % or more homogeneous. This material was assayed for bioactivity (see below).
- the C3, C2 and C69 muteins were covalently joined to an 8.5 kDa polyethylene glycol (8.5 kDa PEG) or an 20 kDa polyethylene glycol (20 kDa PEG) having a maleimide activating group in a two step process: 1)
- the purified IGF-1 muteins were partially reduced with DTT in a 15 ml reaction mixture containing 2.3 mg (296 nmoles) IGF-1 mutein, 170 ug DTT (1110 nmoles) in 14 mM sodium acetate, 33 mM sodium phosphate, pH 7.0.
- the final concentration of protein was 10 ug/ml, and the molar ratio of DTT:protein was 3.75: 1.
- 91ug DTT (592 nmoles) was used and the molar ratio of DTT:protein was 2:1.
- the reaction mixture was incubated at room temperature for 3 hours (5 hours for reaction with the C69 mutein) and terminated by the addition of 1.0 ml of IM sodium acetate, pH 5.5.
- the reaction mixture was dialyzed at 4°C overnight against 20 mM sodium acetate pH 5.5.
- the partially reduced IGF-1 mutein was reacted with either the 8.5 kDa PEG or the 20 kDa PEG in a 20 ml reaction mixture containing 2.3 mg (296 nmoles) of protein, 9.985 mg (1174 nmoles) 8.5 kDa PEG in 15 mM sodium acetate, 26 mM sodium phosphate, pH 7.0.
- the final concentration of protein was 112 mg/1.
- the molar ratio of 8.5 kDa PEG: protein was 4:1; for reaction with the C69 mutein the molar ratio of 20kDa PEG: protein was 4:1.
- the reaction mixture was incubated at room temperature for 3 hours, and terminated by placing at 4oC or freezing at -20°C. SDS-PAGE analysis of the reaction mixture following the procedure of Example 2 showed that approximately 50% of the partially reduced PEGylated C2 and C3 mutein was converted to a mono-PEGylated species.
- the C3 and C2 20kDa-PEG conjugates migrated at a relative molecular weight of approximately 60kDa on SDS PAGE;
- the C3 and C2 8.5kDa-Peg conjugates migrated at a relative molecular weight of about 23 kDa on SDS PAGE.
- Approximately 20% of the partially reduced PEGylated C69 mutein was converted to a mono-PEGylated species migrating at a relative molecular weight of 67 kDa on SDS PAGE.
- the pegylated C2 or C3 mutein reaction mixtures (containing approximately 100-200 mg protein) were dialyzed extensively at 4°C against 5 mM citric acid, pH 2.6.
- the pegylated mutein was separated from the unPEGylated mutein using an S-Sepharose
- the C69-PEG was separated from the unpegylated C69 mutein by Q-Sepharose anion exchange chromatography .
- 100 ml of the reaction mixture containing 11 mg of total protein was loaded onto a Q-Sepharose anion exchange column column (Pharmacia/LKB, Piscataway, NJ) column (2.6 X 100 cm) previously equilibrated with 20mM Tris, pH 9.0 (buffer A).
- the bound protein was eluted with a linear gradient of 20mM tris Ph 9.0, IM
- IGF-BP1 insulin-like growth factor binding protein 1
- the relative mitogenic (growth stimulating) activities of the C3 and C2 muteins and pegylated C3 and C2 muteins were compared to that of wild type IGF-1 by measuring the relative amount of 3 H-thymidine incorporated into rat osteosarcoma cells when varying amounts of the proteins were present under serum free conditions.
- the rat osteosarcoma cells (the UMR106 cell line; obtained from American Type Culture Collection, Accession No.
- CRL-1661 Rockville, Maryland
- CRL-1661 Rockville, Maryland
- X 104 cells were plated at 5-6 X 104 cells in 0.5 ml of Ham's F12 Media (Mediatech, Herndon, VA) containing 7% fetal bovine serum, 100 U/ml penicillin and 100 ⁇ g/ml streptomycin and 2 mM L-glutamine per well in 48-well tissue culture plates (Costar, Cambridge, MA). After incubating for 72 hours at 37°C when the cells were confluent, the cells were washed twice with phosphate buffered saline (PBS) and pre-incubated in serum-free Ham's F12 medium containing 100 U/ml penicillin and 100 mg/ml streptomycin and 2 mM L-glutamine for 24 hours.
- PBS phosphate buffered saline
- 3H-thymidine was quantitated by liquid scintillation counting. All assays were performed in triplicate.
- the C3 and C2 muteins and pegylated C3 and C2 muteins were found to stimulate the same maximal level of 3H-thymidine incorporation into DNA as recombinant IGF-1.
- the potencies of the C3 and C2 muteins and the pegylated C3 and C2 muteins were about
- ED50 dose required for half maximal activity
- recombinant IGF-1 was 5-10 ng/ml compared with 30-40 ng/ml for unpegylated C3 and C2 muteins, and the pegylated C3 and C2 muteins.
- Peaks H of the C12, C16, C55, C67 and C69 mutein monomers was not significantly different from the mitogenic activity of correctly refolded WT rIGF-I (Peak H).
