US20170009205A1 - Ex vivo antibody production - Google Patents

Ex vivo antibody production Download PDF

Info

Publication number
US20170009205A1
US20170009205A1 US15/106,991 US201415106991A US2017009205A1 US 20170009205 A1 US20170009205 A1 US 20170009205A1 US 201415106991 A US201415106991 A US 201415106991A US 2017009205 A1 US2017009205 A1 US 2017009205A1
Authority
US
United States
Prior art keywords
rabbit
cell
bcl
nucleic acid
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/106,991
Other languages
English (en)
Inventor
Pauline Maria Wilhelmina VAN HELDEN
Mark Jeroen KWAKKENBOS
Hergen Spits
Tim Beaumont
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
AIMM Therapeutics BV
Original Assignee
AIMM Therapeutics BV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by AIMM Therapeutics BV filed Critical AIMM Therapeutics BV
Assigned to AIMM THERAPEUTICS B.V. reassignment AIMM THERAPEUTICS B.V. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: BEAUMONT, TIM, KWAKKENBOS, Mark Jeroen, SPITS, HERGEN, VAN HELDEN, PAULA MARIA WILHELMINA
Publication of US20170009205A1 publication Critical patent/US20170009205A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0635—B lymphocytes
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • C07K16/1018—Orthomyxoviridae, e.g. influenza virus
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P21/00—Preparation of peptides or proteins
    • C12P21/005—Glycopeptides, glycoproteins
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/10—Immunoglobulins specific features characterized by their source of isolation or production
    • C07K2317/14—Specific host cells or culture conditions, e.g. components, pH or temperature
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells
    • C12N2510/02—Cells for production
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells
    • C12N2510/04—Immortalised cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00—Reverse transcribing RNA viruses
    • C12N2740/00011—Details
    • C12N2740/10011—Retroviridae
    • C12N2740/13011—Gammaretrovirus, e.g. murine leukeamia virus
    • C12N2740/13041—Use of virus, viral particle or viral elements as a vector
    • C12N2740/13045—Special targeting system for viral vectors
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2810/00—Vectors comprising a targeting moiety
    • C12N2810/50—Vectors comprising as targeting moiety peptide derived from defined protein
    • C12N2810/60—Vectors comprising as targeting moiety peptide derived from defined protein from viruses
    • C12N2810/6045—RNA rev transcr viruses
    • C12N2810/6054—Retroviridae