- the ED 50 of wild type rIGF-I was 4-6 ng/ml compared with 5-8 ng/ml for these unPEGylated mutein monomers.
- Table 5 shows that Peaks I of the various muteins had lower (5-30 fold) bioactivity than correctly refolded WT rIGF-I similar to the bioactivity of WT rIGF-I peak I.
- the C69-PEG conjugate, synthesized from peak H of C69 had the same bioactivity as C69 peak H and correctly refolded WT rIGF-I.
- IGF-1 by measuring the ability of IGF-BPl to inhibit the mitogenic activities of the proteins on rat osteosarcoma cells.
- the rat UMR106 osteosarcoma cells were plated at 5-6 X 104 cells in 0.5 ml of Ham's F12 containing 7% fetal bovine serum, 100 U/ml penicillin and 100 mg/ml streptomycin and 2 mM L-glutamine per well in 48-well tissue culture plates.
- the cells were washed twice with PBS and pre-incubated in serum-free Ham's F12 medium containing 100 U/ml penicillin, 100 mg/ml streptomycin and 2 mM L-glutamine for 24 hours. After the pre-incubation, 0.5 ml of F12 serum-free medium containing either 50 ng/ml or 200ng/ml of rIGF-1, C3 or C2 mutein, or pegylated C3 or C2 mutein were incubated separately with varying amounts of IGF-BPl (100 ng/ml - 1 X 104 ng/ml) for an additional 20-24 hours.
- IGF-BPl 100 ng/ml - 1 X 104 ng/ml
- the mitogenic activity of rIGF-1 50 ng/ml was reduced 80%; however, the mitogenic activities of the same concentrations of the unpegylated C3 mutein and pegylated C3 mutein were reduced 35% and 0%, respectively.
- pegylated C3 mutein has greatly reduced affinity for IGFBPl when compared to IGF-1.
- the mitogemc activity of the pegylated C3 mutein will not be inhibited by IGF binding proteins under conditions where the mitogemc activity of IGF-1 will be inhibited.
- the affinity of pegylated C2 and C69 muteins for IGFBPl is the same as the affinity of wild type IGF-1.
- the mitogemc activity of pegylated C2 and C69 muteins will be inhibited by IGF binding proteins under the same conditions where the mitogenic activity of IGF-1 will be inhibited.
- EXAMPLE 8 Animal Tests Animal studies were performed to compare the pharmacodynamic properties of the muteins and PEG conjugates of the present invention to the pharmacodynamic properties of wild type IGF- 1.
- the rats were maintained in cages with lighting controlled over a 12 h-light/12 h-dark cycle.
- the animals had continuous access to water and food. Five animals were housed per cage. The weights of the rats were monitored daily and only rats with weight gains of less than 2 grams per week during the 2-3 weeks after arrival were considered to be successivefully hypophysectomized and used for the experiments.
- mice (10 Hypox rats per group) were injected every third day (ETD) subcutaneously (sc) with WT rIGF-I (160 mg, 320mg), unpegylated C2 (320mg), unpegylated C3 (320mg), pegylated C2 0(C2-PEG, 320mg) or Pegylated C3 (C3- PEG,320mg) dissolved in 0.2 ml of binding buffer (0.1 M HEPES-0.05 M NaH 2 PO 4 ).
- a separate group of 10 animals received 0.2ml vehicle. Injections were given between 0700 hours and 0800 hours and body weights were recorded daily between 1600 h and 1700 h. The weights of rats on the day after the last injection were taken as the final weight.
- mice (9 Hypox rats per group) were injected every third day sub- cutaneously with WT rIGF-I (320mg, single injection daily, SID; 320mg ETD; 640mg ETD), or C3-PEG (320mg ETD, 640mg ETD, 960mg ETD). dissolved in 0.2 ml of binding buffer (0.1 M HEPES-0.05 M NaH 2 PO 4 ). A separate group of 9 animals received 0.2ml vehicle. Injections were given between 0700 h and 0800 h and body weight were recorded daily between 1600 h and 1700 h. The weights of rats on the day after the last injection were taken as the final weight.
- WT rIGF-I 320mg, single injection daily, SID; 320mg ETD; 640mg ETD
- C3-PEG 320mg ETD, 640mg ETD, 960mg ETD
- mice (10 Hypox rats) were injected every third day sub- cutaneously with C3-PEG (160mg ETD, 320mg ETD), dissolved in 0.2 ml vehicle (0.1 M HEPES-0.05 M NaH 2 PO 4 ). A separate group of 10 animals received 0.2ml vehicle.
- Injections were given between 0700 h and 0800 h and body weight were recorded daily between 1600-1700 h. The weights of rats on the day after the last injection were taken as the final weight.
- Experiment H demonstrates that C3-PEG administered sc ETD exhibits greater potency than WT IGF-I administered sc ETD. All doses of C3-PEG stimulated greater mean weight gain than animals given 320mg WT IGF-I SID. The enhanced pharmacodynamics of C3-PEG make it more potent than WT IGF-I in the animal model described.
- Experiment HI Rats treated with sc injections of C3-PEG 160 mg and 320 mg gained 8.3g ⁇ 0.7g and 9.0g ⁇ 0.6g, respectively (Table 4). Vehicle gained 4.2g + 0.3g. The weight gained induced by C3-PEG was statistically greater than animals given vehicle. Similarly, the tibial epiphyseal widths of rats receiving C3-PEG were statistically greater than rats receiving vehicle (Table 8).
- Experiment HI demonstrates that C3-PEG stimulates not only weight gain, but also bone growth in HYPOX rats. This indicates that C3-PEG may be a useful pharmaceutical for the induction of bone formation.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Diabetes (AREA)
- Zoology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Endocrinology (AREA)
- Toxicology (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP7530514A JPH10500693A (ja) | 1994-05-24 | 1995-05-24 | 改変型インスリン様増殖因子 |
EP95920629A EP0756494A1 (fr) | 1994-05-24 | 1995-05-24 | Facteurs de croissance proches de l'insuline modifies |
AU26018/95A AU2601895A (en) | 1994-05-24 | 1995-05-24 | Modified insulin-like growth factors |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US24827394A | 1994-05-24 | 1994-05-24 | |
US08/248,273 | 1994-05-24 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO1995032003A1 true WO1995032003A1 (fr) | 1995-11-30 |
Family
ID=22938406
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US1995/006540 WO1995032003A1 (fr) | 1994-05-24 | 1995-05-24 | Facteurs de croissance proches de l'insuline modifies |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP0756494A1 (fr) |
JP (1) | JPH10500693A (fr) |
AU (1) | AU2601895A (fr) |
CA (1) | CA2190752A1 (fr) |
WO (1) | WO1995032003A1 (fr) |
Cited By (35)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000042175A1 (fr) * | 1999-01-14 | 2000-07-20 | Bolder Biotechnology Inc. | Techniques permettant de produire des proteines contenant des residus cysteine libres |
WO2001087925A2 (fr) * | 2000-05-16 | 2001-11-22 | Bolder Biotechnology, Inc. | Procede de repliement de proteines renfermant des residus de cysteine libre |
EP1172372A1 (fr) * | 1999-04-02 | 2002-01-16 | Ajinomoto Co., Inc. | Procede de production de sous-unite de peptide issue d'une proteine de polymere |
US6458355B1 (en) | 1998-01-22 | 2002-10-01 | Genentech, Inc. | Methods of treating inflammatory disease with anti-IL-8 antibody fragment-polymer conjugates |
US6468532B1 (en) | 1998-01-22 | 2002-10-22 | Genentech, Inc. | Methods of treating inflammatory diseases with anti-IL-8 antibody fragment-polymer conjugates |
US6608183B1 (en) | 1997-07-14 | 2003-08-19 | Bolder Biotechnology, Inc. | Derivatives of growth hormone and related proteins |
US6753165B1 (en) | 1999-01-14 | 2004-06-22 | Bolder Biotechnology, Inc. | Methods for making proteins containing free cysteine residues |
US6870033B1 (en) | 1997-02-21 | 2005-03-22 | Genentech, Inc. | Antibody fragment-polymer conjugates and humanized anti-IL-8 monoclonal antibodies |
US7005504B2 (en) | 1998-01-22 | 2006-02-28 | Genentech, Inc. | Antibody fragment-peg conjugates |
EP1674113A1 (fr) * | 2004-12-22 | 2006-06-28 | F. Hoffmann-La Roche Ag | Conjugués de l'IGF-1 et du poly(éthylène glycol) |
US7090835B2 (en) | 1994-10-12 | 2006-08-15 | Amgen, Inc. | N-terminally chemically modified protein compositions and methods |
US7141545B2 (en) | 1998-04-03 | 2006-11-28 | Novartis Vaccines And Diagnostics, Inc. | Compositions and methods for treating articular cartilage disorders |
US7153943B2 (en) | 1997-07-14 | 2006-12-26 | Bolder Biotechnology, Inc. | Derivatives of growth hormone and related proteins, and methods of use thereof |
US7214776B2 (en) | 1999-01-21 | 2007-05-08 | Genentech, Inc. | Antibody fragment-polymer conjugates and uses of same |
US7270809B2 (en) | 1997-07-14 | 2007-09-18 | Bolder Biotechnology, Inc. | Cysteine variants of alpha interferon-2 |
US7495087B2 (en) | 1997-07-14 | 2009-02-24 | Bolder Biotechnology, Inc. | Cysteine muteins in the C-D loop of human interleukin-11 |