Definitions

  • the invention relates to the fields of medicine, molecular biology and immunology.
  • Monoclonal antibodies represent multiple identical copies of a single antibody molecule, which copies bind to antigens with the same affinity and promote the same effector functions.
  • mAbs Monoclonal antibodies
  • the benefits of mAbs is their specificity for the same epitope on an antigen. This specificity confers certain clinical advantages on mAbs over more conventional treatments while offering patients an effective, well-tolerated therapy option with generally low side effects.
  • mAbs are useful for biological and medical research.
  • hybridoma technology wherein a B cell is fused with a myeloma cell in order to form hybrid antibody producing cell lines (hybridomas).
  • hybridoma technology with human B cells has not been very successful because the resulting hybridomas are unstable.
  • an improved technology has been developed wherein ex vivo B cell cultures are produced with a prolonged replicative life span (WO 2007/067046).
  • This technology involves human ex vivo cultures wherein Bcl-6, together with Blimp-1 and/or an anti-apoptotic nucleic acid, are expressed in the B cells. This improves the replicative life span of these B cells.
  • human B cells are cultured in order to obtain human mAbs.
  • Human mAbs are preferred for therapeutic applications in humans due to the lower immunogenicity as compared to antibodies of other species.
  • ex vivo human B cell cultures with a mean doubling time of about 25-36 hours are obtained.
  • B cell cultures wherein the B cells have a short doubling time.
  • a short doubling time is also very important in therapeutic approaches like cancer therapy, for instance when a non-human mammal is immunized with cancer cells of a patient, where after cancer-specific B cells are harvested from the animal and used for ex vivo antibody production. Since such antibodies are a tailor-made medicine for the individual patient, they should be produced as fast as possible so that the patient can start his/her Ab therapy as soon as possible. Such antibodies that are specific for an individual's tumor cannot be produced beforehand.
  • the present invention provides the insight that B cell cultures with a shorter doubling time, as compared to the B cell cultures disclosed in WO 2007/067046, are obtained when rabbit B cells are used.
  • B cells such as human B cells, murine B cells and llama B cells typically have a doubling time of 25-36 hours
  • the present inventors have surprisingly found that rabbit B cell cultures can be obtained with a doubling time of 20 hours or less. This insight allows significant faster production of antibodies of interest, resulting in a higher yield within a given time frame, which is particularly valuable for commercial antibody production and therapeutic applications.
  • the invention provides a use of a rabbit B cell for obtaining an ex vivo B cell culture with a mean doubling time of 20 hours or less.
  • Ex vivo rabbit B cell cultures according to the present invention are typically obtained by expression of Bcl-6, or a rabbit homologue thereof, and an anti-apoptotic nucleic acid molecule in a rabbit B-cell.
  • a method for obtaining an ex vivo B cell culture with a mean doubling time of 20 hours or less comprising:
  • said B cell is a rabbit B cell.
  • ex vivo rabbit B cell cultures are produced with a mean doubling time of less than 20 hours. More preferably, said mean doubling time is less than 19 hours or even less than 18 hours.
  • a shorter doubling time allows faster and higher antibody production, which enhances the time to—and efficacy of—testing and screening for a desired antibody and isolation and/or identification of antibodies of interest.
  • the shorter doubling time of rabbit B cells allows for a quicker start of the patient's specific mAb therapy.
  • a method according to the present invention using rabbit B cells, thus provides the advantage that antibody can be obtained, tested, identified, isolated and/or produced ex vivo within a shorter time frame as compared to currently known human, murine or llama B cell cultures.
  • the present invention provides a B cell culture with a short doubling time provides the advantage that a sufficient quantity of antibody can be obtained within a shorter period of time as compared to existing methods.
  • a collection of B cells obtained from a human individual is stabilized using Bcl-6 and an anti-apoptotic nucleic acid (or compounds increasing the expression of such nucleic acids) and subsequently cultured.
  • This results in stabilized human B cells which are capable of both proliferating and producing antibody.
  • the stabilized B cells produce antibody, which is secreted into the culture medium. Subsequently, these antibodies are preferably tested for a desired specificity (and/or affinity).
  • an antibody concentration of at least 100 ng/ml culture medium is typically required. After 15-20 days of culturing stabilized human B cells, such minimal antibody concentration is obtained. Therefore, using human B cell cultures, antibody is harvested at least 15-20 days after starting the culture, typically around day 20. Llama B cells have a similar growth rate as human B cells, so that if a llama B cell culture is used, antibody is also typically harvested at least 15-20 days after starting the culture. With murine B cells, which have a longer doubling time, antibodies with a minimal concentration of 100 ng/ml are typically obtained after more than 20 days.
  • the corresponding B cells of interest are often selected and isolated for further use. Given the fact that antibody testing normally takes about three days, human or llama B cells of interested are typically selected and isolated after 18-23 days from the start of the B cell culture, whereas murine B cells of interest are typically selected and isolated after more than 23 days. The isolated B cells are then further cultured. A B cell culture with human, llama or murine B cells of interest is thus typically obtained after about three weeks from the start of the B cell culture. With a method according to the present invention, however, an antibody concentration of at least 100 ng/ml is already obtained after 11-12 days.
  • antibody can now already be harvested 11-12 days after starting the B cell culture, whereas one had to maintain a human (or llama) B cell culture for at least 15-20 days before harvesting antibody.
  • rabbit B cells of interest are thus selected and isolated within 14-15 days from the start of the B cell culture, which is significantly faster as compared to the situation wherein human or murine B cells are cultured.
  • a B cell culture with rabbit B cells producing a sufficient Ab concentration is already obtained after two weeks. This is a major advantage over existing methods.
  • One aspect of the invention therefore provides a method for obtaining antibodies, preferably for use in one or more testing assays requiring a minimal antibody concentration of at least 100 ng/ml, the method comprising:
  • the obtained antibodies are typically used for testing for a desired specificity and/or affinity
  • Current test methods often require a minimal antibody concentration of 100 ng/ml, but if more sensitive detection methods are used, the antibodies can be harvested earlier.
  • the required minimal antibody concentration is obtained earlier as compared to the use of currently known human, llama or murine B cells, due to the significant faster doubling time of rabbit B cells.
  • the term “rabbit B cell” means a B cell that has been obtained from a rabbit, or a B cell that originates from a rabbit B cell.
  • An example of B cells originating from a rabbit B cell is the progeny of a rabbit B cell that is formed after one or more cell division cycles. Such progeny for instance includes an ex vivo culture of rabbit B cells.
  • An ex vivo rabbit B cell culture is a culture that contains rabbit B cells and/or progeny thereof.
  • Other kinds of cells may also be present in the culture.
  • B cell stimulator cells such as CD40 positive L cells and/or EL4B5 cells are typically also present in a B cell culture according to the invention.
  • other kinds of cells which were also present in a B cell-containing sample, could still be present in a B cell culture.
  • non-B cells are typically less capable of proliferating as compared to B cells, so that the number of such contaminating cells will typically decline in time
  • at least 70% of the cells of a rabbit B cell culture are rabbit B cells.
  • rabbit B cells and B cell stimulator cells such as CD40 positive L cells and/or EL4B5 cells are essentially the only kinds of cell present in a rabbit B cell culture.
  • the B cells of a rabbit B cell culture according to the invention are progeny of one original rabbit B cell, so that monoclonal antibodies are produced by the B cell culture.
  • mean doubling time is defined herein as the mean time required, starting from a culture with a certain original amount of B cells, to obtain a culture with a number of B cells that is two times said original B cell number. Since not every B cell will proliferate at exactly the same rate, mean values are typically used for a B cell culture as a whole.
  • Bcl-6 encodes a transcriptional repressor which is required for normal B cell and T cell development and maturation and which is required for the formation of germinal centers.
  • Bcl-6 is highly expressed in germinal center B cells whereas it is hardly expressed in plasma cells.
  • Bcl-6 inhibits differentiation of activated B cells into plasma cells.
  • Bcl-6 expression product, or the expression product of a rabbit homologue thereof remains present in the rabbit B cells of an ex vivo culture. The presence of Bcl-6, or a rabbit homologue thereof, together with the presence of an anti-apoptotic nucleic acid, prolongs the replicative life span of the B cells.
  • Expression of Bcl-6, or a rabbit homologue thereof is preferably induced, enhanced or maintained by administering a Bcl-6 expression-promoting compound, or a compound that promotes expression of a rabbit homologue of Bcl-6, to the rabbit B cell(s) used for culturing, or by culturing rabbit B cells in the presence of such compound.
  • STAT5 Signal Transducer of Activation and Transcription 5
  • STAT5a Signal Transducer of Activation and Transcription 5
  • STAT5b signal transducer capable of enhancing Bcl-6 expression.
  • STAT5a There are two known forms of STAT5, STAT5a and STAT5b, which are encoded by two different, tandemly linked genes.
  • Administration and/or activation of STAT5, or a rabbit homologue thereof results in enhanced levels of Bcl-6, or enhanced levels of a rabbit homologue of Bcl-6.
  • STAT5, or a rabbit homologue thereof, or a functional part or a functional derivative thereof is capable of directly increasing expression of Bcl-6, or expression of a rabbit homologue of Bcl-6.