WO2009051844A1 (fr) | 2007-10-17 | 2009-04-23 | Neuren Pharmaceuticals Limited | Analogues synthétiques de peptides de régénération neurale |
WO2009121759A2 (fr) * | 2008-04-03 | 2009-10-08 | F. Hoffmann-La Roche Ag | Utilisation de variants de igf-i pegylés pour traiter des troubles neuromusculaires |
US7625996B2 (en) | 2006-08-31 | 2009-12-01 | Hoffmann-La Roche Inc. | Method for the production of conjugates of insulin-like growth factor-1 and poly(ethylene glycol) |
WO2011098400A1 (fr) * | 2010-02-11 | 2011-08-18 | F. Hoffmann-La Roche Ag | Conjugués de l'igf-i et du poly(éthylène glycol) |
EP2382982A2 (fr) | 2001-08-24 | 2011-11-02 | Neuren Pharmaceuticals Limited | Peptides de régéneration neurale et procédés d'utilisation de ces derniers dans le traitement des lesions cerebrales |
US8129330B2 (en) | 2002-09-30 | 2012-03-06 | Mountain View Pharmaceuticals, Inc. | Polymer conjugates with decreased antigenicity, methods of preparation and uses thereof |
WO2012102832A1 (fr) | 2011-01-27 | 2012-08-02 | Neuren Pharmaceuticals Limited | Traitement de troubles du spectre autistique en utilisant l'acide glycyl-l-2-méthylprolyl-l-glutamique |
US8293708B2 (en) | 2005-08-30 | 2012-10-23 | Novo Nordisk Health Care A/G | Liquid formulations N-terminal serine of pegylated growth hormone |
US8329866B2 (en) | 2005-10-03 | 2012-12-11 | Bolder Biotechnology, Inc. | Long acting VEGF inhibitors and methods of use |
US8343918B2 (en) | 2006-06-09 | 2013-01-01 | Novartis Ag | Stabilized insulin-like growth factor polypeptides |
US8552158B2 (en) | 2006-08-31 | 2013-10-08 | Hoffmann-La Roche Inc. | Method for the production of insulin-like growth factor-1 |
US8617531B2 (en) | 2006-12-14 | 2013-12-31 | Bolder Biotechnology, Inc. | Methods of making proteins and peptides containing a single free cysteine |
US8859497B2 (en) | 1997-07-14 | 2014-10-14 | Bolder Biotechnology, Inc. | Method of treatment using cysteine mutants of beta interferon |
US8957023B2 (en) | 1999-01-14 | 2015-02-17 | Bolder Biotechnology Inc. | Methods for making proteins containing free cysteine residues |
US9125880B2 (en) | 2002-12-26 | 2015-09-08 | Mountain View Pharmaceuticals, Inc. | Polymer conjugates of interferon-beta with enhanced biological potency |
US9175061B2 (en) | 2006-07-07 | 2015-11-03 | Novo Nordisk Health Care Ag | Protein conjugates and methods for their preparation |
US9718892B2 (en) | 2010-05-21 | 2017-08-01 | Merrimack Pharmaceuticals, Inc. | Method of treating myocardial infarction by administering a bi-specific fusion protein |
US10040840B2 (en) | 2015-10-02 | 2018-08-07 | Silver Creek Pharmaceuticals, Inc. | Bi-specific annexin A5/IGF-1 proteins and methods of use thereof to promote regeneration and survival of tissue |
WO2020206375A1 (fr) * | 2019-04-03 | 2020-10-08 | Technical University Of Denmark | Conjugués de protéine de facteur neurotrophique et modes de réalisation associés |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1990012874A2 (fr) * | 1989-04-21 | 1990-11-01 | Genetics Institute, Inc. | Variantes de polypeptides par addition de cysteine, et leurs modifications chimiques |
WO1992016221A1 (fr) * | 1991-03-15 | 1992-10-01 | Synergen, Inc. | Pegylation de polypeptides |
WO1994012219A2 (fr) * | 1992-11-25 | 1994-06-09 | Amgen Boulder Inc. | Facteur de croissance insulinoide modifie |
WO1994022466A1 (fr) * | 1993-04-07 | 1994-10-13 | Synergen, Inc. | Procedes d'utilisation de proteines de liaison de facteurs de croissance semblables a l'insuline |
-
1995
- 1995-05-24 AU AU26018/95A patent/AU2601895A/en not_active Abandoned
- 1995-05-24 EP EP95920629A patent/EP0756494A1/fr not_active Withdrawn
- 1995-05-24 WO PCT/US1995/006540 patent/WO1995032003A1/fr not_active Application Discontinuation
- 1995-05-24 CA CA002190752A patent/CA2190752A1/fr not_active Abandoned
- 1995-05-24 JP JP7530514A patent/JPH10500693A/ja active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1990012874A2 (fr) * | 1989-04-21 | 1990-11-01 | Genetics Institute, Inc. | Variantes de polypeptides par addition de cysteine, et leurs modifications chimiques |
WO1992016221A1 (fr) * | 1991-03-15 | 1992-10-01 | Synergen, Inc. | Pegylation de polypeptides |
WO1994012219A2 (fr) * | 1992-11-25 | 1994-06-09 | Amgen Boulder Inc. | Facteur de croissance insulinoide modifie |
WO1994022466A1 (fr) * | 1993-04-07 | 1994-10-13 | Synergen, Inc. | Procedes d'utilisation de proteines de liaison de facteurs de croissance semblables a l'insuline |
Non-Patent Citations (3)
Title |
---|
GOODSON, ROBERT J. ET AL: "Site-directed PEGylation of recombinant interleukin-2 at its glycosylation site", BIO/TECHNOLOGY (1990), 8(4), 343-6 CODEN: BTCHDA;ISSN: 0733-222X * |
KUAN, CHIEN TSUN ET AL: "Pseudomonas exotoxin A mutants. Replacement of surface exposed residues in domain II with cysteine residues that can be modified with polyethylene glycol in a site-specific manner", J. BIOL. CHEM. (1994), 269(10), 7610-16 CODEN: JBCHA3;ISSN: 0021-9258 * |
TANG, WEI ET AL: "Preparation of a new PEGylation reagent for sulfhydryl-containing polypeptide", TETRAHEDRON LETT. (1994), 35(35), 6515-16 CODEN: TELEAY;ISSN: 0040-4039 * |
Cited By (92)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7090835B2 (en) | 1994-10-12 | 2006-08-15 | Amgen, Inc. | N-terminally chemically modified protein compositions and methods |
US6870033B1 (en) | 1997-02-21 | 2005-03-22 | Genentech, Inc. | Antibody fragment-polymer conjugates and humanized anti-IL-8 monoclonal antibodies |
US8859497B2 (en) | 1997-07-14 | 2014-10-14 | Bolder Biotechnology, Inc. | Method of treatment using cysteine mutants of beta interferon |
US7270809B2 (en) | 1997-07-14 | 2007-09-18 | Bolder Biotechnology, Inc. | Cysteine variants of alpha interferon-2 |
US7345149B2 (en) | 1997-07-14 | 2008-03-18 | Bolder Biotechnology, Inc. | Cysteine substitution variants of beta interferon |
US7345154B2 (en) | 1997-07-14 | 2008-03-18 | Bolder Biotechnology, Inc. | Cysteine variants of erythropoietin |
US10329337B2 (en) | 1997-07-14 | 2019-06-25 | Bolder Biotechnology, Inc. | Method to increase the number of circulating platelets by administering PEGylated cysteine variants of IL-11 |
US6608183B1 (en) | 1997-07-14 | 2003-08-19 | Bolder Biotechnology, Inc. | Derivatives of growth hormone and related proteins |
US9637530B2 (en) | 1997-07-14 | 2017-05-02 | Bolder Biotechnology, Inc. | Methods of preparing cysteine variants of human recombinant IL-11 |
US8748392B2 (en) | 1997-07-14 | 2014-06-10 | Bolder Biotechnology Inc. | Methods of treatment using cysteine variants of interleukin-11 |
US7314921B2 (en) | 1997-07-14 | 2008-01-01 | Bolder Biotechnology, Inc. | Cysteine variants of erythropoietin |
US8618256B2 (en) | 1997-07-14 | 2013-12-31 | Bolder Biotechnology | Cysteine variants of interferon gamma |
US8148500B2 (en) | 1997-07-14 | 2012-04-03 | Bolder Biotechnology, Inc. | Method of preparing cysteine mutants of human recombinant GM-CSF |
US7964184B2 (en) | 1997-07-14 | 2011-06-21 | Bolder Biotechnology, Inc. | Cysteine variants of interferon-gamma |
US7309781B2 (en) | 1997-07-14 | 2007-12-18 | Bolder Biotechnology, Inc. | Cysteine variants of granulocyte colony-stimulating factor |
US7148333B2 (en) | 1997-07-14 | 2006-12-12 | Bolder Biotechnology, Inc. | Cysteine variants of granulocyte-macrophage colony-stimulating factor |
US7153943B2 (en) | 1997-07-14 | 2006-12-26 | Bolder Biotechnology, Inc. | Derivatives of growth hormone and related proteins, and methods of use thereof |
US7214779B2 (en) | 1997-07-14 | 2007-05-08 | Bolder Biotechnology Inc. | Termini cysteine-added variants of granulocyte-macrophage colony stimulating factor |
US8133480B2 (en) | 1997-07-14 | 2012-03-13 | Bolder Biotechnology, Inc. | Cysteine variants of interleukin-11 |
US7824669B2 (en) | 1997-07-14 | 2010-11-02 | Bolder Biotechnology, Inc. | In vivo stimulation of peripheral blood progenitor cells by granulocyte-macrophage colony stimulating factor (GM-CSF) cysteine muteins and their PEGylated variants |
US7795396B2 (en) | 1997-07-14 | 2010-09-14 | Bolder Biotechnology, Inc. | COOH-terminally added cysteine variant of the beta interferon |