  • a method according to the invention comprising providing said rabbit B cell with STAT5, or with a rabbit homologue thereof, or with a functional part or a functional derivative thereof, or providing said rabbit B cell with a nucleic acid molecule encoding STAT5, or a rabbit homologue thereof, or a functional part or a functional derivative thereof, or culturing said rabbit B cell in the presence of STAT5, or in the presence of a rabbit homologue thereof, or a functional part or a functional derivative thereof.
  • the presence of STAT5, or a rabbit homologue thereof directly increases the amount of Bcl-6, or the amount of a rabbit homologue of Bcl-6. It is also possible to indirectly increase expression of Bcl-6, or expression of a rabbit homologue thereof. This is for instance done by regulating the amount of a certain compound, which in turn is capable of directly or indirectly activating STAT5, or a rabbit homologue thereof, and/or increasing expression of STAT5, or expression of a rabbit homologue thereof. Hence, in one embodiment the expression and/or activity of endogenous and/or exogenous STAT5, or the expression of a rabbit homologue thereof, is increased.
  • Bcl-6 it is for instance possible to indirectly enhance expression of Bcl-6, or expression of a rabbit homologue thereof, by culturing a rabbit B cell in the presence of interleukin (IL) 2 and/or IL4 which are capable of activating STAT5, or activating a rabbit homologue of STAT5, which in turn increases expression of Bcl-6, or expression of a rabbit homologue of Bcl-6.
  • IL interleukin
  • rabbit homologue of, for instance, Bcl-6 or STAT5 means a rabbit protein corresponding to Bcl-6 or STAT5, which means that it has a corresponding, similar function in rabbit B cells as compared to the function of Bcl-6 or STAT5 in human B cells.
  • a rabbit B cell with a nucleic acid molecule encoding Bcl-6, or encoding a rabbit homologue thereof, or a functional part or a functional derivative thereof.
  • a method according to the invention comprising providing said rabbit B cell with a nucleic acid molecule encoding Bcl-6, or encoding a rabbit homologue of Bcl-6, or a functional part or a functional derivative thereof.
  • said nucleic acid molecule is constitutively active, meaning that Bcl-6, or a rabbit homologue thereof, or a functional part or a functional derivative thereof, is continuously expressed, independent of the presence of a regulator.
  • said nucleic acid molecule is inducible, meaning that the expression thereof is regulated by at least one inducer and/or repressor. This way, expression of said nucleic acid molecule is regulated at will.
  • Tet-On and Tet-Off expression systems for example Tet-On® and Tet-Off® Advanced Inducible Gene Expression Systems, Clontech
  • Tet-On and Tet-Off expression systems can be used for inducible expression of a nucleic acid sequence of interest.
  • tTA transcriptional activator
  • TC tetracycline
  • dox doxycycline
  • tTA is composed of the Escherichia coli Tet repressor protein (TetR) and the Herpes simplex virus transactivating domain VP16.
  • tTA regulates transcription of a nucleic acid sequence of interest under the control of a tetracycline-responsive element (TRE) comprising the Tet operator (TetO) DNA sequence and a promoter sequence, for instance the human cytomegalovirus (hCMV) promoter.
  • TRE tetracycline-responsive element
  • hCMV human cytomegalovirus
  • a nucleic acid sequence encoding, for instance, Bcl6, or a rabbit homologue thereof, or a functional part or a functional derivative thereof, can be placed downstream of this promoter.
  • tTA binds to TRE in the absence of TC or dox and transcription of a nucleic acid sequence of interest is activated, whereas in the presence of TC or dox tTA cannot bind TRE and expression of a nucleic acid sequence of interest is inhibited.
  • the Tet-on system uses a reverse tTA (rtTA) that can only bind the TRE in the presence of dox. Transcription of a nucleic acid sequence of interest is inhibited in the absence of dox and activated in the presence of dox.
  • inducible expression is executed using a hormone inducible gene expression system such as for instance an ecdysone inducible gene expression system (for example RheoSwitch®, New England Biolabs) (Christopherson, K. S. et al. PNAS 89, 6314-8 (1992)).
  • Ecdysone is an insect steroid hormone from for example Drosophila melanogaster .
  • a heterodimer consisting of the ecdysone receptor (Ecr) and retinoid X receptor (RXR) is formed in the presence of an ecdyson agonist selected from ecdysone, one of its analogues such as muristerone A and ponasterone A, and a non-steroid ecdysone agonist.
  • Ecr and RXR interact and bind to an ecdysone response element that is present on an expression cassette. Expression of a nucleic acid sequence of interest that is placed in an expression cassette downstream of the ecdysone response element is thus induced by exposing a rabbit B-cell to an ecdyson agonist.
  • inducible expression is executed using an arabinose-inducible gene expression system (for example pBAD/gIII kit, Invitrogen) (Guzman, L. M. et al. Bacteriol 177, 4121-4130 (1995)).
  • Arabinose is a monosaccharide containing five carbon atoms.
  • PBAD expression of a nucleic acid sequence of interest placed downstream of PBAD can then be induced in the presence of arabinose.
  • a Bcl-6 protein or a rabbit homologue thereof, or a functional part or functional derivative thereof, wherein the activity of said Bcl-6 or rabbit homologue or functional part or functional derivative is regulated by at least one inducer and/or repressor.
  • a non-limiting example is a fusion protein wherein a regulatory element is fused to a sequence encoding at least part of Bcl-6 or a rabbit homologue thereof.
  • an estrogen receptor (ER) is fused to Bcl-6, resulting in fusion protein ER-Bcl-6.
  • This fusion protein is inactive because it forms a complex with heat shock proteins in the cytosol.
  • the exogenous inducer 4 hydroxy-tamoxifen (4HT) the fusion protein ER-Bcl-6 dissociates from the heat shock proteins, so that the Bcl-6 part of the fusion protein becomes active.
  • anti-apoptotic nucleic acid molecule refers to a nucleic acid molecule, which is capable of delaying and/or preventing apoptosis in a rabbit B cell.
  • said anti-apoptotic nucleic acid molecule is capable of delaying and/or preventing apoptosis in a plasmablast-like rabbit B cell, which is capable of both proliferating and producing antibody.
  • an anti-apoptotic nucleic acid molecule is used which comprises an exogenous nucleic acid molecule.
  • nucleic acid sequence is used which is not naturally expressed in rabbit B cells, or that an additional copy of a naturally occurring nucleic acid sequence is used, so that expression in the resulting rabbit B cells is enhanced as compared to natural rabbit B cells.
  • Various anti-apoptotic nucleic acid molecules are known in the art, so that various embodiments are available.
  • an anti-apoptotic nucleic acid molecule is used which is an anti-apoptotic member of the Bcl-2 family because anti-apoptotic Bcl-2 proteins are good apoptosis inhibiters in B cells.
  • Bcl-2 family which family includes both pro- and anti-apoptotic proteins
  • Bcl-2 family members Bcl-2, Bcl-xL, Bcl-w, Bcl-2-related protein A1 (also named Bcl2-A1 or A1), Bcl-2 like 10 (Bcl2L10) and Mcl-1, or a rabbit homologue thereof, or a functional part or functional derivative thereof is preferred because Bcl-2, Bcl-xL, Bcl-w, A1, Bcl2L10 and Mcl-1 are generally integrated with the outer mitochondrial membrane. They directly bind and inhibit the pro-apoptotic proteins that belong to the Bcl-2 family to protect mitochondrial membrane integrity.
  • a preferred embodiment therefore provides a method according to the invention, wherein said anti-apoptotic nucleic acid molecule comprises an anti-apoptotic gene of the Bcl2 family, preferably Bcl-xL or Mcl-1 or Bcl-2 or A1 or Bcl-w or Bcl2L10, or a rabbit homologue thereof, or a functional part or a functional derivative thereof.
  • said anti-apoptotic nucleic acid molecule comprises an anti-apoptotic gene of the Bcl2 family, preferably Bcl-xL or Mcl-1 or Bcl-2 or A1 or Bcl-w or Bcl2L10, or a rabbit homologue thereof, or a functional part or a functional derivative thereof.
  • expression of Bcl-xL or Mcl-1 or Bcl-2 or A1 or Bcl-w or Bcl2L10, or a rabbit homologue thereof is induced, enhanced or maintained by administering at least one compound, capable of promoting expression of any of these anti-apoptotic genes, to rabbit B cell(s), or by culturing rabbit B cells in the presence of such compound(s).
  • a method according to the invention comprising:
  • a rabbit B cell is provided with at least one nucleic acid molecule encoding an anti-apoptotic gene of the Bcl2 family, preferably selected from the group consisting of Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w, Bcl2L10, and rabbit homologues thereof, and functional parts and functional derivatives thereof.
  • an anti-apoptotic gene of the Bcl2 family preferably selected from the group consisting of Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w, Bcl2L10, and rabbit homologues thereof, and functional parts and functional derivatives thereof.
  • a method according to the invention comprising providing said rabbit B cell with at least one nucleic acid molecule encoding an anti-apoptotic gene of the Bcl2 family, preferably selected from the group consisting of Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w, Bcl2L10, and rabbit homologues thereof, and functional parts and functional derivatives thereof.
  • said nucleic acid molecule is constitutively active, meaning that said nucleic acid molecule is continuously expressed.
  • said nucleic acid molecule is inducible, meaning that the expression thereof is regulated by at least one inducer and/or repressor. Non-limiting examples of inducible nucleic acid expression systems known in the art are described herein before.
  • said anti-apoptotic nucleic acid molecule encodes Bcl-xL or Mcl-1, or a rabbit homologue thereof, or a functional part or a functional derivative thereof.
  • a combination of Bcl-6 and Bcl-xL is particularly well capable of increasing the replicative life span of rabbit B-cells, thereby forming long term cultures of the resulting plasmablast-like B-cells. The same holds true for a combination of Bcl-6 and Mcl-1.
  • said anti-apoptotic nucleic acid encodes Bcl-xL or a functional part or a functional derivative thereof.
  • a functional part of Bcl-6, Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w or Bcl2L10, or of a rabbit homologue thereof is a proteinaceous molecule that has the same capability—in kind, not necessarily in amount—of increasing the replicative life span of a rabbit B cell as compared to natural Bcl-6, Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w or Bcl2L10, or a rabbit homologue thereof, respectively.