US7232885B2 (en) | 1997-07-14 | 2007-06-19 | Bolder Biotechnology, Inc. | Termini cysteine-added variants of granulocyte colony stimulating factor |
US7732572B2 (en) | 1997-07-14 | 2010-06-08 | Bolder Biotechnology, Inc. | Cysteine variants of alpha interferon-2 |
US7253267B2 (en) | 1997-07-14 | 2007-08-07 | Bolder Biotechnology Inc. | Cysteine variants of interleukin-11 |
US7495087B2 (en) | 1997-07-14 | 2009-02-24 | Bolder Biotechnology, Inc. | Cysteine muteins in the C-D loop of human interleukin-11 |
US7959909B2 (en) | 1997-07-14 | 2011-06-14 | Bolder Biotechnology, Inc. | Cysteine variants of interferon gamma |
US7560101B2 (en) | 1997-07-14 | 2009-07-14 | Bolder Biotechnology, Inc. | Method of treatment of an infection in an animal with GM-CSF cysteine muteins in the proximal region to helix A |
US7005504B2 (en) | 1998-01-22 | 2006-02-28 | Genentech, Inc. | Antibody fragment-peg conjugates |
US6468532B1 (en) | 1998-01-22 | 2002-10-22 | Genentech, Inc. | Methods of treating inflammatory diseases with anti-IL-8 antibody fragment-polymer conjugates |
US6458355B1 (en) | 1998-01-22 | 2002-10-01 | Genentech, Inc. | Methods of treating inflammatory disease with anti-IL-8 antibody fragment-polymer conjugates |
US7141545B2 (en) | 1998-04-03 | 2006-11-28 | Novartis Vaccines And Diagnostics, Inc. | Compositions and methods for treating articular cartilage disorders |
WO2000042175A1 (fr) * | 1999-01-14 | 2000-07-20 | Bolder Biotechnology Inc. | Techniques permettant de produire des proteines contenant des residus cysteine libres |
US8957023B2 (en) | 1999-01-14 | 2015-02-17 | Bolder Biotechnology Inc. | Methods for making proteins containing free cysteine residues |
US7399839B2 (en) | 1999-01-14 | 2008-07-15 | Bolder Biotechnology, Inc. | Monopegylated growth hormone proteins |
KR100731826B1 (ko) * | 1999-01-14 | 2007-06-22 | 볼더 바이오테크놀로지 인코퍼레이티드 | 유리 시스테인 잔기를 함유하는 단백질의 제조 방법 |
US20160244798A1 (en) * | 1999-01-14 | 2016-08-25 | Bolder Biotechnology, Inc. | Methods for making proteins containing free cysteine residues |
US7629314B2 (en) | 1999-01-14 | 2009-12-08 | Bolder Biotechnology, Inc. | Methods for making proteins containing free cysteine residues |
US6753165B1 (en) | 1999-01-14 | 2004-06-22 | Bolder Biotechnology, Inc. | Methods for making proteins containing free cysteine residues |
US7842789B2 (en) | 1999-01-21 | 2010-11-30 | Genentech, Inc. | Antibody fragment-polymer conjugates and uses of same |
US8652468B2 (en) | 1999-01-21 | 2014-02-18 | Genentech, Inc. | Methods of binding TNF-α using anti-TNF-α antibody fragment-polymer conjugates |
US8147830B2 (en) | 1999-01-21 | 2012-04-03 | Genentech, Inc. | Antibody fragment-polymer conjugates and uses of same |
US7214776B2 (en) | 1999-01-21 | 2007-05-08 | Genentech, Inc. | Antibody fragment-polymer conjugates and uses of same |
US7507405B2 (en) | 1999-01-21 | 2009-03-24 | Genentech, Inc. | Antibody fragment-polymer conjugates and uses of same |
EP1172372A1 (fr) * | 1999-04-02 | 2002-01-16 | Ajinomoto Co., Inc. | Procede de production de sous-unite de peptide issue d'une proteine de polymere |
EP1172372A4 (fr) * | 1999-04-02 | 2003-05-14 | Ajinomoto Kk | Procede de production de sous-unite de peptide issue d'une proteine de polymere |
US7270972B1 (en) | 1999-04-02 | 2007-09-18 | Ajinomoto Co., Inc. | Process for producing subunit peptide originating in polymer protein |
JP4670150B2 (ja) * | 1999-04-02 | 2011-04-13 | 味の素株式会社 | 多量体蛋白質に由来するサブユニットペプチドの製造法 |
US7306931B2 (en) | 2000-05-16 | 2007-12-11 | Bolder Biotechnology, Inc. | Method for refolding proteins containing free cysteine residues |
WO2001087925A3 (fr) * | 2000-05-16 | 2002-08-01 | Bolder Biotechnology Inc | Procede de repliement de proteines renfermant des residus de cysteine libre |
WO2001087925A2 (fr) * | 2000-05-16 | 2001-11-22 | Bolder Biotechnology, Inc. | Procede de repliement de proteines renfermant des residus de cysteine libre |
US8932828B2 (en) | 2000-05-16 | 2015-01-13 | Bolder Biotechnology, Inc. | Method for preparing recombinant granulocyte colony stimulating factor cysteine muteins |
CN1318443C (zh) * | 2000-05-16 | 2007-05-30 | 博尔德生物技术公司 | 含游离半胱氨酸残基的蛋白重折叠的方法 |
EP2382982A2 (fr) | 2001-08-24 | 2011-11-02 | Neuren Pharmaceuticals Limited | Peptides de régéneration neurale et procédés d'utilisation de ces derniers dans le traitement des lesions cerebrales |
US8129330B2 (en) | 2002-09-30 | 2012-03-06 | Mountain View Pharmaceuticals, Inc. | Polymer conjugates with decreased antigenicity, methods of preparation and uses thereof |
US9125880B2 (en) | 2002-12-26 | 2015-09-08 | Mountain View Pharmaceuticals, Inc. | Polymer conjugates of interferon-beta with enhanced biological potency |
WO2006066891A3 (fr) * | 2004-12-22 | 2007-05-31 | Hoffmann La Roche | Conjugues du facteur de croissance 1 analogue a l'insuline et du poly(ethylene glycol) |
KR101106860B1 (ko) * | 2004-12-22 | 2012-01-19 | 에프. 호프만-라 로슈 아게 | 인슐린-유사 성장 인자-1(igf-1) 및 폴리(에틸렌 글라이콜)의 접합체 |
US20150099699A1 (en) * | 2004-12-22 | 2015-04-09 | Hoffmann-La Roche Inc. | Conjugates of insulin-like growth factor-1 and poly(ethylene glycol) |
WO2006066891A2 (fr) * | 2004-12-22 | 2006-06-29 | F. Hoffmann-La Roche Ag | Conjugues du facteur de croissance 1 analogue a l'insuline et du poly(ethylene glycol) |
US9724425B2 (en) | 2004-12-22 | 2017-08-08 | Hoffmann-La Roche Inc. | Conjugates of insulin-like growth factor-1 and poly(ethylene glycol) |
KR100915278B1 (ko) * | 2004-12-22 | 2009-09-03 | 에프. 호프만-라 로슈 아게 | 인슐린-유사 성장 인자-1(igf-1) 및 폴리(에틸렌글라이콜)의 접합체 |
EP1674113A1 (fr) * | 2004-12-22 | 2006-06-28 | F. Hoffmann-La Roche Ag | Conjugués de l'IGF-1 et du poly(éthylène glycol) |
EA011284B1 (ru) * | 2004-12-22 | 2009-02-27 | Ф.Хоффманн-Ля Рош Аг | Конъюгаты инсулиноподобного фактора роста i (ифр-i) и полиэтиленгликоля |
US8293708B2 (en) | 2005-08-30 | 2012-10-23 | Novo Nordisk Health Care A/G | Liquid formulations N-terminal serine of pegylated growth hormone |
US8329866B2 (en) | 2005-10-03 | 2012-12-11 | Bolder Biotechnology, Inc. | Long acting VEGF inhibitors and methods of use |
US8343918B2 (en) | 2006-06-09 | 2013-01-01 | Novartis Ag | Stabilized insulin-like growth factor polypeptides |
US8722621B2 (en) | 2006-06-09 | 2014-05-13 | Novartis Ag | Stabilized insulin-like growth factor polypeptides |
US9175061B2 (en) | 2006-07-07 | 2015-11-03 | Novo Nordisk Health Care Ag | Protein conjugates and methods for their preparation |
US8476232B2 (en) | 2006-08-31 | 2013-07-02 | Hoffman-La Roche Inc. | Method for the production of conjugates of insulin-like growth factor-1 and poly(ethylene glycol) |
US8552158B2 (en) | 2006-08-31 | 2013-10-08 | Hoffmann-La Roche Inc. | Method for the production of insulin-like growth factor-1 |
US7625996B2 (en) | 2006-08-31 | 2009-12-01 | Hoffmann-La Roche Inc. | Method for the production of conjugates of insulin-like growth factor-1 and poly(ethylene glycol) |
US8617531B2 (en) | 2006-12-14 | 2013-12-31 | Bolder Biotechnology, Inc. | Methods of making proteins and peptides containing a single free cysteine |
US10508131B2 (en) | 2006-12-14 | 2019-12-17 | Bolder Biotechnology, Inc. | Cysteine analogs of exendin-4 |
US9296804B2 (en) | 2006-12-14 | 2016-03-29 | Bolder Biotechnology, Inc. | NH2-terminal glutamine modified cysteine variants of interferon gamma |
WO2009051844A1 (fr) | 2007-10-17 | 2009-04-23 | Neuren Pharmaceuticals Limited | Analogues synthétiques de peptides de régénération neurale |
WO2009121759A3 (fr) * | 2008-04-03 | 2010-03-25 | F. Hoffmann-La Roche Ag | Utilisation de variants de igf-i pegylés pour traiter des troubles neuromusculaires |
WO2009121759A2 (fr) * | 2008-04-03 | 2009-10-08 | F. Hoffmann-La Roche Ag | Utilisation de variants de igf-i pegylés pour traiter des troubles neuromusculaires |
WO2011098400A1 (fr) * | 2010-02-11 | 2011-08-18 | F. Hoffmann-La Roche Ag | Conjugués de l'igf-i et du poly(éthylène glycol) |
US9587006B2 (en) | 2010-02-11 | 2017-03-07 | Hoffmann-La Roche Inc. | IGF-I poly (ethylene glycol) conjugates |
CN102740896A (zh) * | 2010-02-11 | 2012-10-17 | 霍夫曼-拉罗奇有限公司 | Igf-i聚乙二醇缀合物 |
US20120309679A1 (en) * | 2010-02-11 | 2012-12-06 | Friederike Hesse | Igf-i poly (ethylene glycol) conjugates |