  • Such functional part is for instance devoid of amino acids that are not, or only very little, involved in said cap ability.
  • functional parts of Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w and Bcl2L10, or of a rabbit homologue thereof are defined herein as fragments of Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w and Bcl2L10, respectively, or of a rabbit homologue thereof, which have retained the same kind of anti-apoptotic characteristics as full length Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w and Bcl2L10, respectively, or a rabbit homologue thereof (in kind, but not necessarily in amount).
  • Functional parts of Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w or Bcl2L10, or of a rabbit homologue thereof are typically shorter fragments of Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w or Bcl2L10, respectively, or of a rabbit homologue thereof, which are capable of delaying and/or preventing apoptosis in a rabbit B-cell.
  • Such functional parts are for instance devoid of sequences which do not significantly contribute to the anti-apoptotic activity of Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w and Bcl2L10.
  • a functional part of Bcl-6, or of a rabbit homologue thereof is typically a shorter fragment of Bcl-6, or a shorter fragment of a rabbit homologue thereof, which is capable of increasing the replicative life span of a rabbit B cell.
  • a functional derivative of Bcl-6, Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w or Bcl2L10, or of a rabbit homologue thereof is defined as a Bcl-6, Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w or Bcl2L10 protein, respectively, or a rabbit homologue thereof, which has been altered but has maintained its capability (in kind, not necessarily in amount) of increasing the replicative life span of a rabbit B cell.
  • a functional derivative is provided in many ways, for instance through conservative amino acid substitution wherein one amino acid is substituted by another amino acid with generally similar properties (size, hydrophobicity, etc), such that the overall functioning is not seriously affected.
  • a functional derivative for instance comprises a fusion protein with a detectable label or with an inducible compound.
  • Another aspect of the present invention solves the problem of efficiently introducing a nucleic acid molecule of interest into rabbit B cells.
  • the commonly used ampho retroviral vector which is suitable for infecting rodent cells such as murine cells and which was therefore expected to be also capable of transducing rabbit B cells, appeared not to transduce rabbit B cells efficiently; the transduction efficiency of an ampho vector at 4 days after transduction appeared lower than 1% in rabbit B cells. Therefore, the present inventors had to search for other gene delivery vehicles.
  • a gene delivery vehicle which comprises the extracellular domain of a gibbon ape leukemia virus (GALV) envelope protein is capable of transducing rabbit B cells with a high efficiency, typically of 80-90% at 3-5 days after transduction.
  • GALV gibbon ape leukemia virus
  • This property was quite unexpected, since a gibbon ape leukemia virus does not naturally infect rabbits. Rabbit cells were therefore not expected to contain a receptor for a GALV envelope protein; the current finding was mere coincidence.
  • transduction efficiency of human B cells with a vector containing the extracellular domain of a GALV envelope protein is typically 60-70% at 4 days after transduction, which is often lower than the transduction efficiency of rabbit B cells with this vector, despite the fact that human B cells are primate cells.
  • a preferred embodiment of the invention therefore provides a method for increasing the replicative life span of a rabbit B cell, the method comprising:
  • said rabbit B cell is provided with a nucleic acid molecule encoding Bcl-6, or encoding a rabbit homologue thereof, or encoding a functional part or a functional derivative thereof, and/or with at least one anti-apoptotic nucleic acid molecule, via transduction with a gene delivery vehicle that comprises the extracellular domain of a gibbon ape leukemia virus (GALV) envelope protein, or at least a functional part of said extracellular domain, or via transduction with a gene delivery vehicle that comprises a protein that has at least 70% sequence identity with the extracellular domain of a GALV envelope protein, or via transduction with a gene delivery vehicle that comprises a protein that has at least 70% sequence identity with at least a functional part of the extracellular domain of a GALV envelope protein.
  • GLV gibbon ape leukemia virus
  • said extracellular domain is of an envelope protein of GALV strain SEATO.
  • Said extracellular domain preferably comprises the sequence MVLLPGSMLLTSNLHHLRHQMSPGSWKRLIILLSCVFGGGGTSLQNKNP HQPMTLTWQVLSQTGDVVWDTKAVQPPWTWPTLKPDVCALAASLES WDIPGTDVSSSKRVRPPDSDYTAAYKQITWGAIGCSYPRARTRMASSTFY VCPRDGRTLSEARRCGGLESLYCKEWDCETTGTGYWLSKSSKDLITVKW DQNSEWTQKFQQCHQTGWCNPLKIDFTDKGKLSKDWITGKTWGLRFY VSGHPGVQFTIRLKITNMPAVAVGPDLVLVEQGPPRTSLALPPPLPPREA PPPSLPDSNSTALATSAQTPTVRKTIVTLNTPPPTTGDRLFDLVQGAFLTL NATNPGATESCWLCLAMGPPYYEAIASSGEVAYSTDLDRCRWGTQGKLT
  • said sequence identity is at least 75%, more preferably at least 80%, more preferably at least 81%, more preferably at least 82%, more preferably at least 83%, more preferably at least 84%, more preferably at least 85%, more preferably at least 86%, more preferably at least 86%, more preferably at least 87%, more preferably at least 88%, more preferably at least 89%, more preferably at least 90%, more preferably at least 91%, more preferably at least 92%, more preferably at least 93%, more preferably at least 94%, more preferably at least 95%, more preferably at least 96%, more preferably at least 97%, more preferably at least 98%, more preferably at least 99%, more preferably 100%.
  • said extracellular domain which is located at the surface (envelope) of a wild type gibbon ape leukemia virus so that it can bind a host cell, is preferably also located at the surface (envelope) of a gene delivery vehicle for transducing rabbit B cells.
  • a vector or other gene delivery vehicle is used that comprises an envelope protein which contains the extracellular domain and transmembrane domain of a GALV envelope protein, or a functional part thereof, which is fused to the cytoplasmic domain of an ampho envelope protein. This allows particular efficient transduction of rabbit B cells, as shown in the Examples.
  • a functional part of the extracellular domain of a GALV envelope protein means a part of said extracellular domain which is still capable of binding rabbit B cells, thereby mediating infection and/or transduction of the rabbit B cells.
  • Such functional part may lack one, or multiple, amino acid residues which are not essential for binding, infection and/or transduction of rabbit B cells.
  • rabbit B cells can be transduced with any nucleic acid molecule of interest using at least a functional part of the extracellular domain of a GALV envelope protein. Further provided is therefore an isolated or recombinant rabbit B cell bound to the extracellular domain of a GALV envelope protein, or bound to at least a functional part of said extracellular domain, or bound to a protein that has at least 70% sequence identity with at least a functional part of the extracellular domain of a GALV envelope protein.
  • An isolated or recombinant rabbit B cell that is bound via at least a functional part of the extracellular domain of a GALV envelope protein, or via a protein that has at least 70% sequence identity with at least a functional part of the extracellular domain of a GALV envelope protein, to a gene delivery vehicle is also provided herewith.
  • said extracellular domain is of an envelope protein of GALV strain SEATO.
  • Said extracellular domain preferably comprises the sequence MVLLPGSMLLTSNLHHLRHQMSPGSWKRLIILLSCVFGGGGTSLQNKNP HQPMTLTWQVLSQTGDVVWDTKAVQPPWTWPTLKPDVCALAASLES WDIPGTDVSSSKRVRPPDSDYTAAYKQITWGAIGCSYPRARTRMASSTFY VCPRDGRTLSEARRCGGLESLYCKEWDCETTGTGYWLSKSSKDLITVKW DQNSEWTQKFQQCHQTGWCNPLKIDFTDKGKLSKDWITGKTWGLRFY VSGHPGVQFTIRLKITNMPAVAVGPDLVLVEQGPPRTSLALPPPLPPREA PPPSLPDSNSTALATSAQTPTVRKTIVTLNTPPPTTGDRLFDLVQGAFLTL NATNPGATESCWLCLAMGPPYYEAIASSGEVAYSTDLDRCRWGTQGKLT LTEVSGHGLCIGKVPFTHQHLCNQTLSINSSGDHQYLLP
  • sequence identity is preferably at least 75%, more preferably at least 80%, more preferably at least 81%, more preferably at least 82%, more preferably at least 83%, more preferably at least 84%, more preferably at least 85%, more preferably at least 86%, more preferably at least 86%, more preferably at least 87%, more preferably at least 88%, more preferably at least 89%, more preferably at least 90%, more preferably at least 91%, more preferably at least 92%, more preferably at least 93%, more preferably at least 94%, more preferably at least 95%, more preferably at least 96%, more preferably at least 97%, more preferably at least 98%, more preferably at least 99%, more preferably 100%.
  • Said gene delivery vehicle preferably comprises a nucleic acid molecule of interest, preferably a nucleic acid sequence encoding Bcl-6, or a rabbit homologue thereof, or a functional part or functional derivative thereof, and/or an anti-apoptotic nucleic acid sequence.
  • a stabile rabbit B cell culture according to the present invention can be produced.
  • Said anti-apoptotic nucleic acid sequence is preferably an anti-apoptotic gene of the Bcl2 family, most preferably selected from the group consisting of Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w, Bcl2L10, and rabbit homologues thereof, and functional parts and functional derivatives thereof.
  • a use of the extracellular domain of a GALV envelope protein, or at least a functional part thereof that is capable of binding a rabbit B cell, for introducing a nucleic acid molecule of interest into a rabbit B cell is also herewith provided, as well as a use of a protein that has at least 70% sequence identity with at least a functional part of the extracellular domain of a GALV envelope protein for introducing a nucleic acid molecule of interest into a rabbit B cell.
  • a gene delivery vehicle comprising at least a functional part of the extracellular domain of a GALV envelope protein, or a gene delivery vehicle comprising a protein that has at least 70% sequence identity with at least a functional part of the extracellular domain of a GALV envelope protein, said gene delivery vehicle further comprising a nucleic acid sequence encoding Bcl-6, or a rabbit homologue thereof, or a functional part or a functional derivative thereof, and at least one anti-apoptotic nucleic acid sequence, for increasing the replicative life span of a rabbit B cell.
  • said extracellular domain is of an envelope protein of GALV strain SEATO.
  • Said extracellular domain preferably comprises the sequence MVLLPGSMLLTSNLHHLRHQMSPGSWKRLIILLSCVFGGGGTSLQNKNP HQPMTLTWQVLSQTGDVVWDTKAVQPPWTWPTLKPDVCALAASLES WDIPGTDVSSSKRVRPPDSDYTAAYKQITWGAIGCSYPRARTRMASSTFY VCPRDGRTLSEARRCGGLESLYCKEWDCETTGTGYWLSKSSKDLITVKW DQNSEWTQKFQQCHQTGWCNPLKIDFTDKGKLSKDWITGKTWGLRFY VSGHPGVQFTIRLKITNMPAVAVGPDLVLVEQGPPRTSLALPPPLPPREA PPPSLPDSNSTALATSAQTPTVRKTIVTLNTPPPTTGDRLFDLVQGAFLTL NATNPGATESCWLCLAMGPPYYEAIASSGEVAYSTDLDRCRWGTQGKLT LTEVSGHGLCIGKVPFTHQHLCNQTLSINSSGDHQYLLP
  • FIG. 9 A preferred chimeric envelope protein, which is also used in the Examples, is shown in FIG. 9 .
  • This chimeric envelope protein contains the extracellular domain of a GALV envelope protein (with the sequence MVLLPGSMLLTSNLHHLRHQMSPGSWKRLIILLSCVFGGGGTSLQNKNP HQPMTLTWQVLSQTGDVVWDTKAVQPPWTWPTLKPDVCALAASLES WDIPGTDVSSSKRVRPPDSDYTAAYKQITWGAIGCSYPRARTRMASSTFY VCPRDGRTLSEARRCGGLESLYCKEWDCETTGTGYWLSKSSKDLITVKW DQNSEWTQKFQQCHQTGWCNPLKIDFTDKGKLSKDWITGKTWGLRFY VSGHPGVQFTIRLKITNMPAVAVGPDLVLVEQGPPRTSLALPPPLPPREA PPPSLPDSNSTALATSAQTPTVRKTIVTLNTPPPTTGDRLFDLVQGAFLTL NATNPGATESCWLCLAMG
  • a vector or other gene delivery vehicle that comprises this preferred chimeric envelope protein is particularly well capable of introducing a nucleic acid molecule of interest into rabbit B cells.
  • An isolated or recombinant rabbit B cell that is bound via a chimeric envelope protein as depicted in FIG. 9 , or via a protein comprising a chimeric envelope protein as depicted in FIG. 9 or via a protein that has at least 70% sequence identity with a chimeric envelope protein as depicted in FIG. 9 , to a vector or other gene delivery vehicle is also provided herewith.
  • Such vector or other gene delivery vehicle is particularly suitable for transducing rabbit B cells with a nucleic acid molecule of interest. Further provided is therefore a use of a chimeric envelope protein as depicted in FIG. 9 , or a protein comprising a chimeric envelope protein as depicted in FIG. 9 or a protein that has at least 70% sequence identity with a chimeric envelope protein as depicted in FIG. 9 , for introducing a nucleic acid molecule of interest into a rabbit B cell.
  • Such vector or other gene delivery vehicle is particularly suitable for increasing the replicative life span of rabbit B cells. Further provided is therefore a method for increasing the replicative life span of a rabbit B cell, the method comprising:
  • said rabbit B cell is provided with a nucleic acid molecule encoding Bcl-6, or encoding a rabbit homologue thereof, or encoding a functional part or a functional derivative thereof, and/or with at least one anti-apoptotic nucleic acid molecule, via transduction with a vector or other gene delivery vehicle that comprises a chimeric envelope protein as depicted in FIG. 9 , or a protein comprising a chimeric envelope protein as depicted in FIG. 9 , or a protein that has at least 70% sequence identity with a chimeric envelope protein as depicted in FIG. 9 .
  • a gene delivery vehicle comprising a chimeric envelope protein as depicted in FIG. 9 , or a protein comprising a chimeric envelope protein as depicted in FIG. 9 , or a protein that has at least 70% sequence identity with a chimeric envelope protein as depicted in FIG. 9 , said gene delivery vehicle further comprising a nucleic acid sequence encoding Bcl-6, or a rabbit homologue thereof, or a functional part or a functional derivative thereof, and at least one anti-apoptotic nucleic acid sequence, for increasing the replicative life span of a rabbit B cell.
  • a GALV-based gene delivery vehicle is very suitable for efficient transduction of rabbit B cells with one or more nucleic acid molecule(s) of interest, such as Bcl-6 and an anti-apoptotic nucleic acid molecule
  • the use of a GALV-based gene delivery vehicle is not mandatory for obtaining rabbit B cells with a short doubling time of 20 hours or less.
  • Other gene delivery vehicles can also be used for introducing Bcl-6 and an anti-apoptotic nucleic acid molecule into rabbit B cells (although the efficiency will often be lower), in order to produce rabbit B cells with a doubling time of 20 hours or less.
  • a fast-growing B cell culture can be obtained, although it may take longer for the lower amount of originally transduced rabbit B cells to grow out.
  • An advantage of the use of a gene delivery vehicle that is able to efficiently transduce rabbit B cells, such as a GALV-based gene delivery vehicle as described herein, is that a higher proportion of the originally isolated B cells will be transduced, so that B cells derived therefrom will be present in the resulting B cell culture.
  • a nucleic acid molecule of interest is preferably operably linked to a promoter.
  • a promoter include a CMV promoter and a CAG promoter.
  • such promoter is inducible, meaning that its activity is influenced by at least one compound, such as for instance a transcription factor.
  • the term “gene delivery vehicle” means any compound capable of transferring a nucleic acid molecule into a host cell.
  • Non-limiting examples of gene delivery vehicles include (viral) vectors and plasmids.
  • the term “gene delivery vehicle comprising at least a functional part of the extracellular domain of a GALV envelope protein” means a gene delivery vehicle comprising at least part of the extracellular domain of a GALV envelope protein, wherein said extracellular domain, or said part thereof, is capable of binding a rabbit B cell so that nucleic acid can be introduced into said rabbit B cell.
  • said extracellular domain, or part thereof is preferably located at the surface of the gene delivery vehicle, so that it can bind a receptor on a rabbit B cell.
  • a gene delivery vehicle according to the invention comprises a protein that has at least 70% sequence identity with at least a functional part of the extracellular domain of a GALV envelope protein, said protein is preferably located at the surface of the gene delivery vehicle, so that it can bind a receptor on a rabbit B cell.
  • the percentage of identity of an amino acid or nucleic acid sequence is defined herein as the percentage of residues in a candidate amino acid or nucleic acid sequence that is identical with the residues in a reference sequence after aligning the two sequences and introducing gaps, if necessary, to achieve the maximum percent identity.
  • Methods and computer programs for the alignment are well known in the art, for example “Align 2 ”.
  • a GALV envelope protein is a protein that is naturally present in the viral envelope of gibbon ape leukemia virus and that is involved in infection of host cells.
  • the target specificity is typically determined by the envelope protein.
  • said envelope protein is of GALV strain SEATO.
  • Retroviral vectors containing the GALV envelope protein are known in the art and can be produced using procedures that are commonly used in the art of molecular biology, see for instance Lam et al., 1996.
  • operably linked to a promoter means that a nucleic acid sequence of interest is located sufficiently close to a promoter so that the promoter can influence expression thereof. Typically, such promoter will induce or increase expression of said nucleic acid of interest.
  • expression activity refers to such induction or enhancement of expression.
  • the present invention provides the insight that an ex vivo rabbit B cell culture can be obtained with a shorter mean doubling time as compared to currently known human or murine B cell cultures.
  • non-rabbit compounds such as a human Bcl-6 nucleic acid sequence, murine IL21 and human CD40L
  • the present inventors transduced rabbit B cells with a nucleic acid molecule containing a human Bcl-6 sequence and a human Bcl-xL or Mcl-1 sequence. Even though human sequences were used, and the rabbit cells were cultured in the presence of murine IL21 and human CD40L, the rabbit B cells surprisingly appeared to proliferate faster and to produce more antibody as compared to human and murine B cells.
  • rabbit B cells proliferate very well using human and murine compounds. Under these reaction conditions, the rabbit B cells even proliferate better than human and murine B cells. This has amongst other things the advantage that currently used reaction conditions for human B cells do not have to be adjusted for rabbit B cells. There is no need to obtain rabbit IL21, rabbit CD40 or rabbit nucleic acid sequences encoding Bcl-6 or an anti-apoptotic gene. Instead, currently available human or murine compounds can be used.
  • One aspect of the invention therefore provides a method for increasing the replicative life span of a rabbit B cell, the method comprising:
  • said non-rabbit nucleic acid molecule is a human nucleic acid molecule because human Bcl-6 and human anti-apoptotic sequences appear to provide particularly good results in rabbit B cells.
  • a rabbit B cell is provided with a nucleic acid molecule encoding human Bcl-6 and with a human anti-apoptotic nucleic acid molecule, preferably human Bcl-xL or human Mcl-1 or human Bcl-2 or human A1 or human Bcl-w or human Bcl2L10.
  • a method according to the invention is provided, further comprising providing said rabbit B cell with IL21 and CD40L.
  • IL21 and CD40L Preferably, non-rabbit IL21 and/or non-rabbit CD40L is used.
  • said IL21 is murine or human IL21, most preferably murine IL21.
  • said CD40L is murine or human CD40L, most preferably human CD40L.
  • Blimp-1 Besides increasing Bcl-6 expression and the expression of an anti-apoptotic nucleic acid molecule, it is also advantageous to induce, enhance and/or maintain expression of Blimp-1, or a rabbit homologue thereof, in a rabbit B-cell. This enhances antibody production of said B cell.
  • One aspect thus provides a method according to the invention, wherein the method further comprises inducing, enhancing and/or maintaining expression of Blimp-1, or a rabbit homologue thereof, in said rabbit B-cell.
  • a rabbit B cell is provided with a compound, which is capable of directly or indirectly increasing expression of Blimp-1, or expression of a rabbit homologue thereof. Additionally, or alternatively, a rabbit B cell is cultured in the presence of a compound capable of directly or indirectly increasing expression of Blimp-1, or expression of a rabbit homologue thereof. Further provided is therefore a method according to the invention, further comprising:
  • Said compound capable of increasing expression of Blimp-1, or of a rabbit homologue thereof most preferably comprises IL21.
  • rabbit B cells are cultured in the presence of IL21, at least during part of the culture time.
  • said compound capable of increasing Blimp-1 expression comprises a Signal Transducer of Activation and Transcription 3 (STAT3) protein or a functional part or a functional derivative thereof, and/or a nucleic acid molecule coding therefore.