KR101485646B1 (ko) | 2010-02-11 | 2015-01-22 | 에프. 호프만-라 로슈 아게 | Igf―ⅰ 폴리(에틸렌 글리콜) 컨쥬게이트 |
US10407512B2 (en) | 2010-05-21 | 2019-09-10 | Silver Creek Pharmaceuticals, Inc. | Bi-specific fusion proteins |
US9718892B2 (en) | 2010-05-21 | 2017-08-01 | Merrimack Pharmaceuticals, Inc. | Method of treating myocardial infarction by administering a bi-specific fusion protein |
US10988547B2 (en) | 2010-05-21 | 2021-04-27 | Silver Creek Pharmaceuticals, Inc. | Bi-specific fusion proteins |
US11814443B2 (en) | 2010-05-21 | 2023-11-14 | Silver Creek Pharmaceuticals, Inc. | Bi-specific fusion proteins |
WO2012102832A1 (fr) | 2011-01-27 | 2012-08-02 | Neuren Pharmaceuticals Limited | Traitement de troubles du spectre autistique en utilisant l'acide glycyl-l-2-méthylprolyl-l-glutamique |
US10040840B2 (en) | 2015-10-02 | 2018-08-07 | Silver Creek Pharmaceuticals, Inc. | Bi-specific annexin A5/IGF-1 proteins and methods of use thereof to promote regeneration and survival of tissue |
US10633425B2 (en) | 2015-10-02 | 2020-04-28 | Silver Creek Pharmaceuticals, Inc. | Method of protecting tissue from damage by administering a bi-specific therapeutic protein comprising insulin-like growth factor 1 (IGF-1) and Annexin A5 |
US11155593B2 (en) | 2015-10-02 | 2021-10-26 | Silver Creek Pharmaceuticals, Inc. | Method of inhibiting apoptosis or promoting cell survival by providing a bi-specific protein comprising insulin-like growth factor IGF-1 and Annexin A5 |
US11879002B2 (en) | 2015-10-02 | 2024-01-23 | Silver Creek Pharmaceuticals, Inc. | Bi-specific therapeutic proteins, in vivo methods of use thereof and encoding nucleic acids thereof |
WO2020206375A1 (fr) * | 2019-04-03 | 2020-10-08 | Technical University Of Denmark | Conjugués de protéine de facteur neurotrophique et modes de réalisation associés |
Also Published As
Publication number | Publication date |
---|---|
CA2190752A1 (fr) | 1995-11-30 |
AU2601895A (en) | 1995-12-18 |
EP0756494A1 (fr) | 1997-02-05 |
JPH10500693A (ja) | 1998-01-20 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO1995032003A1 (fr) | Facteurs de croissance proches de l'insuline modifies | |
EP0679095A1 (fr) | Facteur de croissance insulinoide modifie | |
KR100776862B1 (ko) | 엔 말단 모노피이지화된 인간 성장 호르몬 접합체, 그의제조 방법, 및 그의 사용 방법 | |
JP4854851B2 (ja) | 改善された生物活性と生体適合性のためのタンパク質の部位特異的二重ポリエチレングリコール化 | |
JP4949844B2 (ja) | エリスロポエチン受容体に結合する新規ペプチド | |
US20030054997A1 (en) | OB protein compositions and methods | |
US20070265200A1 (en) | Glycol Linked Fgf-21 Compounds | |
US6703480B1 (en) | Peptide dimers as agonists of the erythropoientin (EPO) receptor, and associated methods of synthesis and use | |
JPH05255392A (ja) | A−c−bプロインスリン、その製造法および使用法、およびインスリン生産の中間体 | |
KR20080038391A (ko) | 페그화 성장 호르몬의 액체 제제 | |
JPH08301899A (ja) | Igf−1スーパーアゴニスト | |
WO1993019084A1 (fr) | Repliement et purification de facteurs de croissance i ressemblant a l'insuline | |
KR19990022716A (ko) | 골 자극 인자 | |
KR20220077590A (ko) | Candida Utilis 유래 요산산화효소-알부민 복합체 및 이의 제조 방법 | |
KR20230106149A (ko) | 성장호르몬 융합 단백질, 이의 제조 방법 및 용도 | |
WO2004005335A2 (fr) | Hormone de croissance multimerisee | |
MXPA06008888A (en) | N-terminally monopegylated human growth hormone conjugates, process for their preparation, and methods of use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A1 Designated state(s): AM AT AU BB BG BR BY CA CH CN CZ DE DK EE ES FI GB GE HU IS JP KE KG KP KR KZ LK LR LT LU LV MD MG MN MW MX NO NZ PL PT RO RU SD SE SG SI SK TJ TM TT UA UG US UZ VN |
|
AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): KE MW SD SZ UG AT BE CH DE DK ES FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN ML MR NE SN TD TG |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 2190752 Country of ref document: CA Ref document number: 1995920629 Country of ref document: EP |
|
WWP | Wipo information: published in national office |
Ref document number: 1995920629 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 1995920629 Country of ref document: EP |