  • STAT3 is a signal transducer, which is involved in B cell development and differentiation.
  • STAT3 is capable of upregulating Blimp-1 expression.
  • a rabbit B cell is provided with a nucleic acid molecule encoding STAT3 or a functional part or a functional derivative thereof, wherein the expression of said nucleic acid molecule is regulated by an exogenous inducer of repressor, so that the extent of STAT3 expression is regulated at will.
  • a fusion product comprising STAT3, or a functional part or a functional derivative, and ER is used.
  • a rabbit B cell is provided with a nucleic acid molecule encoding an estrogen receptor (ER) and STAT3 as a fusion protein ER-STAT3.
  • This fusion protein is inactive because it forms a complex with heat shock proteins in the cytosol. This way, STAT3 is unable to reach the nucleus and Blimp-1 expression is not enhanced.
  • the exogenous inducer 4 hydroxy-tamoxifen (4HT) the fusion protein ER-STAT3 dissociates from the heat shock proteins, so that STAT3 is capable of entering the nucleus and activating Blimp-1 expression.
  • a functional part of STAT3 is defined as a fragment of STAT3 that has the same capability—in kind, not necessarily in amount—of increasing expression of Blimp-1, or of a rabbit homologue thereof, as compared to natural STAT3.
  • Such functional part is for instance devoid of amino acids that are not, or only very little, involved in said capability.
  • a functional derivative of STAT3 is defined as a STAT3 protein, which has been altered but has maintained its capability (in kind, not necessarily in amount) of increasing expression of Blimp-1, or of a rabbit homologue thereof.
  • a functional derivative is provided in many ways, for instance through conservative amino acid substitution wherein one amino acid is substituted by another amino acid with generally similar properties (size, hydrophobicity, etc), such that the overall functioning is not seriously affected.
  • a functional derivative for instance comprises a fusion protein with a detectable label or with an inducible compound.
  • STAT3 is capable of increasing expression of Blimp-1, or increasing expression of a rabbit homologue thereof, it is also possible to indirectly increase expression of Blimp-1, or of a rabbit homologue thereof, by administering a compound capable of increasing the activity and/or expression of STAT3.
  • a rabbit B cell is therefore provided with a compound that is capable of enhancing the activity of STAT3, so that expression of Blimp-1, or of a rabbit homologue thereof, is indirectly enhanced.
  • STAT3 is activated in a variety of ways.
  • STAT3 is activated by providing a rabbit B cell with a cytokine.
  • Cytokines being naturally involved in B cell differentiation, are very effective in regulating STAT proteins.
  • Very effective activators of STAT3 are IL21 and IL6, but also IL2, IL7, IL10, IL15 and IL27 are known to activate STAT3.
  • Toll-like receptors (TLRs) which are involved in innate immunity, are also capable of activating STAT3.
  • One embodiment therefore provides a method of the invention, wherein said rabbit B cell is cultured in the presence of IL21, IL2, IL6, IL7, IL10, IL15 and/or IL27.
  • IL21 is used, since IL21 is particularly suitable for enhancing antibody production of rabbit B cell cultures according to the present invention.
  • IL21 is capable of upregulating Blimp-1 expression, even when Blimp-1 expression is counteracted by BCL6.
  • a mutated Janus kinase (JAK), or a mutated rabbit homologue of a JAK, is used in order to activate STAT3.
  • a JAK is capable of phosphorylating STAT3 after it has itself been activated by at least one cytokine.
  • a mutated Janus kinase, or a mutated rabbit homologue of a JAK, capable of activating STAT3 independently of the presence of cytokines, is particularly suitable in a method according to the present invention.
  • expression of Blimp-1, or of a rabbit homologue thereof is increased by providing a rabbit B cell with a suppressor of cytokine signalling (SOCS) protein, or a rabbit homologue thereof, and/or by activating a SOCS protein or a rabbit homologue thereof within said cell.
  • SOCS cytokine signalling
  • at least one of the E-proteins E47, E12, E2-2 and HEB is used in order to increase expression of Blimp-1, or of a rabbit homologue thereof.
  • E47 is a transcription factor that belongs to a family of helix-loop-helix proteins, named E-proteins. There are four E-proteins, E12, E47, E2-2 and HEB, which are involved in lymphocyte development. E12 and E47 are encoded by one gene, named E2A, which is spliced differently. E proteins have been described as tumor suppressors.
  • One of the specific targets of E47 are the Socs1 and Socs3 genes.
  • One aspect thus provides a method according to the present invention, further increasing expression of Blimp-1, or of a rabbit homologue thereof, in a rabbit B cell by providing said B cell with a compound capable of directly or indirectly increasing expression of Blimp-1, or of a rabbit homologue thereof, and/or culturing said B cell in the presence of a compound capable of directly or indirectly increasing expression of Blimp-1, or of a rabbit homologue thereof, wherein said compound comprises:
  • said compound is IL21.
  • the invention further provides isolated or recombinant rabbit B cells obtainable with a method according to the presence invention.
  • isolated or recombinant rabbit B cells preferably comprise an exogenous anti-apoptotic nucleic acid sequence and an exogenous nucleic acid sequence encoding Bcl-6, or a rabbit homologue thereof, or a functional part or a functional derivative thereof.
  • an isolated or recombinant rabbit B cell comprising an exogenous nucleic acid sequence encoding Bcl-6, or a rabbit homologue thereof, or a functional part or a functional derivative thereof, and an exogenous anti-apoptotic nucleic acid sequence.
  • said exogenous nucleic acid molecule either contains a nucleic acid sequence that does not naturally occur in rabbit B cells, or an additional copy of a natural rabbit B cell nucleic acid sequence.
  • Bcl-xL, Mcl-1, Bcl-2, A1, Bcl-w and Bcl2L10, and rabbit homologues thereof, are preferred anti-apoptotic nucleic acid molecules.
  • One preferred aspect therefore provides an isolated or recombinant rabbit B cell, which comprises an exogenous nucleic acid sequence encoding Bcl-6, or a rabbit homologue thereof, or a functional part or a functional derivative thereof, and an exogenous nucleic acid sequence encoding Bcl-xL or Mcl-1 or Bcl-2 or A1 or Bcl-w or Bcl2L10, or a rabbit homologue thereof, or a functional part or a functional derivative thereof.
  • Said nucleic acid sequence encoding Bcl-6, or a rabbit homologue thereof, or a functional part or a functional derivative thereof, and said exogenous anti-apoptotic nucleic acid sequence may be present on one nucleic acid molecule. Alternatively, these sequences are present on at least two different nucleic acid molecules.
  • non-rabbit sequences are used, as explained before.
  • a preferred embodiment therefore provides an isolated or recombinant rabbit B cell comprising a non-rabbit anti-apoptotic nucleic acid sequence and a non-rabbit nucleic acid sequence encoding Bcl-6, or a rabbit homologue thereof, or a functional part or a functional derivative thereof.
  • Said non-rabbit nucleic acid sequence preferably contain human sequences.
  • an isolated or recombinant rabbit B cell which comprises:
  • the invention also provides ex vivo rabbit B cell cultures obtainable by the methods according to the present invention.
  • An important advantage is the fact that ex vivo B cell cultures are now obtained with a short mean doubling time.
  • an ex vivo rabbit B cell culture which has a mean doubling time of 20 hours or less.
  • a further preferred embodiment provides an ex vivo rabbit B cell culture comprising rabbit B cells according to the invention.
  • Said rabbit B cells preferably comprise a nucleic acid sequence encoding human Bcl-6 or a functional part or a functional derivative thereof, and an anti-apoptotic nucleic acid sequence.
  • an ex vivo rabbit B cell culture comprising rabbit B cells in the presence of non-rabbit IL21 and/or non-rabbit CD40L.
  • said IL21 is murine or human IL21, most preferably murine IL21.
  • said CD40L is murine or human CD40L, most preferably human CD40L.
  • an antibody when obtained by a method according to the invention is also provided herewith, as well as an antibody produced by a rabbit B cell according to the invention or by an ex vivo rabbit B cell culture according to the invention.
  • Such antibody is particularly useful for therapeutic or diagnostic applications.
  • said antibody is a monoclonal antibody.
  • Retroviral and lentiviral transductions are suitable for efficient gene transfer. While retroviral integration is dependent on cell division, lentiviral transduction can also be applied to non-dividing cells like plasma B cells. Large-scale preparation of recombinant retrovirus can easily be achieved by using stable producer cell lines such as the Phoenix expression platform (Kinsella and Nolan, 1996). Production of high titer lentivirus tends to be more cumbersome mainly because of the toxicity of the expressed virus proteins and envelopes.
  • MMLV Moloney Murine Leukemia Virus
  • GALV Gibbon Ape Leukemia Virus
  • the transfer vector is set-up such that Bcl-6, Bcl-xL and the green fluorescent protein (GFP) marker protein are simultaneously translated from the same viral RNA ( FIG. 8 ).
  • This multicistronic approach is achieved by placing a ‘self-cleaving’ 2A peptide sequence (Szymczak et al., 2004) between the BCL-6 and BCL-xL coding regions and an Internal Ribosomal Entry Sequence (IRES) upstream of the GFP reporter gene.
  • IRS Internal Ribosomal Entry Sequence
  • Human memory B cells were immortalized using the BCL-6/Bcl-xL technology described by Kwakkenbos et al., 2010 and patent application WO 2007/067046.
  • PBMC's from rabbit blood were isolated using a ficoll density gradient and stained for Ig expression using an antibody that recognizes Ig (IgG H+L: IgG heavy chain and kappa and lambda light chains) sometimes in combination with an IgM specific antibody.
  • B cells were isolated (Ig positive, or Ig positive+IgM negative) using a FACS sorter and stimulated on y irradiated (50 Gy) mouse L cell fibroblasts stably expressing CD40L (CD40L-L cells, 10 5 cells ml ⁇ 1 ) together with recombinant mouse interleukin (IL)-21 for 36-48 hours.
  • Cells were harvested and washed with medium without FCS and cells were then transferred to Retronectin® (Takara, Shiga, Japan)-coated tissue culture plates where they were transduced with a retroviral vector containing BCL-6, Bcl-xL, and GFP as a reporter protein.
  • FIG. 1 the transduction efficiency is compared for GALV and amphotropic type retroviruses at 4 days after transduction.
  • the GALV type retrovirus is superior to the amphotropic type retrovirus for transducing rabbit B cells.
  • FIG. 2 growth curves are depicted for B cells from two human donors (89 and 93), one llama B-cell sample (Llama) and one rabbit B-cell sample which was transduced with a GALV type retrovirus carrying a nucleic acid molecule containing a human Bcl-6 sequence and a human Bcl-xL (Rb 6XL). Also a growth curve is depicted for one rabbit sample that was transduced with a GALV type retrovirus carrying a nucleic acid molecule containing a human Bcl-6 sequence and a human Mcl-1 (Rb 6M).
  • the transduced rabbit B cells have an average doubling time of 19 hours and thus grow faster than the human or llama B cells that have doubling times between 26 and 32 hours. These average doubling times were originally calculated by determining the increase of B cells during several 3-4 days time intervals, and averaging the obtained results. Subsequently, the overall average doubling time during the whole culturing period was calculated. This resulted in an average doubling time of the transduced rabbit B cells of 18 hours, an average doubling time of the transduced human B cells of 25-29 hours and an average doubling time of the transduced llama B cells of 27 hours. This confirms our observations that our methods yield rabbit B-cell cultures with a mean doubling time of 20 hours or less, whereas human, murine and llama B cells typically have a doubling time of between 25 and 36 hours.
  • Immortalized human B cells express the B-cell receptor. This quality enables antigen-specific staining and sorting of B cells.
  • B-cell clones are stained with fluorescently labeled antibodies reacting specifically with either rabbit IgG, rabbit IgM or rabbit IgA.
  • B cells were washed in cold (4° C.) cell culture medium and incubated on ice in the dark with cell culture medium containing immunofluorescently labelled antibodies that are specific for either rabbit IgG, IgM, IgA or labelled antigen. Afterwards excess of labelled antibodies or antigen was washed away and B-cell receptor expression analysed on a FACS analyser; the Guava easycyte (Millipore) or FACS Aria3 (BD).
  • FIG. 3 three different B-cell clones of different isotypes were stained with fluorescently labelled antibodies specifically recognizing rabbit antibody isotype IgG, IgA or IgM. Clearly the B-cell receptor can be efficiently stained for the different rabbit antibody isotypes. We therefore conclude that immortalized rabbit B cells also express the B-cell receptor.
  • Transduced B cells were sorted one cell per well using a FACS sorter and cultured in the presence of y irradiated (50 Gy) mouse L cell fibroblasts stably expressing CD40L (CD40L-L cells, 105 cells ml-1) together with recombinant mouse IL-21. Every 3-4 days fresh CD40L-L cells and IL-21 were added. Starting 9 days after seeding the cells (one cell per well), the supernatants were analyzed in ELISA for the production of rabbit immunoglobulin G (IgG). For comparison also the human IgG in the supernatant of human B-cell clones was analyzed in parallel.
  • IgG rabbit immunoglobulin G
  • FIG. 7 the antibody concentration in the supernatant is depicted over time starting at 9 days after the initiation of the single cell cultures.
  • the antibody concentration was determined for two human donors and one rabbit B-cell sample that were transduced with a GALV type retrovirus carrying a nucleic acid molecule containing a human Bcl-6 sequence and a human Bcl-xL and for one rabbit B-cell sample that was transduced with a GALV type retrovirus carrying a nucleic acid molecule containing a human Bcl-6 sequence and a human Mcl-1.
  • B cell clones from rabbits produce IgG concentrations of 30 ng/ml and 100 ng/ml within a shorter time period (9-10 days and 11-12 days, respectively) than do the human B-cell clones (13-18 and 15-20 days, respectively). This provides the important advantage that it allows for earlier screening for antibodies of interest of rabbit B cell clones, compared to human B cell clones.
  • New Zealand White rabbits were immunized with a human influenza vaccine containing 15 ug H1N1, 15 ug H3N2 and 15 ug infl B in complete Freunds adjuvans. After 3 weeks rabbits were boosted with the same vaccine in incomplete Freunds adjuvans. Five days after the boost rabbits were bled, B-cells were isolated from the blood and transduced with a GALV type retrovirus (containing the extracellular domain and transmembrane domain of the GALV strain SEATO envelope protein, fused to the cytoplasmic domain of an ampho envelope protein) carrying a nucleic acid molecule containing a human Bcl-6 sequence and a human Bcl-xL.
  • a GALV type retrovirus containing the extracellular domain and transmembrane domain of the GALV strain SEATO envelope protein, fused to the cytoplasmic domain of an ampho envelope protein carrying a nucleic acid molecule containing a human Bcl-6 sequence and a human Bcl-xL.
  • Transduced B cells were seeded at different cell densities into culture plates and cultured as described in Example 4. Also, transduced B cells were labeled with fluorescently labeled components of the vaccine; H1, H3 or influenza B and sorted 1 cell per well using a FACS sorter and cultured as described in Example 4. The supernatants of the cultured cells were analyzed for binding to the complete vaccine or to its individual components. The results are depicted in FIGS. 4-6 and show that antigen-specific B cells can be identified in the B-cell pool from vaccinated rabbits by seeding cells at different density ( FIG. 5 ) and also very efficiently by sorting cells using the labeled antigens ( FIG. 4 and FIG. 6 ).
  • Immortalization of rabbit B cells by introduction of the genes Bcl-6 and Bcl-xl can be achieved by using different types of vectors, such as for instance GALV and amphotrophic type retroviruses as is shown in Example 1.
  • the growth of B cells transduced with the amphotrophic type retrovirus was further pursued to confirm that introduction of Bcl-6 and Bcl-xl by amphotrophic retrovirus also leads to immortalization of rabbit B cells.
  • Four days after transduction with the amphotropic type retrovirus 0.8% of the cells was transduced compared to 80% of cells after transduction with a GALV type retrovirus ( FIG. 1 and FIG. 10 ).
  • Ten days after transduction 94% of the cell population transduced with the amphotrophic retrovirus was GFP positive demonstrating that the transduced cells overgrow the non-transduced cells ( FIG. 10 ).
  • Example 2 To determine cell doubling time cells were cultured as done in Example 2 in 24-well plates at 50-100.000 cells/well together with CD40L-L cells and IL-21. Every 3-4 days cell were counted and 50-100.000 cells transferred to a new well.
  • FIG. 11 the growth curve is depicted for rabbit B cells transduced with amphotrophic virus. The calculated doubling time is 19 hours, which is comparable to rabbit B cells transduced with GALV type retrovirus (18 hours).
  • introduction of Bcl-6 and Bcl-xl into rabbit B cells by amphotrophic retrovirus also results in immortalization of rabbit B cells, although the transduction efficiency is much lower as compared to a GALV based vector.
  • FIG. 1 is a diagrammatic representation of FIG. 1 .
  • Rabbit B cells were isolated from PBMCs based on Ig expression. Cells were activated for 36-40 hrs on CD40L L-cells with rm-IL-21. Cells were transduced with a retroviral vector containing BCL6 and Bcl-xL. Both GALV and amphotropic type retroviruses were tested. Transduced cells are then cultured on CD40L-L cells in the presence of recombinant mouse IL-21. After four days of culture the transduction efficiency was determined based on GFP expression. GALV typed retrovirus showed superior (80%) transduction efficiency compared to amphotropic (0.8%) typed retrovirus.
  • FIG. 2 is a diagrammatic representation of FIG. 1 .
  • Growth curves were analyzed for rabbit B cells transduced with a retroviral vector containing BCL6 and Bcl-xL or a retroviral vector containing BCL6 and Mcl-1. For comparison growth curves were analysed in parallel B cells from llama cells and human cells from two different donors that were transduced with an identical retroviral vector containing BCL6 and Bcl-xL.
  • FIG. 3 is a diagrammatic representation of FIG. 3 .
  • IgG, IgM and IgA surface immunoglobulin expression was detected using FACS on three different Bcl-6 Bcl-xL transduced rabbit B-cell clones.
  • FIG. 4 is a diagrammatic representation of FIG. 4 .
  • FIG. 5 is a diagrammatic representation of FIG. 5 .
  • Antigen-specific rabbit antibodies were obtained against the different components of a human influenza vaccine containing 15 ug H1N1, 15 ug H3N2 and 15 ug infl B. Rabbits were immunized and boosted with the human influenza vaccine. B cells were immortalized and seeded at different densities in 384-well plates on CD40L-L cells in the presence of recombinant mouse IL-21. Antibodies present in the rabbit B cell culture supernatants were screened in ELISA for influenza-specificity. Antigen-specific antibodies were observed for all the components of the vaccine.
  • FIG. 6 is a diagrammatic representation of FIG. 6 .
  • Immortalized B cells from rabbits immunized with a human influenza vaccine containing 15 ug H1N1, 15 ug H3N2 and 15 ug infl B were stained with fluorescently labelled influenza proteins.
  • B cells showing binding to the influenza proteins were sorted 1 cell per well in 384-well plates on CD40L-L cells in the presence of recombinant mouse IL-21 using a FACSAria sorter.
  • Supernatants were screened in ELISA for influenza-specific antibodies. Antigen-specific antibodies were observed with a high frequency for the components of the vaccine that were used for antigen-specific sorting.
  • FIG. 7 is a diagrammatic representation of FIG. 7 .
  • Antibody concentration in the supernatant of clonal B cells at different time points Human, llama and rabbit transduced B cells were seeded 1 cell per well in the presence of irradiated CD40L- L cells and supplemented with mouse IL-21. Every 3-4 days CD40L-L cells and IL-21 were replenished. The IgG concentration was analyzed in ELISA for individual wells at different time points during culture. Each measurement was done on different wells.
  • the rabbit B cells were either transduced with a retroviral vector containing BCL6 and Bcl-xL or a retroviral vector containing BCL6 and Mcl-1. All other cells (human and llama) were transduced with BCL6 and Bcl-xL.
  • FIG. 8 is a diagrammatic representation of FIG. 8 .
  • FIG. 9 is a diagrammatic representation of FIG. 9 .
  • FIG. 10 is a diagrammatic representation of FIG. 10 .
  • FIG. 11 is a diagrammatic representation of FIG. 11 .
  • a growth curve was analyzed for rabbit B cells transduced with a amphotrophic type retroviral vector containing BCL6 and Bcl-xL

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • General Engineering & Computer Science (AREA)
  • Virology (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Communicable Diseases (AREA)
  • Cell Biology (AREA)
  • Pulmonology (AREA)
  • Hematology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
US15/106,991 2013-12-23 2014-12-24 Ex vivo antibody production Abandoned US20170009205A1 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
EP13199584.7 2013-12-24
EP13199584 2013-12-24
PCT/NL2014/050908 WO2015099534A1 (en) 2013-12-24 2014-12-24 Ex vivo antibody production

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/NL2014/050908 A-371-Of-International WO2015099534A1 (en) 2013-12-23 2014-12-24 Ex vivo antibody production

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/575,518 Division US20200149007A1 (en) 2013-12-24 2019-09-19 Ex vivo antibody production

Publications (1)

Publication Number Publication Date
US20170009205A1 true US20170009205A1 (en) 2017-01-12

Family

ID=49885067

Family Applications (2)

Application Number Title Priority Date Filing Date
US15/106,991 Abandoned US20170009205A1 (en) 2013-12-23 2014-12-24 Ex vivo antibody production
US16/575,518 Pending US20200149007A1 (en) 2013-12-24 2019-09-19 Ex vivo antibody production

Family Applications After (1)

Application Number Title Priority Date Filing Date
US16/575,518 Pending US20200149007A1 (en) 2013-12-24 2019-09-19 Ex vivo antibody production

Country Status (15)

Country Link
US (2) US20170009205A1 (ja)
EP (2) EP4141108A1 (ja)
JP (1) JP6832705B2 (ja)
CN (1) CN106029873A (ja)
AU (1) AU2014370516B9 (ja)
BR (1) BR112016014881B1 (ja)
CA (1) CA2934660C (ja)
DK (1) DK3087177T3 (ja)
EA (1) EA201691112A1 (ja)
ES (1) ES2927905T3 (ja)
HU (1) HUE060145T2 (ja)
IL (1) IL246409B (ja)
MX (1) MX2016008345A (ja)
SG (1) SG11201605126YA (ja)
WO (1) WO2015099534A1 (ja)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160096881A1 (en) * 2010-12-02 2016-04-07 Aimm Therapeutics B.V. Means and methods for producing high affinity antibodies

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN116554353B (zh) * 2023-04-28 2024-05-03 北京奇迈永华生物科技有限公司 一种假病毒高效感染人nk细胞及其他免疫细胞的方法

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ATE424464T1 (de) * 2002-04-26 2009-03-15 Inst Nat Sante Rech Med Verbesserte chimäre glykoproteine und pseudotypisierte lentivirale vektoren
CN103710371B (zh) * 2005-08-03 2017-03-01 人类多克隆治疗股份有限公司 表达人源化免疫球蛋白的转基因动物中b细胞凋亡的抑制
PT2540820T (pt) 2005-12-09 2018-03-02 Academisch Medisch Centrum Bij De Univ Van Amsterdam Meios e métodos para influenciar a establidade de células produtoras de anticorpos
PL2400298T3 (pl) * 2010-05-28 2014-01-31 Hoffmann La Roche Sposób hodowania pojedynczych komórek b oraz wytwarzania swoistych przeciwciał
CN103429615B (zh) * 2010-12-02 2018-03-16 埃姆医疗有限公司 用于生产高亲和力抗体的方式和方法
ES2617488T3 (es) * 2011-11-23 2017-06-19 F. Hoffmann-La Roche Ag Células de mamífero que expresan CD40L y su uso
WO2014109696A1 (en) * 2013-01-10 2014-07-17 Alf Grandien Method for immortalization of b cells and uses thereof
EP3099709B1 (en) * 2014-01-31 2019-12-25 AIMM Therapeutics B.V. Means and methods for producing stable antibodies

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160096881A1 (en) * 2010-12-02 2016-04-07 Aimm Therapeutics B.V. Means and methods for producing high affinity antibodies
US9969795B2 (en) * 2010-12-02 2018-05-15 Aimm Therapeutics B.V. Means and methods for producing high affinity antibodies

Also Published As

Publication number Publication date
SG11201605126YA (en) 2016-07-28
IL246409A0 (en) 2016-08-31
AU2014370516B2 (en) 2021-03-11
EP4141108A1 (en) 2023-03-01
CA2934660C (en) 2023-03-14
WO2015099534A1 (en) 2015-07-02
EA201691112A1 (ru) 2017-01-30
CA2934660A1 (en) 2015-07-02
AU2014370516B9 (en) 2021-07-29
ES2927905T3 (es) 2022-11-11
JP6832705B2 (ja) 2021-02-24
BR112016014881B1 (pt) 2023-03-28
MX2016008345A (es) 2017-02-08
AU2014370516A1 (en) 2016-07-07
CN106029873A (zh) 2016-10-12
BR112016014881A2 (pt) 2017-08-08
IL246409B (en) 2022-01-01
NZ722156A (en) 2021-08-27
HUE060145T2 (hu) 2023-02-28
EP3087177B1 (en) 2022-09-14
EP3087177A1 (en) 2016-11-02
US20200149007A1 (en) 2020-05-14
BR112016014881A8 (pt) 2020-06-09
DK3087177T3 (da) 2022-10-03
JP2017500052A (ja) 2017-01-05

Similar Documents

Publication Publication Date Title
DK2797951T3 (en) PROCEDURE FOR ISOLATING HUMAN ANTIBODIES.
CN109651511B (zh) 一种靶向bcma的嵌合抗原受体及其应用
JP5726744B2 (ja) 生体外におけるヒトｂリンパ球産生培養システム
CN109942709A (zh) 一种抗bcma的单域抗体及其应用
CN112166193A (zh) 具有经修饰的接头结构域的嵌合抗原受体及其用途
EP4023678A1 (en) Chimeric antigen receptor and immune effector cell expressing chimeric antigen receptor
US20200149007A1 (en) Ex vivo antibody production
CA3136281A1 (en) Antibody or chimeric antigen receptor which targets claudin 18.2
JP2017516496A5 (ja)
JP2019509729A (ja) 抗体産生のためにｂ細胞を拡張及び分化する方法
JP7026634B2 (ja) Ｂ細胞培養法
WO2018205917A1 (en) Novel method for producing antibodies
NZ722156B2 (en) Ex vivo antibody production
EA044991B1 (ru) Образование антител ex vivo
CN112608902A (zh) 一种第四代car-t细胞及其应用
KR20210143097A (ko) Cd22에 특이적인 항체 및 이의 용도
WO2024122579A1 (ja) 不死化細胞の製造方法
US20110171688A1 (en) Method of providing immunoglobulin secreting b lymphocytes and human antibodies
EP3284819A1 (en) Method for the generation of t cell hybridoma for cloning and analysis of receptors using engineered measles virus fusogenic glycoproteins
JPWO2018079497A1 (ja) チオプリン高感受性キメラ抗原受容体遺伝子改変リンパ球
WO2022228429A1 (zh) 靶向bcma的嵌合抗原受体及其应用
US20240018262A1 (en) Antibody specific for gpc3 and uses thereof
US20240034790A1 (en) Antibody specific for cd47 and uses thereof
KR20220122844A (ko) Cd22에 특이적인 인간화 항체 및 이의 용도

Legal Events

Date Code Title Description
AS Assignment

Owner name: AIMM THERAPEUTICS B.V., NETHERLANDS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:VAN HELDEN, PAULA MARIA WILHELMINA;KWAKKENBOS, MARK JEROEN;SPITS, HERGEN;AND OTHERS;REEL/FRAME:039869/0396

Effective date: 20160725

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION