US20120058985A1 - Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities - Google Patents
Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities Download PDFInfo
- Publication number
- US20120058985A1 US20120058985A1 US13/098,243 US201113098243A US2012058985A1 US 20120058985 A1 US20120058985 A1 US 20120058985A1 US 201113098243 A US201113098243 A US 201113098243A US 2012058985 A1 US2012058985 A1 US 2012058985A1
- Authority
- US
- United States
- Prior art keywords
- compound
- fluorophenyl
- dicarboxamide
- cyclopropane
- alkyl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 230000001747 exhibiting effect Effects 0.000 title description 3
- 230000001093 anti-cancer Effects 0.000 title description 2
- 230000001028 anti-proliverative effect Effects 0.000 title description 2
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 title description 2
- 150000001875 compounds Chemical class 0.000 claims abstract description 198
- 150000003839 salts Chemical class 0.000 claims abstract description 55
- 238000000034 method Methods 0.000 claims abstract description 29
- 239000012453 solvate Substances 0.000 claims abstract description 29
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 27
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 5
- 239000000203 mixture Substances 0.000 claims description 63
- 125000000217 alkyl group Chemical group 0.000 claims description 30
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 29
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 claims description 26
- 230000000694 effects Effects 0.000 claims description 24
- 201000010099 disease Diseases 0.000 claims description 23
- 108091000080 Phosphotransferase Proteins 0.000 claims description 20
- 102000020233 phosphotransferase Human genes 0.000 claims description 20
- 125000002947 alkylene group Chemical group 0.000 claims description 15
- 229910052736 halogen Inorganic materials 0.000 claims description 15
- 150000002367 halogens Chemical group 0.000 claims description 15
- 125000000623 heterocyclic group Chemical group 0.000 claims description 15
- 125000000753 cycloalkyl group Chemical group 0.000 claims description 13
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 claims description 13
- 125000003118 aryl group Chemical group 0.000 claims description 12
- 150000004677 hydrates Chemical class 0.000 claims description 12
- 125000004093 cyano group Chemical group *C#N 0.000 claims description 11
- 125000001072 heteroaryl group Chemical group 0.000 claims description 11
- 125000006552 (C3-C8) cycloalkyl group Chemical group 0.000 claims description 8
- 102000037865 fusion proteins Human genes 0.000 claims description 8
- 108020001507 fusion proteins Proteins 0.000 claims description 8
- 125000006701 (C1-C7) alkyl group Chemical group 0.000 claims description 7
- 206010006187 Breast cancer Diseases 0.000 claims description 7
- 208000026310 Breast neoplasm Diseases 0.000 claims description 7
- 230000001594 aberrant effect Effects 0.000 claims description 7
- 201000011510 cancer Diseases 0.000 claims description 7
- 231100000590 oncogenic Toxicity 0.000 claims description 7
- 230000002246 oncogenic effect Effects 0.000 claims description 7
- XGGWHIQZALFGOB-UHFFFAOYSA-N 1-n'-[2,5-difluoro-4-[2-(2-methylpropanoylamino)pyridin-4-yl]oxyphenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)C(C)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 XGGWHIQZALFGOB-UHFFFAOYSA-N 0.000 claims description 6
- YIPSLILFBXVKMU-UHFFFAOYSA-N 1-n'-[2,5-difluoro-4-[2-(propanoylamino)pyridin-4-yl]oxyphenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)CC)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 YIPSLILFBXVKMU-UHFFFAOYSA-N 0.000 claims description 6
- WOVFQJQCMLCIDS-UHFFFAOYSA-N 1-n'-[4-(2-acetamidopyridin-4-yl)oxy-2,5-difluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 WOVFQJQCMLCIDS-UHFFFAOYSA-N 0.000 claims description 6
- YBYIRNPNPLQARY-UHFFFAOYSA-N 1H-indene Natural products C1=CC=C2CC=CC2=C1 YBYIRNPNPLQARY-UHFFFAOYSA-N 0.000 claims description 6
- 206010048643 Hypereosinophilic syndrome Diseases 0.000 claims description 6
- 206010027476 Metastases Diseases 0.000 claims description 6
- 230000001404 mediated effect Effects 0.000 claims description 6
- 230000009401 metastasis Effects 0.000 claims description 6
- 208000008839 Kidney Neoplasms Diseases 0.000 claims description 5
- 208000014767 Myeloproliferative disease Diseases 0.000 claims description 5
- 206010033128 Ovarian cancer Diseases 0.000 claims description 5
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 5
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 5
- 206010060862 Prostate cancer Diseases 0.000 claims description 5
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 5
- 208000019065 cervical carcinoma Diseases 0.000 claims description 5
- 208000029742 colonic neoplasm Diseases 0.000 claims description 5
- 239000003085 diluting agent Substances 0.000 claims description 5
- 208000005017 glioblastoma Diseases 0.000 claims description 5
- 230000003463 hyperproliferative effect Effects 0.000 claims description 5
- 208000020816 lung neoplasm Diseases 0.000 claims description 5
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 5
- 201000001441 melanoma Diseases 0.000 claims description 5
- 208000002154 non-small cell lung carcinoma Diseases 0.000 claims description 5
- 201000002528 pancreatic cancer Diseases 0.000 claims description 5
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 5
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 5
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 claims description 5
- HVVMMAOQONKVON-UHFFFAOYSA-N 1-n'-[2,5-difluoro-4-[2-[(2-fluoro-2-methylpropanoyl)amino]pyridin-4-yl]oxyphenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)C(C)(F)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 HVVMMAOQONKVON-UHFFFAOYSA-N 0.000 claims description 4
- UTBXIRBUAUMOFR-UHFFFAOYSA-N 1-n'-[2,5-difluoro-4-[2-[(2-methoxyacetyl)amino]pyridin-4-yl]oxyphenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)COC)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 UTBXIRBUAUMOFR-UHFFFAOYSA-N 0.000 claims description 4
- QSMBNJYWRFZRLZ-UHFFFAOYSA-N 1-n'-[4-[2-(azetidine-3-carbonylamino)pyridin-4-yl]oxy-2,5-difluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=CC(F)=CC=C1NC(=O)C1(C(=O)NC=2C(=CC(OC=3C=C(NC(=O)C4CNC4)N=CC=3)=C(F)C=2)F)CC1 QSMBNJYWRFZRLZ-UHFFFAOYSA-N 0.000 claims description 4
- PRXXUUDSMHUXSS-UHFFFAOYSA-N 1-n'-[4-[2-(cyclobutanecarbonylamino)pyridin-4-yl]oxy-2,5-difluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=CC(F)=CC=C1NC(=O)C1(C(=O)NC=2C(=CC(OC=3C=C(NC(=O)C4CCC4)N=CC=3)=C(F)C=2)F)CC1 PRXXUUDSMHUXSS-UHFFFAOYSA-N 0.000 claims description 4
- GNNDEPIMDAZHRQ-UHFFFAOYSA-N 1-n'-[4-[2-(cyclopropanecarbonylamino)pyridin-4-yl]oxy-2,5-difluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=CC(F)=CC=C1NC(=O)C1(C(=O)NC=2C(=CC(OC=3C=C(NC(=O)C4CC4)N=CC=3)=C(F)C=2)F)CC1 GNNDEPIMDAZHRQ-UHFFFAOYSA-N 0.000 claims description 4
- JPEGWEXLPVMJEI-UHFFFAOYSA-N 1-n'-[4-[2-[[2-(dimethylamino)acetyl]amino]pyridin-4-yl]oxy-2,5-difluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)CN(C)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 JPEGWEXLPVMJEI-UHFFFAOYSA-N 0.000 claims description 4
- 125000003392 indanyl group Chemical group C1(CCC2=CC=CC=C12)* 0.000 claims description 4
- 125000003454 indenyl group Chemical group C1(C=CC2=CC=CC=C12)* 0.000 claims description 4
- 125000001624 naphthyl group Chemical group 0.000 claims description 4
- 125000001712 tetrahydronaphthyl group Chemical group C1(CCCC2=CC=CC=C12)* 0.000 claims description 4
- YHZMFCIQHCKQGJ-AWEZNQCLSA-N 1-n'-[2,5-difluoro-4-[2-[[(2s)-2-methoxypropanoyl]amino]pyridin-4-yl]oxyphenyl]-1-n'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)[C@H](C)OC)=CC(OC=2C(=CC(=C(F)C=2)N(C(=O)C2(CC2)C(N)=O)C=2C=CC(F)=CC=2)F)=C1 YHZMFCIQHCKQGJ-AWEZNQCLSA-N 0.000 claims description 3
- WLSYPGHMVDFQRN-UHFFFAOYSA-N 1-n'-[4-[2-[(2-cyanoacetyl)amino]pyridin-4-yl]oxy-2,5-difluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=CC(F)=CC=C1NC(=O)C1(C(=O)NC=2C(=CC(OC=3C=C(NC(=O)CC#N)N=CC=3)=C(F)C=2)F)CC1 WLSYPGHMVDFQRN-UHFFFAOYSA-N 0.000 claims description 3
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 claims description 3
- 201000004569 Blindness Diseases 0.000 claims description 3
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 claims description 3
- 206010012689 Diabetic retinopathy Diseases 0.000 claims description 3
- 206010051066 Gastrointestinal stromal tumour Diseases 0.000 claims description 3
- 241000124008 Mammalia Species 0.000 claims description 3
- 206010027406 Mesothelioma Diseases 0.000 claims description 3
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 claims description 3
- 208000022873 Ocular disease Diseases 0.000 claims description 3
- 206010033701 Papillary thyroid cancer Diseases 0.000 claims description 3
- 206010038923 Retinopathy Diseases 0.000 claims description 3
- AXIPFEYBCCZPJU-AWEZNQCLSA-N [(2s)-1-[[4-[2,5-difluoro-4-[[1-[(4-fluorophenyl)carbamoyl]cyclopropanecarbonyl]amino]phenoxy]pyridin-2-yl]amino]-1-oxopropan-2-yl] acetate Chemical compound C1=NC(NC(=O)[C@@H](OC(C)=O)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 AXIPFEYBCCZPJU-AWEZNQCLSA-N 0.000 claims description 3
- 239000000654 additive Substances 0.000 claims description 3
- 230000000996 additive effect Effects 0.000 claims description 3
- 239000002671 adjuvant Substances 0.000 claims description 3
- 206010064930 age-related macular degeneration Diseases 0.000 claims description 3
- 230000033115 angiogenesis Effects 0.000 claims description 3
- 208000006673 asthma Diseases 0.000 claims description 3
- 230000001684 chronic effect Effects 0.000 claims description 3
- 239000003937 drug carrier Substances 0.000 claims description 3
- 201000011243 gastrointestinal stromal tumor Diseases 0.000 claims description 3
- 208000032839 leukemia Diseases 0.000 claims description 3
- 208000014018 liver neoplasm Diseases 0.000 claims description 3
- 208000002780 macular degeneration Diseases 0.000 claims description 3
- 208000000516 mast-cell leukemia Diseases 0.000 claims description 3
- 208000008585 mastocytosis Diseases 0.000 claims description 3
- 208000030159 metabolic disease Diseases 0.000 claims description 3
- 230000004770 neurodegeneration Effects 0.000 claims description 3
- 208000015122 neurodegenerative disease Diseases 0.000 claims description 3
- 230000000414 obstructive effect Effects 0.000 claims description 3
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 3
- 239000003381 stabilizer Substances 0.000 claims description 3
- 208000030045 thyroid gland papillary carcinoma Diseases 0.000 claims description 3
- YHZMFCIQHCKQGJ-CQSZACIVSA-N 1-n'-[2,5-difluoro-4-[2-[[(2r)-2-methoxypropanoyl]amino]pyridin-4-yl]oxyphenyl]-1-n'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)[C@@H](C)OC)=CC(OC=2C(=CC(=C(F)C=2)N(C(=O)C2(CC2)C(N)=O)C=2C=CC(F)=CC=2)F)=C1 YHZMFCIQHCKQGJ-CQSZACIVSA-N 0.000 claims description 2
- JSZREPMBHVOAAG-UHFFFAOYSA-N 1-n'-[4-[2-(cyclopropanecarbonylamino)pyridin-4-yl]oxy-2,5-difluorophenyl]-1-n'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C=1C=C(F)C=CC=1N(C=1C(=CC(OC=2C=C(NC(=O)C3CC3)N=CC=2)=C(F)C=1)F)C(=O)C1(C(=O)N)CC1 JSZREPMBHVOAAG-UHFFFAOYSA-N 0.000 claims description 2
- DPOPAJRDYZGTIR-UHFFFAOYSA-N Tetrazine Chemical compound C1=CN=NN=N1 DPOPAJRDYZGTIR-UHFFFAOYSA-N 0.000 claims description 2
- 230000002685 pulmonary effect Effects 0.000 claims description 2
- ZYAVIILSHQPKCL-CYBMUJFWSA-N 1-n'-[2,5-difluoro-4-[2-[[(2r)-2-hydroxypropanoyl]amino]pyridin-4-yl]oxyphenyl]-1-n'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)[C@H](O)C)=CC(OC=2C(=CC(=C(F)C=2)N(C(=O)C2(CC2)C(N)=O)C=2C=CC(F)=CC=2)F)=C1 ZYAVIILSHQPKCL-CYBMUJFWSA-N 0.000 claims 1
- BITBPXMBNBFPEI-UHFFFAOYSA-N 1-n'-[4-(2-acetamidopyridin-4-yl)oxy-2,5-difluorophenyl]-1-n'-phenylcyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)C)=CC(OC=2C(=CC(=C(F)C=2)N(C(=O)C2(CC2)C(N)=O)C=2C=CC=CC=2)F)=C1 BITBPXMBNBFPEI-UHFFFAOYSA-N 0.000 claims 1
- UWZLYCYQEULUQN-UHFFFAOYSA-N 1-n'-[4-(2-acetamidopyridin-4-yl)oxy-5-chloro-2-fluorophenyl]-1-n'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)C)=CC(OC=2C(=CC(=C(F)C=2)N(C(=O)C2(CC2)C(N)=O)C=2C=CC(F)=CC=2)Cl)=C1 UWZLYCYQEULUQN-UHFFFAOYSA-N 0.000 claims 1
- CZWMEAAFMVCWAU-UHFFFAOYSA-N 1-n'-[4-(2-acetamidopyrimidin-4-yl)oxy-2,5-difluorophenyl]-1-n'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound CC(=O)NC1=NC=CC(OC=2C(=CC(=C(F)C=2)N(C(=O)C2(CC2)C(N)=O)C=2C=CC(F)=CC=2)F)=N1 CZWMEAAFMVCWAU-UHFFFAOYSA-N 0.000 claims 1
- BGCPRGCBJIHSFQ-UHFFFAOYSA-N 1-n'-[4-[2-(2,2-dimethylpropanoylamino)pyridin-4-yl]oxy-2,5-difluorophenyl]-1-n'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)C(C)(C)C)=CC(OC=2C(=CC(=C(F)C=2)N(C(=O)C2(CC2)C(N)=O)C=2C=CC(F)=CC=2)F)=C1 BGCPRGCBJIHSFQ-UHFFFAOYSA-N 0.000 claims 1
- 241000282414 Homo sapiens Species 0.000 abstract description 11
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 118
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 54
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 52
- IAZDPXIOMUYVGZ-WFGJKAKNSA-N Dimethyl sulfoxide Chemical compound [2H]C([2H])([2H])S(=O)C([2H])([2H])[2H] IAZDPXIOMUYVGZ-WFGJKAKNSA-N 0.000 description 50
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 50
- 239000011541 reaction mixture Substances 0.000 description 49
- 239000000243 solution Substances 0.000 description 46
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 42
- 235000019439 ethyl acetate Nutrition 0.000 description 41
- 238000006243 chemical reaction Methods 0.000 description 38
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 36
- 238000005160 1H NMR spectroscopy Methods 0.000 description 33
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 33
- 239000012267 brine Substances 0.000 description 32
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 32
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 29
- CXNIUSPIQKWYAI-UHFFFAOYSA-N xantphos Chemical compound C=12OC3=C(P(C=4C=CC=CC=4)C=4C=CC=CC=4)C=CC=C3C(C)(C)C2=CC=CC=1P(C=1C=CC=CC=1)C1=CC=CC=C1 CXNIUSPIQKWYAI-UHFFFAOYSA-N 0.000 description 28
- 229910052786 argon Inorganic materials 0.000 description 27
- 239000012044 organic layer Substances 0.000 description 27
- 239000007787 solid Substances 0.000 description 27
- 0 B.CC.[3*]CC1=CC(OC2=C(C)C=C(NC(=O)C3(C(=O)NC4=CC=CC=C4)CC3)C(F)=C2)=CC=N1 Chemical compound B.CC.[3*]CC1=CC(OC2=C(C)C=C(NC(=O)C3(C(=O)NC4=CC=CC=C4)CC3)C(F)=C2)=CC=N1 0.000 description 26
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 24
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 21
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 21
- 230000002829 reductive effect Effects 0.000 description 21
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 20
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 20
- 230000005764 inhibitory process Effects 0.000 description 19
- -1 thiene Chemical compound 0.000 description 19
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 18
- 239000002253 acid Substances 0.000 description 18
- 229910052757 nitrogen Inorganic materials 0.000 description 18
- 101001106413 Homo sapiens Macrophage-stimulating protein receptor Proteins 0.000 description 17
- 102100021435 Macrophage-stimulating protein receptor Human genes 0.000 description 17
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 17
- 238000003556 assay Methods 0.000 description 17
- 238000010898 silica gel chromatography Methods 0.000 description 17
- 150000001412 amines Chemical class 0.000 description 16
- 239000002904 solvent Substances 0.000 description 16
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 15
- ZKHQWZAMYRWXGA-UHFFFAOYSA-N Adenosine triphosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)C(O)C1O ZKHQWZAMYRWXGA-UHFFFAOYSA-N 0.000 description 15
- 210000004027 cell Anatomy 0.000 description 15
- 239000003112 inhibitor Substances 0.000 description 15
- FPYJSJDOHRDAMT-KQWNVCNZSA-N 1h-indole-5-sulfonamide, n-(3-chlorophenyl)-3-[[3,5-dimethyl-4-[(4-methyl-1-piperazinyl)carbonyl]-1h-pyrrol-2-yl]methylene]-2,3-dihydro-n-methyl-2-oxo-, (3z)- Chemical compound C=1C=C2NC(=O)\C(=C/C3=C(C(C(=O)N4CCN(C)CC4)=C(C)N3)C)C2=CC=1S(=O)(=O)N(C)C1=CC=CC(Cl)=C1 FPYJSJDOHRDAMT-KQWNVCNZSA-N 0.000 description 14
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 14
- 239000000543 intermediate Substances 0.000 description 14
- JNGZXGGOCLZBFB-IVCQMTBJSA-N compound E Chemical compound N([C@@H](C)C(=O)N[C@@H]1C(N(C)C2=CC=CC=C2C(C=2C=CC=CC=2)=N1)=O)C(=O)CC1=CC(F)=CC(F)=C1 JNGZXGGOCLZBFB-IVCQMTBJSA-N 0.000 description 13
- 229910052938 sodium sulfate Inorganic materials 0.000 description 13
- DLFVBJFMPXGRIB-UHFFFAOYSA-N Acetamide Chemical compound CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 12
- SJRJJKPEHAURKC-UHFFFAOYSA-N N-Methylmorpholine Chemical compound CN1CCOCC1 SJRJJKPEHAURKC-UHFFFAOYSA-N 0.000 description 12
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 12
- 239000010410 layer Substances 0.000 description 12
- KWGKDLIKAYFUFQ-UHFFFAOYSA-M lithium chloride Chemical compound [Li+].[Cl-] KWGKDLIKAYFUFQ-UHFFFAOYSA-M 0.000 description 12
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 12
- BOPGDPNILDQYTO-NNYOXOHSSA-N nicotinamide-adenine dinucleotide Chemical compound C1=CCC(C(=O)N)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C3=NC=NC(N)=C3N=C2)O)O1 BOPGDPNILDQYTO-NNYOXOHSSA-N 0.000 description 12
- 229930027945 nicotinamide-adenine dinucleotide Natural products 0.000 description 12
- 238000012360 testing method Methods 0.000 description 12
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 11
- 101000579425 Homo sapiens Proto-oncogene tyrosine-protein kinase receptor Ret Proteins 0.000 description 11
- FJDQFPXHSGXQBY-UHFFFAOYSA-L caesium carbonate Chemical compound [Cs+].[Cs+].[O-]C([O-])=O FJDQFPXHSGXQBY-UHFFFAOYSA-L 0.000 description 11
- 229910000024 caesium carbonate Inorganic materials 0.000 description 11
- 235000019341 magnesium sulphate Nutrition 0.000 description 11
- 108090000623 proteins and genes Proteins 0.000 description 11
- PAYRUJLWNCNPSJ-UHFFFAOYSA-N Aniline Chemical compound NC1=CC=CC=C1 PAYRUJLWNCNPSJ-UHFFFAOYSA-N 0.000 description 10
- 102000003855 L-lactate dehydrogenase Human genes 0.000 description 10
- 108700023483 L-lactate dehydrogenases Proteins 0.000 description 10
- 102100028286 Proto-oncogene tyrosine-protein kinase receptor Ret Human genes 0.000 description 10
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 10
- 102000013009 Pyruvate Kinase Human genes 0.000 description 10
- 108020005115 Pyruvate Kinase Proteins 0.000 description 10
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 10
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 10
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 10
- 125000004429 atom Chemical group 0.000 description 10
- 239000002585 base Substances 0.000 description 10
- 229910001629 magnesium chloride Inorganic materials 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- 125000006413 ring segment Chemical group 0.000 description 10
- FQNDKOURIMYEJE-UHFFFAOYSA-N 1-n'-[4-(2-chloropyridin-4-yl)oxy-2,5-difluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=CC(F)=CC=C1NC(=O)C1(C(=O)NC=2C(=CC(OC=3C=C(Cl)N=CC=3)=C(F)C=2)F)CC1 FQNDKOURIMYEJE-UHFFFAOYSA-N 0.000 description 9
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 9
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 9
- 238000005859 coupling reaction Methods 0.000 description 9
- 238000000021 kinase assay Methods 0.000 description 9
- KDLHZDBZIXYQEI-UHFFFAOYSA-N palladium Substances [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 9
- 229920006395 saturated elastomer Polymers 0.000 description 9
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 9
- 235000011152 sodium sulphate Nutrition 0.000 description 9
- ATGCOUHBQPKRIY-UHFFFAOYSA-N 1-n'-[4-(2-aminopyridin-4-yl)oxy-2,5-difluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(N)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 ATGCOUHBQPKRIY-UHFFFAOYSA-N 0.000 description 8
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 8
- 239000000460 chlorine Substances 0.000 description 8
- 230000008878 coupling Effects 0.000 description 8
- 238000010168 coupling process Methods 0.000 description 8
- 239000000706 filtrate Substances 0.000 description 8
- 239000003921 oil Substances 0.000 description 8
- 235000019198 oils Nutrition 0.000 description 8
- 229910052760 oxygen Inorganic materials 0.000 description 8
- 239000000758 substrate Substances 0.000 description 8
- 238000000967 suction filtration Methods 0.000 description 8
- FYSNRJHAOHDILO-UHFFFAOYSA-N thionyl chloride Chemical compound ClS(Cl)=O FYSNRJHAOHDILO-UHFFFAOYSA-N 0.000 description 8
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 8
- XTWYTFMLZFPYCI-KQYNXXCUSA-N 5'-adenylphosphoric acid Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O XTWYTFMLZFPYCI-KQYNXXCUSA-N 0.000 description 7
- XTWYTFMLZFPYCI-UHFFFAOYSA-N Adenosine diphosphate Natural products C1=NC=2C(N)=NC=NC=2N1C1OC(COP(O)(=O)OP(O)(O)=O)C(O)C1O XTWYTFMLZFPYCI-UHFFFAOYSA-N 0.000 description 7
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 7
- 150000001408 amides Chemical class 0.000 description 7
- 229910052731 fluorine Inorganic materials 0.000 description 7
- 230000000670 limiting effect Effects 0.000 description 7
- YJVFFLUZDVXJQI-UHFFFAOYSA-L palladium(ii) acetate Chemical compound [Pd+2].CC([O-])=O.CC([O-])=O YJVFFLUZDVXJQI-UHFFFAOYSA-L 0.000 description 7
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 6
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 6
- OKKJLVBELUTLKV-MZCSYVLQSA-N Deuterated methanol Chemical compound [2H]OC([2H])([2H])[2H] OKKJLVBELUTLKV-MZCSYVLQSA-N 0.000 description 6
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 6
- 239000007821 HATU Substances 0.000 description 6
- 102000001253 Protein Kinase Human genes 0.000 description 6
- 239000004202 carbamide Substances 0.000 description 6
- 150000001732 carboxylic acid derivatives Chemical group 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 229910052801 chlorine Inorganic materials 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 6
- 125000004433 nitrogen atom Chemical group N* 0.000 description 6
- HEGSGKPQLMEBJL-RKQHYHRCSA-N octyl beta-D-glucopyranoside Chemical compound CCCCCCCCO[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O HEGSGKPQLMEBJL-RKQHYHRCSA-N 0.000 description 6
- 108060006633 protein kinase Proteins 0.000 description 6
- 238000010992 reflux Methods 0.000 description 6
- 239000011369 resultant mixture Substances 0.000 description 6
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical group [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 5
- 239000007995 HEPES buffer Substances 0.000 description 5
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 5
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 5
- 239000007983 Tris buffer Substances 0.000 description 5
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 5
- 238000010521 absorption reaction Methods 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 229910052799 carbon Inorganic materials 0.000 description 5
- 238000004128 high performance liquid chromatography Methods 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 230000003647 oxidation Effects 0.000 description 5
- 238000007254 oxidation reaction Methods 0.000 description 5
- 239000001301 oxygen Substances 0.000 description 5
- 238000005897 peptide coupling reaction Methods 0.000 description 5
- 229930029653 phosphoenolpyruvate Natural products 0.000 description 5
- DTBNBXWJWCWCIK-UHFFFAOYSA-N phosphoenolpyruvic acid Chemical compound OC(=O)C(=C)OP(O)(O)=O DTBNBXWJWCWCIK-UHFFFAOYSA-N 0.000 description 5
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 5
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- YLQBMQCUIZJEEH-UHFFFAOYSA-N tetrahydrofuran Natural products C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 5
- PFMAFXYUHZDKPY-UHFFFAOYSA-N 1-[(4-fluorophenyl)carbamoyl]cyclopropane-1-carboxylic acid Chemical compound C=1C=C(F)C=CC=1NC(=O)C1(C(=O)O)CC1 PFMAFXYUHZDKPY-UHFFFAOYSA-N 0.000 description 4
- IEQAICDLOKRSRL-UHFFFAOYSA-N 2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-dodecoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethanol Chemical compound CCCCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO IEQAICDLOKRSRL-UHFFFAOYSA-N 0.000 description 4
- VBEHFOMFHUQAOW-UHFFFAOYSA-N 2-chloro-1h-pyridin-4-one Chemical compound OC1=CC=NC(Cl)=C1 VBEHFOMFHUQAOW-UHFFFAOYSA-N 0.000 description 4
- YOETUEMZNOLGDB-UHFFFAOYSA-N 2-methylpropyl carbonochloridate Chemical compound CC(C)COC(Cl)=O YOETUEMZNOLGDB-UHFFFAOYSA-N 0.000 description 4
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 4
- 238000007167 Hofmann rearrangement reaction Methods 0.000 description 4
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 4
- 239000007832 Na2SO4 Substances 0.000 description 4
- 229910020700 Na3VO4 Inorganic materials 0.000 description 4
- 235000019502 Orange oil Nutrition 0.000 description 4
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 4
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 4
- WHBMMWSBFZVSSR-UHFFFAOYSA-N R3HBA Natural products CC(O)CC(O)=O WHBMMWSBFZVSSR-UHFFFAOYSA-N 0.000 description 4
- KEAYESYHFKHZAL-UHFFFAOYSA-N Sodium Chemical compound [Na] KEAYESYHFKHZAL-UHFFFAOYSA-N 0.000 description 4
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 4
- HEDRZPFGACZZDS-MICDWDOJSA-N Trichloro(2H)methane Chemical compound [2H]C(Cl)(Cl)Cl HEDRZPFGACZZDS-MICDWDOJSA-N 0.000 description 4
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 4
- 229910052783 alkali metal Inorganic materials 0.000 description 4
- 125000000304 alkynyl group Chemical group 0.000 description 4
- 235000019270 ammonium chloride Nutrition 0.000 description 4
- 239000012043 crude product Substances 0.000 description 4
- 150000004820 halides Chemical class 0.000 description 4
- 229940043355 kinase inhibitor Drugs 0.000 description 4
- 150000007522 mineralic acids Chemical class 0.000 description 4
- 239000010502 orange oil Substances 0.000 description 4
- 150000007524 organic acids Chemical class 0.000 description 4
- 239000002953 phosphate buffered saline Substances 0.000 description 4
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 4
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 4
- 230000003389 potentiating effect Effects 0.000 description 4
- 239000002244 precipitate Substances 0.000 description 4
- 108090000765 processed proteins & peptides Proteins 0.000 description 4
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 4
- 150000003384 small molecules Chemical class 0.000 description 4
- 239000012312 sodium hydride Substances 0.000 description 4
- 229910000104 sodium hydride Inorganic materials 0.000 description 4
- 125000001424 substituent group Chemical group 0.000 description 4
- IHIXIJGXTJIKRB-UHFFFAOYSA-N trisodium vanadate Chemical compound [Na+].[Na+].[Na+].[O-][V]([O-])([O-])=O IHIXIJGXTJIKRB-UHFFFAOYSA-N 0.000 description 4
- PORMSSHVBFZGAT-UHFFFAOYSA-N 1-n'-[4-(2-acetamidopyridin-4-yl)oxy-2,5-difluorophenyl]-1-n-phenylcyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC=CC=3)=C(F)C=2)F)=C1 PORMSSHVBFZGAT-UHFFFAOYSA-N 0.000 description 3
- VJSYQFGUDJRCMR-UHFFFAOYSA-N 1-n'-[4-(2-acetamidopyridin-4-yl)oxy-5-chloro-2-fluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)Cl)=C1 VJSYQFGUDJRCMR-UHFFFAOYSA-N 0.000 description 3
- BAEOIAVGXBJPQH-UHFFFAOYSA-N 1-n'-[4-(2-acetamidopyrimidin-4-yl)oxy-2,5-difluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound CC(=O)NC1=NC=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=N1 BAEOIAVGXBJPQH-UHFFFAOYSA-N 0.000 description 3
- ASBXOTJHWOHLPN-UHFFFAOYSA-N 1-n'-[4-[2-(2,2-dimethylpropanoylamino)pyridin-4-yl]oxy-2,5-difluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)C(C)(C)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 ASBXOTJHWOHLPN-UHFFFAOYSA-N 0.000 description 3
- NGNBDVOYPDDBFK-UHFFFAOYSA-N 2-[2,4-di(pentan-2-yl)phenoxy]acetyl chloride Chemical class CCCC(C)C1=CC=C(OCC(Cl)=O)C(C(C)CCC)=C1 NGNBDVOYPDDBFK-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- WFDIJRYMOXRFFG-UHFFFAOYSA-N Acetic anhydride Chemical compound CC(=O)OC(C)=O WFDIJRYMOXRFFG-UHFFFAOYSA-N 0.000 description 3
- 244000144730 Amygdalus persica Species 0.000 description 3
- UHOVQNZJYSORNB-UHFFFAOYSA-N Benzene Chemical compound C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- FXHOOIRPVKKKFG-UHFFFAOYSA-N N,N-Dimethylacetamide Chemical compound CN(C)C(C)=O FXHOOIRPVKKKFG-UHFFFAOYSA-N 0.000 description 3
- 108700020796 Oncogene Proteins 0.000 description 3
- 235000006040 Prunus persica var persica Nutrition 0.000 description 3
- RWRDLPDLKQPQOW-UHFFFAOYSA-N Pyrrolidine Chemical compound C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 description 3
- 150000001413 amino acids Chemical class 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 230000003197 catalytic effect Effects 0.000 description 3
- 210000000349 chromosome Anatomy 0.000 description 3
- 239000007822 coupling agent Substances 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 238000001914 filtration Methods 0.000 description 3
- 235000019000 fluorine Nutrition 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 description 3
- 230000037361 pathway Effects 0.000 description 3
- 125000006239 protecting group Chemical group 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- CXWXQJXEFPUFDZ-UHFFFAOYSA-N tetralin Chemical compound C1=CC=C2CCCCC2=C1 CXWXQJXEFPUFDZ-UHFFFAOYSA-N 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- ILWRPSCZWQJDMK-UHFFFAOYSA-N triethylazanium;chloride Chemical compound Cl.CCN(CC)CC ILWRPSCZWQJDMK-UHFFFAOYSA-N 0.000 description 3
- CYPYTURSJDMMMP-WVCUSYJESA-N (1e,4e)-1,5-diphenylpenta-1,4-dien-3-one;palladium Chemical compound [Pd].[Pd].C=1C=CC=CC=1\C=C\C(=O)\C=C\C1=CC=CC=C1.C=1C=CC=CC=1\C=C\C(=O)\C=C\C1=CC=CC=C1.C=1C=CC=CC=1\C=C\C(=O)\C=C\C1=CC=CC=C1 CYPYTURSJDMMMP-WVCUSYJESA-N 0.000 description 2
- ROJNMGYMBLNTPK-UHFFFAOYSA-N 1,2,4-trifluoro-5-nitrobenzene Chemical compound [O-][N+](=O)C1=CC(F)=C(F)C=C1F ROJNMGYMBLNTPK-UHFFFAOYSA-N 0.000 description 2
- KDXROTVXLGAFGW-UHFFFAOYSA-N 1-(phenylcarbamoyl)cyclopropane-1-carboxylic acid Chemical compound C=1C=CC=CC=1NC(=O)C1(C(=O)O)CC1 KDXROTVXLGAFGW-UHFFFAOYSA-N 0.000 description 2
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide Substances CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 2
- UIOYEIHBWQTVJC-UHFFFAOYSA-N 1-chloro-2,4-difluoro-5-nitrobenzene Chemical compound [O-][N+](=O)C1=CC(Cl)=C(F)C=C1F UIOYEIHBWQTVJC-UHFFFAOYSA-N 0.000 description 2
- IZYOHLOUZVEIOS-UHFFFAOYSA-N 1-methoxycarbonylcyclopropane-1-carboxylic acid Chemical compound COC(=O)C1(C(O)=O)CC1 IZYOHLOUZVEIOS-UHFFFAOYSA-N 0.000 description 2
- CIVOREZLHOQUQB-CQSZACIVSA-N 1-n'-[2,5-difluoro-4-[2-[[(2r)-2-methoxypropanoyl]amino]pyridin-4-yl]oxyphenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)[C@@H](C)OC)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 CIVOREZLHOQUQB-CQSZACIVSA-N 0.000 description 2
- JRPOXRAOJBBOHD-LJQANCHMSA-N 1-n'-[2,5-difluoro-4-[2-[[(2r)-2-phenylmethoxypropanoyl]amino]pyridin-4-yl]oxyphenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound O([C@H](C)C(=O)NC=1N=CC=C(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)C=1)CC1=CC=CC=C1 JRPOXRAOJBBOHD-LJQANCHMSA-N 0.000 description 2
- AXNJWXAVZBGRDD-UHFFFAOYSA-N 1-n'-[2-fluoro-4-[2-[(4-methoxyphenyl)methylamino]pyridin-4-yl]oxyphenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=CC(OC)=CC=C1CNC1=CC(OC=2C=C(F)C(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=CC=2)=CC=N1 AXNJWXAVZBGRDD-UHFFFAOYSA-N 0.000 description 2
- QUBOPRNQZGEHSB-UHFFFAOYSA-N 1-n'-[4-(2-aminopyridin-4-yl)oxy-2-fluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(N)=CC(OC=2C=C(F)C(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=CC=2)=C1 QUBOPRNQZGEHSB-UHFFFAOYSA-N 0.000 description 2
- XYTOWKCGFNGPFY-UHFFFAOYSA-N 1-n'-[4-(2-chloropyridin-4-yl)oxy-2,5-difluorophenyl]-1-n-phenylcyclopropane-1,1-dicarboxamide Chemical compound FC=1C=C(NC(=O)C2(CC2)C(=O)NC=2C=CC=CC=2)C(F)=CC=1OC1=CC=NC(Cl)=C1 XYTOWKCGFNGPFY-UHFFFAOYSA-N 0.000 description 2
- SPJCGTWMKVFOLQ-UHFFFAOYSA-N 1-n'-[5-chloro-4-(2-chloropyridin-4-yl)oxy-2-fluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=CC(F)=CC=C1NC(=O)C1(C(=O)NC=2C(=CC(OC=3C=C(Cl)N=CC=3)=C(Cl)C=2)F)CC1 SPJCGTWMKVFOLQ-UHFFFAOYSA-N 0.000 description 2
- WKJOQYHMXRVQDK-UHFFFAOYSA-N 2-(dimethylamino)acetamide Chemical compound CN(C)CC(N)=O WKJOQYHMXRVQDK-UHFFFAOYSA-N 0.000 description 2
- IUVCFHHAEHNCFT-INIZCTEOSA-N 2-[(1s)-1-[4-amino-3-(3-fluoro-4-propan-2-yloxyphenyl)pyrazolo[3,4-d]pyrimidin-1-yl]ethyl]-6-fluoro-3-(3-fluorophenyl)chromen-4-one Chemical compound C1=C(F)C(OC(C)C)=CC=C1C(C1=C(N)N=CN=C11)=NN1[C@@H](C)C1=C(C=2C=C(F)C=CC=2)C(=O)C2=CC(F)=CC=C2O1 IUVCFHHAEHNCFT-INIZCTEOSA-N 0.000 description 2
- HVLWVQWJVRJRDF-UHFFFAOYSA-N 2-chloro-4-(2,5-difluoro-4-nitrophenoxy)pyridine Chemical compound C1=C(F)C([N+](=O)[O-])=CC(F)=C1OC1=CC=NC(Cl)=C1 HVLWVQWJVRJRDF-UHFFFAOYSA-N 0.000 description 2
- OJZDPULGDINJTJ-UHFFFAOYSA-N 2-chloro-4-(2-chloro-5-fluoro-4-nitrophenoxy)pyridine Chemical compound C1=C(F)C([N+](=O)[O-])=CC(Cl)=C1OC1=CC=NC(Cl)=C1 OJZDPULGDINJTJ-UHFFFAOYSA-N 0.000 description 2
- FNRMMDCDHWCQTH-UHFFFAOYSA-N 2-chloropyridine;3-chloropyridine;4-chloropyridine Chemical compound ClC1=CC=NC=C1.ClC1=CC=CN=C1.ClC1=CC=CC=N1 FNRMMDCDHWCQTH-UHFFFAOYSA-N 0.000 description 2
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 2
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 2
- HSFWRNGVRCDJHI-UHFFFAOYSA-N Acetylene Chemical compound C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 description 2
- KXDAEFPNCMNJSK-UHFFFAOYSA-N Benzamide Chemical compound NC(=O)C1=CC=CC=C1 KXDAEFPNCMNJSK-UHFFFAOYSA-N 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- WKBOTKDWSSQWDR-UHFFFAOYSA-N Bromine atom Chemical compound [Br] WKBOTKDWSSQWDR-UHFFFAOYSA-N 0.000 description 2
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 2
- JGLMVXWAHNTPRF-CMDGGOBGSA-N CCN1N=C(C)C=C1C(=O)NC1=NC2=CC(=CC(OC)=C2N1C\C=C\CN1C(NC(=O)C2=CC(C)=NN2CC)=NC2=CC(=CC(OCCCN3CCOCC3)=C12)C(N)=O)C(N)=O Chemical compound CCN1N=C(C)C=C1C(=O)NC1=NC2=CC(=CC(OC)=C2N1C\C=C\CN1C(NC(=O)C2=CC(C)=NN2CC)=NC2=CC(=CC(OCCCN3CCOCC3)=C12)C(N)=O)C(N)=O JGLMVXWAHNTPRF-CMDGGOBGSA-N 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 2
- DSLZVSRJTYRBFB-UHFFFAOYSA-N Galactaric acid Natural products OC(=O)C(O)C(O)C(O)C(O)C(O)=O DSLZVSRJTYRBFB-UHFFFAOYSA-N 0.000 description 2
- IAJILQKETJEXLJ-UHFFFAOYSA-N Galacturonsaeure Natural products O=CC(O)C(O)C(O)C(O)C(O)=O IAJILQKETJEXLJ-UHFFFAOYSA-N 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 2
- WMFOQBRAJBCJND-UHFFFAOYSA-M Lithium hydroxide Chemical compound [Li+].[OH-] WMFOQBRAJBCJND-UHFFFAOYSA-M 0.000 description 2
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 2
- 229910021380 Manganese Chloride Inorganic materials 0.000 description 2
- GLFNIEUTAYBVOC-UHFFFAOYSA-L Manganese chloride Chemical compound Cl[Mn]Cl GLFNIEUTAYBVOC-UHFFFAOYSA-L 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- UFWIBTONFRDIAS-UHFFFAOYSA-N Naphthalene Chemical compound C1=CC=CC2=CC=CC=C21 UFWIBTONFRDIAS-UHFFFAOYSA-N 0.000 description 2
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 2
- 108091007960 PI3Ks Proteins 0.000 description 2
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 2
- 102000003993 Phosphatidylinositol 3-kinases Human genes 0.000 description 2
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical compound C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- KYQCOXFCLRTKLS-UHFFFAOYSA-N Pyrazine Chemical compound C1=CN=CC=N1 KYQCOXFCLRTKLS-UHFFFAOYSA-N 0.000 description 2
- KAESVJOAVNADME-UHFFFAOYSA-N Pyrrole Chemical compound C=1C=CNC=1 KAESVJOAVNADME-UHFFFAOYSA-N 0.000 description 2
- PLXBWHJQWKZRKG-UHFFFAOYSA-N Resazurin Chemical compound C1=CC(=O)C=C2OC3=CC(O)=CC=C3[N+]([O-])=C21 PLXBWHJQWKZRKG-UHFFFAOYSA-N 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 239000012317 TBTU Substances 0.000 description 2
- CLZISMQKJZCZDN-UHFFFAOYSA-N [benzotriazol-1-yloxy(dimethylamino)methylidene]-dimethylazanium Chemical compound C1=CC=C2N(OC(N(C)C)=[N+](C)C)N=NC2=C1 CLZISMQKJZCZDN-UHFFFAOYSA-N 0.000 description 2
- WETWJCDKMRHUPV-UHFFFAOYSA-N acetyl chloride Chemical compound CC(Cl)=O WETWJCDKMRHUPV-UHFFFAOYSA-N 0.000 description 2
- 239000012346 acetyl chloride Substances 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000010933 acylation Effects 0.000 description 2
- 238000005917 acylation reaction Methods 0.000 description 2
- IAJILQKETJEXLJ-RSJOWCBRSA-N aldehydo-D-galacturonic acid Chemical compound O=C[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(O)=O IAJILQKETJEXLJ-RSJOWCBRSA-N 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- 150000001340 alkali metals Chemical class 0.000 description 2
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 2
- 150000001342 alkaline earth metals Chemical class 0.000 description 2
- 125000003545 alkoxy group Chemical group 0.000 description 2
- 229910052782 aluminium Inorganic materials 0.000 description 2
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 2
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 2
- 150000008064 anhydrides Chemical class 0.000 description 2
- JUHORIMYRDESRB-UHFFFAOYSA-N benzathine Chemical compound C=1C=CC=CC=1CNCCNCC1=CC=CC=C1 JUHORIMYRDESRB-UHFFFAOYSA-N 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Substances BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 2
- 229910052794 bromium Inorganic materials 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 2
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical compound OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 2
- 150000001735 carboxylic acids Chemical class 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 238000001516 cell proliferation assay Methods 0.000 description 2
- VDANGULDQQJODZ-UHFFFAOYSA-N chloroprocaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1Cl VDANGULDQQJODZ-UHFFFAOYSA-N 0.000 description 2
- 229960002023 chloroprocaine Drugs 0.000 description 2
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 2
- 229960001231 choline Drugs 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 238000001816 cooling Methods 0.000 description 2
- MLIREBYILWEBDM-UHFFFAOYSA-N cyanoacetic acid Chemical compound OC(=O)CC#N MLIREBYILWEBDM-UHFFFAOYSA-N 0.000 description 2
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 2
- 229940043237 diethanolamine Drugs 0.000 description 2
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 2
- 230000007705 epithelial mesenchymal transition Effects 0.000 description 2
- PQVSTLUFSYVLTO-UHFFFAOYSA-N ethyl n-ethoxycarbonylcarbamate Chemical compound CCOC(=O)NC(=O)OCC PQVSTLUFSYVLTO-UHFFFAOYSA-N 0.000 description 2
- 229940012017 ethylenediamine Drugs 0.000 description 2
- 238000001704 evaporation Methods 0.000 description 2
- 230000008020 evaporation Effects 0.000 description 2
- 230000005284 excitation Effects 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 125000001153 fluoro group Chemical group F* 0.000 description 2
- 239000006260 foam Substances 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- DSLZVSRJTYRBFB-DUHBMQHGSA-N galactaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)C(O)=O DSLZVSRJTYRBFB-DUHBMQHGSA-N 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 229910052739 hydrogen Inorganic materials 0.000 description 2
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- PQNFLJBBNBOBRQ-UHFFFAOYSA-N indane Chemical compound C1=CC=C2CCCC2=C1 PQNFLJBBNBOBRQ-UHFFFAOYSA-N 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 239000011630 iodine Substances 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 229910052744 lithium Inorganic materials 0.000 description 2
- GLXDVVHUTZTUQK-UHFFFAOYSA-M lithium hydroxide monohydrate Substances [Li+].O.[OH-] GLXDVVHUTZTUQK-UHFFFAOYSA-M 0.000 description 2
- 229940040692 lithium hydroxide monohydrate Drugs 0.000 description 2
- 239000011777 magnesium Substances 0.000 description 2
- 229910052749 magnesium Inorganic materials 0.000 description 2
- 239000011565 manganese chloride Substances 0.000 description 2
- 229960003194 meglumine Drugs 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 150000002739 metals Chemical class 0.000 description 2
- KICPULRXSYFMDC-UHFFFAOYSA-N methyl 1-(phenylcarbamoyl)cyclopropane-1-carboxylate Chemical compound C=1C=CC=CC=1NC(=O)C1(C(=O)OC)CC1 KICPULRXSYFMDC-UHFFFAOYSA-N 0.000 description 2
- BQEDPQDMNWOYLK-UHFFFAOYSA-N methyl 1-[(4-fluorophenyl)carbamoyl]cyclopropane-1-carboxylate Chemical compound C=1C=C(F)C=CC=1NC(=O)C1(C(=O)OC)CC1 BQEDPQDMNWOYLK-UHFFFAOYSA-N 0.000 description 2
- 150000004702 methyl esters Chemical class 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 239000002480 mineral oil Substances 0.000 description 2
- 235000010446 mineral oil Nutrition 0.000 description 2
- NDVQTYUSHOQHHU-UHFFFAOYSA-N n-(4,6-dichloropyrimidin-2-yl)acetamide Chemical compound CC(=O)NC1=NC(Cl)=CC(Cl)=N1 NDVQTYUSHOQHHU-UHFFFAOYSA-N 0.000 description 2
- CNSMDMZHDGOATP-UHFFFAOYSA-N n-[4-(4-amino-2,5-difluorophenoxy)-6-chloropyrimidin-2-yl]acetamide Chemical compound CC(=O)NC1=NC(Cl)=CC(OC=2C(=CC(N)=C(F)C=2)F)=N1 CNSMDMZHDGOATP-UHFFFAOYSA-N 0.000 description 2
- 108091008819 oncoproteins Proteins 0.000 description 2
- 102000027450 oncoproteins Human genes 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 125000000951 phenoxy group Chemical group [H]C1=C([H])C([H])=C(O*)C([H])=C1[H] 0.000 description 2
- WLJVXDMOQOGPHL-UHFFFAOYSA-N phenylacetic acid Chemical compound OC(=O)CC1=CC=CC=C1 WLJVXDMOQOGPHL-UHFFFAOYSA-N 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 229910052700 potassium Inorganic materials 0.000 description 2
- 239000011591 potassium Substances 0.000 description 2
- 229910000027 potassium carbonate Inorganic materials 0.000 description 2
- LPNYRYFBWFDTMA-UHFFFAOYSA-N potassium tert-butoxide Chemical compound [K+].CC(C)(C)[O-] LPNYRYFBWFDTMA-UHFFFAOYSA-N 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 150000003141 primary amines Chemical class 0.000 description 2
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 2
- 229960004919 procaine Drugs 0.000 description 2
- 238000000159 protein binding assay Methods 0.000 description 2
- 150000003242 quaternary ammonium salts Chemical class 0.000 description 2
- 238000010791 quenching Methods 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 150000003335 secondary amines Chemical class 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000013207 serial dilution Methods 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 235000017557 sodium bicarbonate Nutrition 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 2
- 150000003460 sulfonic acids Chemical class 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 238000003419 tautomerization reaction Methods 0.000 description 2
- ABMQUJMGQSICJJ-UHFFFAOYSA-N tert-butyl 3-[[4-[2,5-difluoro-4-[[1-[(4-fluorophenyl)carbamoyl]cyclopropanecarbonyl]amino]phenoxy]pyridin-2-yl]carbamoyl]azetidine-1-carboxylate Chemical compound C1N(C(=O)OC(C)(C)C)CC1C(=O)NC1=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=CC=N1 ABMQUJMGQSICJJ-UHFFFAOYSA-N 0.000 description 2
- 150000003512 tertiary amines Chemical class 0.000 description 2
- BRNULMACUQOKMR-UHFFFAOYSA-N thiomorpholine Chemical compound C1CSCCN1 BRNULMACUQOKMR-UHFFFAOYSA-N 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 229960000281 trometamol Drugs 0.000 description 2
- 229910052725 zinc Inorganic materials 0.000 description 2
- 239000011701 zinc Substances 0.000 description 2
- ICPWFHKNYYRBSZ-GSVOUGTGSA-N (2r)-2-methoxypropanoic acid Chemical compound CO[C@H](C)C(O)=O ICPWFHKNYYRBSZ-GSVOUGTGSA-N 0.000 description 1
- XWAVPOFYNPXXEL-MRVPVSSYSA-N (2r)-2-phenylmethoxypropanoic acid Chemical compound OC(=O)[C@@H](C)OCC1=CC=CC=C1 XWAVPOFYNPXXEL-MRVPVSSYSA-N 0.000 description 1
- INIKTCFEWCCJMM-WCCKRBBISA-N (2s)-2-(trifluoromethyl)morpholine;hydrochloride Chemical compound Cl.FC(F)(F)[C@@H]1CNCCO1 INIKTCFEWCCJMM-WCCKRBBISA-N 0.000 description 1
- WTLNOANVTIKPEE-VKHMYHEASA-N (2s)-2-acetyloxypropanoic acid Chemical compound OC(=O)[C@H](C)OC(C)=O WTLNOANVTIKPEE-VKHMYHEASA-N 0.000 description 1
- ICPWFHKNYYRBSZ-VKHMYHEASA-N (2s)-2-methoxypropanoic acid Chemical compound CO[C@@H](C)C(O)=O ICPWFHKNYYRBSZ-VKHMYHEASA-N 0.000 description 1
- JYEUMXHLPRZUAT-UHFFFAOYSA-N 1,2,3-triazine Chemical compound C1=CN=NN=C1 JYEUMXHLPRZUAT-UHFFFAOYSA-N 0.000 description 1
- CXWGKAYMVASWDQ-UHFFFAOYSA-N 1,2-dithiane Chemical compound C1CCSSC1 CXWGKAYMVASWDQ-UHFFFAOYSA-N 0.000 description 1
- WNXJIVFYUVYPPR-UHFFFAOYSA-N 1,3-dioxolane Chemical compound C1COCO1 WNXJIVFYUVYPPR-UHFFFAOYSA-N 0.000 description 1
- IMLSAISZLJGWPP-UHFFFAOYSA-N 1,3-dithiolane Chemical compound C1CSCS1 IMLSAISZLJGWPP-UHFFFAOYSA-N 0.000 description 1
- OGYGFUAIIOPWQD-UHFFFAOYSA-N 1,3-thiazolidine Chemical compound C1CSCN1 OGYGFUAIIOPWQD-UHFFFAOYSA-N 0.000 description 1
- YHIIJNLSGULWAA-UHFFFAOYSA-N 1,4-thiazinane 1-oxide Chemical compound O=S1CCNCC1 YHIIJNLSGULWAA-UHFFFAOYSA-N 0.000 description 1
- JOCCFZHFPCIWQU-UHFFFAOYSA-N 1-(phenylcarbamoyl)cyclopropane-1-carbonyl chloride Chemical compound C=1C=CC=CC=1NC(=O)C1(C(=O)Cl)CC1 JOCCFZHFPCIWQU-UHFFFAOYSA-N 0.000 description 1
- NCADHSLPNSTDMJ-UHFFFAOYSA-N 1-[(2-methylpropan-2-yl)oxycarbonyl]azetidine-3-carboxylic acid Chemical compound CC(C)(C)OC(=O)N1CC(C(O)=O)C1 NCADHSLPNSTDMJ-UHFFFAOYSA-N 0.000 description 1
- JQWTVIFNRAALHM-UHFFFAOYSA-N 1-[(4-fluorophenyl)carbamoyl]cyclopropane-1-carbonyl chloride Chemical compound C1=CC(F)=CC=C1NC(=O)C1(C(Cl)=O)CC1 JQWTVIFNRAALHM-UHFFFAOYSA-N 0.000 description 1
- WFQDTOYDVUWQMS-UHFFFAOYSA-N 1-fluoro-4-nitrobenzene Chemical compound [O-][N+](=O)C1=CC=C(F)C=C1 WFQDTOYDVUWQMS-UHFFFAOYSA-N 0.000 description 1
- WLBRCFBAWZUERA-CYBMUJFWSA-N 1-n'-[2,5-difluoro-4-[2-[[(2r)-2-hydroxypropanoyl]amino]pyridin-4-yl]oxyphenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)[C@H](O)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 WLBRCFBAWZUERA-CYBMUJFWSA-N 0.000 description 1
- WLBRCFBAWZUERA-ZDUSSCGKSA-N 1-n'-[2,5-difluoro-4-[2-[[(2s)-2-hydroxypropanoyl]amino]pyridin-4-yl]oxyphenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)[C@@H](O)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 WLBRCFBAWZUERA-ZDUSSCGKSA-N 0.000 description 1
- XFGLDXZEMQZBHT-UHFFFAOYSA-N 1-n'-[4-(2-acetamidopyridin-4-yl)oxy-2-fluorophenyl]-1-n-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C1=NC(NC(=O)C)=CC(OC=2C=C(F)C(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=CC=2)=C1 XFGLDXZEMQZBHT-UHFFFAOYSA-N 0.000 description 1
- YPIHWRCGIWQTJP-UHFFFAOYSA-N 1-n'-[4-(2-chloropyridin-4-yl)oxy-2,5-difluorophenyl]-1-n'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C=1C=C(F)C=CC=1N(C=1C(=CC(OC=2C=C(Cl)N=CC=2)=C(F)C=1)F)C(=O)C1(C(=O)N)CC1 YPIHWRCGIWQTJP-UHFFFAOYSA-N 0.000 description 1
- JGLHXXZEVJHDAX-UHFFFAOYSA-N 1-n'-[4-[2-[(2-cyanoacetyl)amino]pyridin-4-yl]oxy-2,5-difluorophenyl]-1-n'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide Chemical compound C=1C=C(F)C=CC=1N(C=1C(=CC(OC=2C=C(NC(=O)CC#N)N=CC=2)=C(F)C=1)F)C(=O)C1(C(=O)N)CC1 JGLHXXZEVJHDAX-UHFFFAOYSA-N 0.000 description 1
- XMHYAHKRNQCIIH-UHFFFAOYSA-N 2,2,2-trifluoro-1-[3-iodo-2-(2,2,2-trifluoroacetyl)phenyl]ethanone Chemical compound FC(F)(F)C(=O)C1=CC=CC(I)=C1C(=O)C(F)(F)F XMHYAHKRNQCIIH-UHFFFAOYSA-N 0.000 description 1
- JECYNCQXXKQDJN-UHFFFAOYSA-N 2-(2-methylhexan-2-yloxymethyl)oxirane Chemical compound CCCCC(C)(C)OCC1CO1 JECYNCQXXKQDJN-UHFFFAOYSA-N 0.000 description 1
- IMSODMZESSGVBE-UHFFFAOYSA-N 2-Oxazoline Chemical compound C1CN=CO1 IMSODMZESSGVBE-UHFFFAOYSA-N 0.000 description 1
- CDAWCLOXVUBKRW-UHFFFAOYSA-N 2-aminophenol Chemical compound NC1=CC=CC=C1O CDAWCLOXVUBKRW-UHFFFAOYSA-N 0.000 description 1
- JUIKUQOUMZUFQT-UHFFFAOYSA-N 2-bromoacetamide Chemical compound NC(=O)CBr JUIKUQOUMZUFQT-UHFFFAOYSA-N 0.000 description 1
- NZDOWZQRNZLBOY-UHFFFAOYSA-N 2-fluoro-2-methylpropanoic acid Chemical compound CC(C)(F)C(O)=O NZDOWZQRNZLBOY-UHFFFAOYSA-N 0.000 description 1
- JJKWHOSQTYYFAE-UHFFFAOYSA-N 2-methoxyacetyl chloride Chemical compound COCC(Cl)=O JJKWHOSQTYYFAE-UHFFFAOYSA-N 0.000 description 1
- 125000004105 2-pyridyl group Chemical group N1=C([*])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- MGADZUXDNSDTHW-UHFFFAOYSA-N 2H-pyran Chemical compound C1OC=CC=C1 MGADZUXDNSDTHW-UHFFFAOYSA-N 0.000 description 1
- BCHZICNRHXRCHY-UHFFFAOYSA-N 2h-oxazine Chemical compound N1OC=CC=C1 BCHZICNRHXRCHY-UHFFFAOYSA-N 0.000 description 1
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 1
- KLDLRDSRCMJKGM-UHFFFAOYSA-N 3-[chloro-(2-oxo-1,3-oxazolidin-3-yl)phosphoryl]-1,3-oxazolidin-2-one Chemical compound C1COC(=O)N1P(=O)(Cl)N1CCOC1=O KLDLRDSRCMJKGM-UHFFFAOYSA-N 0.000 description 1
- JPZOAVGMSDSWSW-UHFFFAOYSA-N 4,6-dichloropyrimidin-2-amine Chemical compound NC1=NC(Cl)=CC(Cl)=N1 JPZOAVGMSDSWSW-UHFFFAOYSA-N 0.000 description 1
- UGOHGIBWMNXIOM-UHFFFAOYSA-N 4-(2-chloropyridin-4-yl)oxy-2,5-difluoroaniline Chemical compound C1=C(F)C(N)=CC(F)=C1OC1=CC=NC(Cl)=C1 UGOHGIBWMNXIOM-UHFFFAOYSA-N 0.000 description 1
- PUHZRGJWPZFFGF-UHFFFAOYSA-N 4-(4-amino-3-fluorophenoxy)-n-[(4-methoxyphenyl)methyl]pyridin-2-amine Chemical compound C1=CC(OC)=CC=C1CNC1=CC(OC=2C=C(F)C(N)=CC=2)=CC=N1 PUHZRGJWPZFFGF-UHFFFAOYSA-N 0.000 description 1
- RPNPSBJBVUOFBH-UHFFFAOYSA-N 4-amino-2,5-difluorophenol Chemical compound NC1=CC(F)=C(O)C=C1F RPNPSBJBVUOFBH-UHFFFAOYSA-N 0.000 description 1
- XIHHOUUTBZSYJH-UHFFFAOYSA-N 4-chloropyridine-2-carboxamide Chemical compound NC(=O)C1=CC(Cl)=CC=N1 XIHHOUUTBZSYJH-UHFFFAOYSA-N 0.000 description 1
- KRZCOLNOCZKSDF-UHFFFAOYSA-N 4-fluoroaniline Chemical compound NC1=CC=C(F)C=C1 KRZCOLNOCZKSDF-UHFFFAOYSA-N 0.000 description 1
- YMDFQJJGBOCVDT-UHFFFAOYSA-N 5-chloro-4-(2-chloropyridin-4-yl)oxy-2-fluoroaniline Chemical compound C1=C(F)C(N)=CC(Cl)=C1OC1=CC=NC(Cl)=C1 YMDFQJJGBOCVDT-UHFFFAOYSA-N 0.000 description 1
- ZKHQWZAMYRWXGA-KQYNXXCUSA-J ATP(4-) Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O)[C@@H](O)[C@H]1O ZKHQWZAMYRWXGA-KQYNXXCUSA-J 0.000 description 1
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical compound C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 1
- 125000006847 BOC protecting group Chemical group 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- 125000000041 C6-C10 aryl group Chemical group 0.000 description 1
- UXVNMGSRLPRKGZ-UHFFFAOYSA-N CC(=O)CC1=CC(OC2=C(C)C=C(N)C(F)=C2)=CC=N1.CC(=O)CC1=CC(OC2=C(C)C=C(NC(=O)OC(C)(C)C)C(F)=C2)=CC=N1.CC1=C(O)C=C(F)C(N)=C1.CC1=C(OC2=CC=NC(C(N)=O)=C2)C=C(F)C(N)=C1.CC1=C(OC2=CC=NC(C(N)=O)=C2)C=C(F)C(NC(=O)OC(C)(C)C)=C1.CC1=C(OC2=CC=NC(N)=C2)C=C(F)C(NC(=O)OC(C)(C)C)=C1.NC(=O)C1=CC(Cl)=CC=N1 Chemical compound CC(=O)CC1=CC(OC2=C(C)C=C(N)C(F)=C2)=CC=N1.CC(=O)CC1=CC(OC2=C(C)C=C(NC(=O)OC(C)(C)C)C(F)=C2)=CC=N1.CC1=C(O)C=C(F)C(N)=C1.CC1=C(OC2=CC=NC(C(N)=O)=C2)C=C(F)C(N)=C1.CC1=C(OC2=CC=NC(C(N)=O)=C2)C=C(F)C(NC(=O)OC(C)(C)C)=C1.CC1=C(OC2=CC=NC(N)=C2)C=C(F)C(NC(=O)OC(C)(C)C)=C1.NC(=O)C1=CC(Cl)=CC=N1 UXVNMGSRLPRKGZ-UHFFFAOYSA-N 0.000 description 1
- LQYQFNJAVMIVBP-UHFFFAOYSA-N CC(=O)CC1=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=CC=N1.CC(=O)CC1=CC(OC2=CC=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=CC=N1.CN1CCN(C2CCN(C(=O)CC3=CC(OC4=C(F)C=C(NC(=O)C5(C(=O)NC6=CC=C(F)C=C6)CC5)C(F)=C4)=CC=N3)CC2)CC1.CN1CCN(C2CCN(C(=O)CC3=CC(OC4=CC=C(NC(=O)C5(C(=O)NC6=CC=C(F)C=C6)CC5)C(F)=C4)=CC=N3)CC2)CC1.O=C(CC1=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=CC=N1)N1CC(CO)C1 Chemical compound CC(=O)CC1=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=CC=N1.CC(=O)CC1=CC(OC2=CC=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=CC=N1.CN1CCN(C2CCN(C(=O)CC3=CC(OC4=C(F)C=C(NC(=O)C5(C(=O)NC6=CC=C(F)C=C6)CC5)C(F)=C4)=CC=N3)CC2)CC1.CN1CCN(C2CCN(C(=O)CC3=CC(OC4=CC=C(NC(=O)C5(C(=O)NC6=CC=C(F)C=C6)CC5)C(F)=C4)=CC=N3)CC2)CC1.O=C(CC1=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=CC=N1)N1CC(CO)C1 LQYQFNJAVMIVBP-UHFFFAOYSA-N 0.000 description 1
- KROBAYRXVAZTIQ-UHFFFAOYSA-N CC(=O)CC1=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=CC=N1.NC1=CC(F)=C(OC2=CC=NC(Cl)=C2)C=C1F.O=C(Cl)C1(C(=O)NC2=CC=C(F)C=C2)CC1.O=C(NC1=CC=C(F)C=C1)C1(C(=O)NC2=CC(F)=C(OC3=CC=NC(Cl)=C3)C=C2F)CC1.O=C(NC1=CC=C(F)C=C1)C1(C(=O)NC2=CC(F)=C(OC3=CC=NC(Cl)=C3)C=C2F)CC1 Chemical compound CC(=O)CC1=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=CC=N1.NC1=CC(F)=C(OC2=CC=NC(Cl)=C2)C=C1F.O=C(Cl)C1(C(=O)NC2=CC=C(F)C=C2)CC1.O=C(NC1=CC=C(F)C=C1)C1(C(=O)NC2=CC(F)=C(OC3=CC=NC(Cl)=C3)C=C2F)CC1.O=C(NC1=CC=C(F)C=C1)C1(C(=O)NC2=CC(F)=C(OC3=CC=NC(Cl)=C3)C=C2F)CC1 KROBAYRXVAZTIQ-UHFFFAOYSA-N 0.000 description 1
- MDSDBAWNPOJIKV-UHFFFAOYSA-N CC(=O)CC1=CC(OC2=CC(F)=C(N)C=C2C)=CC=N1.CC(=O)CC1=CC(OC2=CC(F)=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C=C2C)=CC=N1.CC(=O)CC1=CC(OC2=CC(F)=C(NC(=O)C3(C(=O)O)CC3)C=C2C)=CC=N1.NC1=CC=C(F)C=C1.O=C(O)C1(C(=O)O)CC1 Chemical compound CC(=O)CC1=CC(OC2=CC(F)=C(N)C=C2C)=CC=N1.CC(=O)CC1=CC(OC2=CC(F)=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C=C2C)=CC=N1.CC(=O)CC1=CC(OC2=CC(F)=C(NC(=O)C3(C(=O)O)CC3)C=C2C)=CC=N1.NC1=CC=C(F)C=C1.O=C(O)C1(C(=O)O)CC1 MDSDBAWNPOJIKV-UHFFFAOYSA-N 0.000 description 1
- DONUUTIMVSJXGO-UHFFFAOYSA-N CC(=O)CC1=CC(OC2=CC(F)=C(N)C=C2C)=CC=N1.CC(=O)CC1=CC(OC2=CC(F)=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C=C2C)=CC=N1.COC(=O)C1(C(=O)NC2=CC=C(F)C=C2)CC1.COC(=O)C1(C(=O)O)CC1.NC1=CC=C(F)C=C1.O=C(Cl)C1(C(=O)NC2=CC=C(F)C=C2)CC1 Chemical compound CC(=O)CC1=CC(OC2=CC(F)=C(N)C=C2C)=CC=N1.CC(=O)CC1=CC(OC2=CC(F)=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C=C2C)=CC=N1.COC(=O)C1(C(=O)NC2=CC=C(F)C=C2)CC1.COC(=O)C1(C(=O)O)CC1.NC1=CC=C(F)C=C1.O=C(Cl)C1(C(=O)NC2=CC=C(F)C=C2)CC1 DONUUTIMVSJXGO-UHFFFAOYSA-N 0.000 description 1
- XAKWVDVKDXEFNU-UHFFFAOYSA-N CC(=O)CC1=NC=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=C1.CC(C)C(=O)CC1=NC=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=C1.CCC(=O)CC1=NC=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=C1.O=C(CC1=NC=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=C1)C1CC1 Chemical compound CC(=O)CC1=NC=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=C1.CC(C)C(=O)CC1=NC=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=C1.CCC(=O)CC1=NC=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=C1.O=C(CC1=NC=CC(OC2=C(F)C=C(NC(=O)C3(C(=O)NC4=CC=C(F)C=C4)CC3)C(F)=C2)=C1)C1CC1 XAKWVDVKDXEFNU-UHFFFAOYSA-N 0.000 description 1
- ZWLULTDKWOTHRB-UHFFFAOYSA-N CC1=C(F)C=C(F)C([N+](=O)[O-])=C1.CC1=C(OC2=CC=NC([Y])=C2)C=C(F)C(N)=C1.CC1=C(OC2=CC=NC([Y])=C2)C=C(F)C([N+](=O)[O-])=C1.OC1=CC=NC([Y])=C1 Chemical compound CC1=C(F)C=C(F)C([N+](=O)[O-])=C1.CC1=C(OC2=CC=NC([Y])=C2)C=C(F)C(N)=C1.CC1=C(OC2=CC=NC([Y])=C2)C=C(F)C([N+](=O)[O-])=C1.OC1=CC=NC([Y])=C1 ZWLULTDKWOTHRB-UHFFFAOYSA-N 0.000 description 1
- RAZURWAJSFORRJ-UHFFFAOYSA-N CC1=C(O)C=C(F)C(N)=C1.CC1=C(OC2=CC=NC([Y])=C2)C=C(F)C(N)=C1.CC1=CC=NC([Y])=C1 Chemical compound CC1=C(O)C=C(F)C(N)=C1.CC1=C(OC2=CC=NC([Y])=C2)C=C(F)C(N)=C1.CC1=CC=NC([Y])=C1 RAZURWAJSFORRJ-UHFFFAOYSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- 208000034951 Genetic Translocation Diseases 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 102000003745 Hepatocyte Growth Factor Human genes 0.000 description 1
- 108090000100 Hepatocyte Growth Factor Proteins 0.000 description 1
- 208000027927 Hereditary papillary renal cell carcinoma Diseases 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- WRYCSMQKUKOKBP-UHFFFAOYSA-N Imidazolidine Chemical compound C1CNCN1 WRYCSMQKUKOKBP-UHFFFAOYSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 208000019693 Lung disease Diseases 0.000 description 1
- 229940125895 MET kinase inhibitor Drugs 0.000 description 1
- 241000282560 Macaca mulatta Species 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-N Malonic acid Chemical compound OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101100042271 Mus musculus Sema3b gene Proteins 0.000 description 1
- VZUNGTLZRAYYDE-UHFFFAOYSA-N N-methyl-N'-nitro-N-nitrosoguanidine Chemical compound O=NN(C)C(=N)N[N+]([O-])=O VZUNGTLZRAYYDE-UHFFFAOYSA-N 0.000 description 1
- VDPMBBUCTHEQMA-UHFFFAOYSA-N NC1=CC(F)=C(OC2=CC=NC([Y])=C2)C=C1F.O=[N+]([O-])C1=CC(F)=C(F)C=C1F.O=[N+]([O-])C1=CC(F)=C(OC2=CC=NC(Cl)=C2)C=C1F.OC1=CC=NC(Cl)=C1 Chemical compound NC1=CC(F)=C(OC2=CC=NC([Y])=C2)C=C1F.O=[N+]([O-])C1=CC(F)=C(F)C=C1F.O=[N+]([O-])C1=CC(F)=C(OC2=CC=NC(Cl)=C2)C=C1F.OC1=CC=NC(Cl)=C1 VDPMBBUCTHEQMA-UHFFFAOYSA-N 0.000 description 1
- IERDPZTZIONHSM-UHFFFAOYSA-N O=C1OCCN1[ClH]P(=O)[ClH]N1C(OCC1)=O Chemical compound O=C1OCCN1[ClH]P(=O)[ClH]N1C(OCC1)=O IERDPZTZIONHSM-UHFFFAOYSA-N 0.000 description 1
- ZCQWOFVYLHDMMC-UHFFFAOYSA-N Oxazole Chemical compound C1=COC=N1 ZCQWOFVYLHDMMC-UHFFFAOYSA-N 0.000 description 1
- WYNCHZVNFNFDNH-UHFFFAOYSA-N Oxazolidine Chemical compound C1COCN1 WYNCHZVNFNFDNH-UHFFFAOYSA-N 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 241001504519 Papio ursinus Species 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- PCNDJXKNXGMECE-UHFFFAOYSA-N Phenazine Natural products C1=CC=CC2=NC3=CC=CC=C3N=C21 PCNDJXKNXGMECE-UHFFFAOYSA-N 0.000 description 1
- 241001085205 Prenanthella exigua Species 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- WTKZEGDFNFYCGP-UHFFFAOYSA-N Pyrazole Chemical compound C=1C=NNC=1 WTKZEGDFNFYCGP-UHFFFAOYSA-N 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 102100033810 RAC-alpha serine/threonine-protein kinase Human genes 0.000 description 1
- 108700003853 RON Proteins 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102000014400 SH2 domains Human genes 0.000 description 1
- 108050003452 SH2 domains Proteins 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 101150037066 TPR3 gene Proteins 0.000 description 1
- DHXVGJBLRPWPCS-UHFFFAOYSA-N Tetrahydropyran Chemical compound C1CCOCC1 DHXVGJBLRPWPCS-UHFFFAOYSA-N 0.000 description 1
- YPWFISCTZQNZAU-UHFFFAOYSA-N Thiane Chemical compound C1CCSCC1 YPWFISCTZQNZAU-UHFFFAOYSA-N 0.000 description 1
- FZWLAAWBMGSTSO-UHFFFAOYSA-N Thiazole Chemical compound C1=CSC=N1 FZWLAAWBMGSTSO-UHFFFAOYSA-N 0.000 description 1
- XIPUIGPNIDKXJU-UHFFFAOYSA-N [CH]1CC1 Chemical compound [CH]1CC1 XIPUIGPNIDKXJU-UHFFFAOYSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 150000003927 aminopyridines Chemical class 0.000 description 1
- 125000002490 anilino group Chemical group [H]N(*)C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000000010 aprotic solvent Substances 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- HONIICLYMWZJFZ-UHFFFAOYSA-N azetidine Chemical compound C1CNC1 HONIICLYMWZJFZ-UHFFFAOYSA-N 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000011203 carbon fibre reinforced carbon Substances 0.000 description 1
- 239000003183 carcinogenic agent Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 239000013626 chemical specie Substances 0.000 description 1
- 239000012069 chiral reagent Substances 0.000 description 1
- 125000001309 chloro group Chemical group Cl* 0.000 description 1
- 229940125773 compound 10 Drugs 0.000 description 1
- 230000006552 constitutive activation Effects 0.000 description 1
- TXWOGHSRPAYOML-UHFFFAOYSA-N cyclobutanecarboxylic acid Chemical compound OC(=O)C1CCC1 TXWOGHSRPAYOML-UHFFFAOYSA-N 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000000582 cycloheptyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000000640 cyclooctyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- FEHLGOYZDFFMND-UHFFFAOYSA-N cyclopropane-1,1-dicarboxamide Chemical compound NC(=O)C1(C(N)=O)CC1 FEHLGOYZDFFMND-UHFFFAOYSA-N 0.000 description 1
- FDKLLWKMYAMLIF-UHFFFAOYSA-N cyclopropane-1,1-dicarboxylic acid Chemical compound OC(=O)C1(C(O)=O)CC1 FDKLLWKMYAMLIF-UHFFFAOYSA-N 0.000 description 1
- AIMMVWOEOZMVMS-UHFFFAOYSA-N cyclopropanecarboxamide Chemical compound NC(=O)C1CC1 AIMMVWOEOZMVMS-UHFFFAOYSA-N 0.000 description 1
- WMKGGPCROCCUDY-PHEQNACWSA-N dibenzylideneacetone Chemical compound C=1C=CC=CC=1\C=C\C(=O)\C=C\C1=CC=CC=C1 WMKGGPCROCCUDY-PHEQNACWSA-N 0.000 description 1
- 150000004683 dihydrates Chemical class 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- LOZWAPSEEHRYPG-UHFFFAOYSA-N dithiane Natural products C1CSCCS1 LOZWAPSEEHRYPG-UHFFFAOYSA-N 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical group SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000000132 electrospray ionisation Methods 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 125000005843 halogen group Chemical group 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- XLYOFNOQVPJJNP-ZSJDYOACSA-N heavy water Substances [2H]O[2H] XLYOFNOQVPJJNP-ZSJDYOACSA-N 0.000 description 1
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 102000050995 human FLT1 Human genes 0.000 description 1
- 102000050427 human RET Human genes 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 1
- 238000006317 isomerization reaction Methods 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- ZLTPDFXIESTBQG-UHFFFAOYSA-N isothiazole Chemical compound C=1C=NSC=1 ZLTPDFXIESTBQG-UHFFFAOYSA-N 0.000 description 1
- CTAPFRYPJLPFDF-UHFFFAOYSA-N isoxazole Chemical compound C=1C=NOC=1 CTAPFRYPJLPFDF-UHFFFAOYSA-N 0.000 description 1
- ZLVXBBHTMQJRSX-VMGNSXQWSA-N jdtic Chemical compound C1([C@]2(C)CCN(C[C@@H]2C)C[C@H](C(C)C)NC(=O)[C@@H]2NCC3=CC(O)=CC=C3C2)=CC=CC(O)=C1 ZLVXBBHTMQJRSX-VMGNSXQWSA-N 0.000 description 1
- ACKFDYCQCBEDNU-UHFFFAOYSA-J lead(2+);tetraacetate Chemical compound [Pb+2].CC([O-])=O.CC([O-])=O.CC([O-])=O.CC([O-])=O ACKFDYCQCBEDNU-UHFFFAOYSA-J 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- GBMDVOWEEQVZKZ-UHFFFAOYSA-N methanol;hydrate Chemical compound O.OC GBMDVOWEEQVZKZ-UHFFFAOYSA-N 0.000 description 1
- 239000012046 mixed solvent Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 125000002950 monocyclic group Chemical group 0.000 description 1
- 150000004682 monohydrates Chemical class 0.000 description 1
- FTQWRYSLUYAIRQ-UHFFFAOYSA-N n-[(octadecanoylamino)methyl]octadecanamide Chemical compound CCCCCCCCCCCCCCCCCC(=O)NCNC(=O)CCCCCCCCCCCCCCCCC FTQWRYSLUYAIRQ-UHFFFAOYSA-N 0.000 description 1
- IFYDWYVPVAMGRO-UHFFFAOYSA-N n-[3-(dimethylamino)propyl]tetradecanamide Chemical compound CCCCCCCCCCCCCC(=O)NCCCN(C)C IFYDWYVPVAMGRO-UHFFFAOYSA-N 0.000 description 1
- AWHGKNXJVXCLLZ-UHFFFAOYSA-N n-[4-(4-amino-2,5-difluorophenoxy)pyrimidin-2-yl]acetamide Chemical compound CC(=O)NC1=NC=CC(OC=2C(=CC(N)=C(F)C=2)F)=N1 AWHGKNXJVXCLLZ-UHFFFAOYSA-N 0.000 description 1
- XBXCNNQPRYLIDE-UHFFFAOYSA-M n-tert-butylcarbamate Chemical compound CC(C)(C)NC([O-])=O XBXCNNQPRYLIDE-UHFFFAOYSA-M 0.000 description 1
- 229950006238 nadide Drugs 0.000 description 1
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 1
- 238000010534 nucleophilic substitution reaction Methods 0.000 description 1
- 239000012074 organic phase Substances 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- WCPAKWJPBJAGKN-UHFFFAOYSA-N oxadiazole Chemical compound C1=CON=N1 WCPAKWJPBJAGKN-UHFFFAOYSA-N 0.000 description 1
- AICOOMRHRUFYCM-ZRRPKQBOSA-N oxazine, 1 Chemical compound C([C@@H]1[C@H](C(C[C@]2(C)[C@@H]([C@H](C)N(C)C)[C@H](O)C[C@]21C)=O)CC1=CC2)C[C@H]1[C@@]1(C)[C@H]2N=C(C(C)C)OC1 AICOOMRHRUFYCM-ZRRPKQBOSA-N 0.000 description 1
- AHHWIHXENZJRFG-UHFFFAOYSA-N oxetane Chemical compound C1COC1 AHHWIHXENZJRFG-UHFFFAOYSA-N 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 229910052763 palladium Inorganic materials 0.000 description 1
- 125000001147 pentyl group Chemical group C(CCCC)* 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- XIPFMBOWZXULIA-UHFFFAOYSA-N pivalamide Chemical compound CC(C)(C)C(N)=O XIPFMBOWZXULIA-UHFFFAOYSA-N 0.000 description 1
- 239000003880 polar aprotic solvent Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000002953 preparative HPLC Methods 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- QLNJFJADRCOGBJ-UHFFFAOYSA-N propionamide Chemical compound CCC(N)=O QLNJFJADRCOGBJ-UHFFFAOYSA-N 0.000 description 1
- 229940080818 propionamide Drugs 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- MWWATHDPGQKSAR-UHFFFAOYSA-N propyne Chemical compound CC#C MWWATHDPGQKSAR-UHFFFAOYSA-N 0.000 description 1
- PBMFSQRYOILNGV-UHFFFAOYSA-N pyridazine Chemical compound C1=CC=NN=C1 PBMFSQRYOILNGV-UHFFFAOYSA-N 0.000 description 1
- UBQKCCHYAOITMY-UHFFFAOYSA-N pyridin-2-ol Chemical compound OC1=CC=CC=N1 UBQKCCHYAOITMY-UHFFFAOYSA-N 0.000 description 1
- 102000016914 ras Proteins Human genes 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000007127 saponification reaction Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- PFJYTJVSQPANMC-UHFFFAOYSA-N tert-butyl n-[4-[2,5-difluoro-4-[[1-[(4-fluorophenyl)carbamoyl]cyclopropanecarbonyl]amino]phenoxy]pyridin-2-yl]carbamate Chemical compound C1=NC(NC(=O)OC(C)(C)C)=CC(OC=2C(=CC(NC(=O)C3(CC3)C(=O)NC=3C=CC(F)=CC=3)=C(F)C=2)F)=C1 PFJYTJVSQPANMC-UHFFFAOYSA-N 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- RAOIDOHSFRTOEL-UHFFFAOYSA-N tetrahydrothiophene Chemical compound C1CCSC1 RAOIDOHSFRTOEL-UHFFFAOYSA-N 0.000 description 1
- 150000003536 tetrazoles Chemical class 0.000 description 1
- VLLMWSRANPNYQX-UHFFFAOYSA-N thiadiazole Chemical compound C1=CSN=N1.C1=CSN=N1 VLLMWSRANPNYQX-UHFFFAOYSA-N 0.000 description 1
- XSROQCDVUIHRSI-UHFFFAOYSA-N thietane Chemical compound C1CSC1 XSROQCDVUIHRSI-UHFFFAOYSA-N 0.000 description 1
- VOVUARRWDCVURC-UHFFFAOYSA-N thiirane Chemical compound C1CS1 VOVUARRWDCVURC-UHFFFAOYSA-N 0.000 description 1
- IBBLKSWSCDAPIF-UHFFFAOYSA-N thiopyran Chemical compound S1C=CC=C=C1 IBBLKSWSCDAPIF-UHFFFAOYSA-N 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 229910052723 transition metal Inorganic materials 0.000 description 1
- 150000003624 transition metals Chemical class 0.000 description 1
- 150000003852 triazoles Chemical class 0.000 description 1
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 description 1
- 150000004684 trihydrates Chemical class 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 229910052727 yttrium Inorganic materials 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
- C07D401/02—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings
- C07D401/12—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing two hetero rings linked by a chain containing hetero atoms as chain links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
- A61P11/06—Antiasthmatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D213/00—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members
- C07D213/02—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members
- C07D213/04—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom
- C07D213/60—Heterocyclic compounds containing six-membered rings, not condensed with other rings, with one nitrogen atom as the only ring hetero atom and three or more double bonds between ring members or between ring members and non-ring members having three double bonds between ring members or between ring members and non-ring members having no bond between the ring nitrogen atom and a non-ring member or having only hydrogen or carbon atoms directly attached to the ring nitrogen atom with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D213/72—Nitrogen atoms
- C07D213/75—Amino or imino radicals, acylated by carboxylic or carbonic acids, or by sulfur or nitrogen analogues thereof, e.g. carbamates
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D239/00—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings
- C07D239/02—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings
- C07D239/24—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members
- C07D239/28—Heterocyclic compounds containing 1,3-diazine or hydrogenated 1,3-diazine rings not condensed with other rings having three or more double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, directly attached to ring carbon atoms
- C07D239/46—Two or more oxygen, sulphur or nitrogen atoms
- C07D239/47—One nitrogen atom and one oxygen or sulfur atom, e.g. cytosine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D401/00—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom
- C07D401/14—Heterocyclic compounds containing two or more hetero rings, having nitrogen atoms as the only ring hetero atoms, at least one ring being a six-membered ring with only one nitrogen atom containing three or more hetero rings
Definitions
- the present invention relates to kinase inhibitors exhibiting novel and unexpected properties useful for the treatment of various diseases including hyperproliferative diseases and cancer. More particularly, the invention is concerned with such compounds, methods of treating diseases, and methods of synthesis of the compounds. Preferably, the compounds are useful for the modulation of activity of c-MET kinase, c-MET kinase polymorphs, c-MET kinase mutants, or c-MET kinase fusion proteins in the treatment of mammalian diseases, and in particular human hyperproliferative diseases and human cancers. In some embodiments, compounds disclosed herein exhibit unexpected selectivity for modulation of c-MET kinase activity.
- c-MET is a receptor tyrosine kinase (RTK) located on chromosome 7p and activated via its natural ligand hepatocyte growth factor.
- RTK receptor tyrosine kinase
- c-MET is found mutated in a variety of solid tumors (Ma, P. C. et al. Cancer Metastasis (2003) 22: 309). Mutations in the tyrosine kinase domain are associated with hereditary papillary renal cell carcinomas (Schmidt, L. et al. Nat. Genet . (1997) 16: 68; Schmidt, L. et al.
- the TPR-MET oncogene is a transforming variant of the c-MET RTK and was initially identified after treatment of a human osteogenic sarcoma cell line transformed by the chemical carcinogen N-methyl-N′-nitro-N-nitrosoguanidine (Park, M. et al. Cell (1986) 45: 895).
- the TPR-MET fusion oncoprotein is the result of a chromosomal translocation, placing the TPR3 locus on chromosome 1 upstream of a portion of the c-MET gene on chromosome 7 encoding only for the cytoplasmic region.
- Studies suggest that TPR-MET is detectable in experimental cancers (e.g., Yu, J. et al. Cancer (2000) 88: 1801).
- TPR-MET activates wild-type c-MET RTK and can activate crucial cellular growth pathways, including the Ras pathway (Aklilu, F. et al. Arm. J. Physiol . (1996) 271: E277) and the phosphatidylinositol 3-kinase (PI3K)/AKT pathway (Ponzetto, C. et al. Mol. Cell. Biol . (1993) 13: 4600).
- TPR-MET is ligand independent, lacks the CBL-like SH2 domain binding site in the juxtamembrane region in c-MET, and is mainly cytoplasmic.
- c-MET immunohistochemical expression seems to be associated with abnormal ⁇ -catenin expression, a hallmark feature of epithelial to mesenchymal transition (EMT) and provides good prognostic and predictive factors in breast cancer patients.
- Protein kinases constitute an important therapeutic protein family. There are approximately 518 human protein kinases. While inhibition of a desired kinase ‘on target’ is desirable for a human therapeutic, it is also desirable in many cases to provide a selective kinase inhibitor which does not substantially inhibit other kinase ‘off targets’ from within this protein family. Monoclonal antibodies are one approach to providing specific inhibitors to a specific kinase without inhibiting ‘off targets.’ Achieving this level of selectivity with small molecule inhibitors, however, is not as easily achievable nor as straightforward. Accordingly, there is a need for kinase inhibitors that are selective for a particular protein kinase. It is theorized that an unexpected increase in potency for c-MET kinase inhibition or an unexpected increase in selective c-MET inhibition relative to other kinases is observed for one or more of the embodiments disclosed herein.
- Compounds described herein find utility in the treatment of mammalian cancers and especially human cancers including, but not limited to, solid tumors, gastric cancers, melanomas, glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer, lung cancers, non small cell lung cancer, breast cancers, kidney cancers, cervical carcinomas, metastasis of primary tumor sites, colonic cancers, myeloproliferative diseases, diseases wherein the etiology or progression is dependent on c-MET kinase activity, or on the activity of oncogenic forms, aberrant fusion protein forms, and mutant forms of c-MET kinase.
- X and F are regiochemically oriented with respect to each other in a mutual para-orientation; X is halogen or C1-C6 alkyl; and R3 is a non-hydrogen moiety regiochemically oriented ortho- to the B ring nitrogen.
- Compounds described herein exhibit unexpected potency for c-MET kinase inhibition and/or an unexpected increase in selective c-MET kinase inhibition relative to other kinases, particularly in comparison to other purported MET kinase inhibitors.
- X is halogen
- Z1 and Z2 are independently and individually CR2 or N;
- Z3 is CH or N
- each R1 is independently and individually halogen, H, C1-C6 alkyl, branched C3-C7 alkyl, C3-C7 cycloalkyl, or —CN;
- each R2 is individually and independently H, halogen, C1-C6 alkyl, or cyano;
- R3 is —C(O)R4, —C(O)—C6-C10-aryl, —C(O)—C4-C6-heterocyclyl, or —C(O)—C5-C6-heteroaryl, wherein
- R4 is C1-C7 alkyl, C3-C8 cycloalkyl, —(CH 2 ) p —CN, —(CH 2 ) p —OR6, —(CH 2 ) p —NR6(R7), —(CH 2 ) p —SO 2 —C1-C6-alkyl, —(CH 2 ) p —C6-C10-aryl, —(CH 2 ) p —C5-C6-heteroaryl, or —(CH 2 ) p —C4-C6-heterocyclyl, wherein
- each R6 and R7 is individually and independently H, C1-C6 alkyl, or C3-C8 branched alkyl;
- each cycloalkyl, aryl, heteroaryl and heterocyclyl is independently substituted with —(R25) m ;
- each R25 is individually and independently C1-C6 alkyl, branched C3-C8 alkyl, halogen, —(CH 2 ) m —CN, —(CH 2 ) m —OR6, —(CH 2 ) m —NR6(R7), —(CH 2 ) m —SO 2 —C1-C6-alkyl, —(CH 2 ) m —C(O)NR6(R7), —(CH 2 ) m —C(O)—C4-C6-heterocyclyl, or —(CH 2 ) m —C4-C6-heterocyclyl, wherein each alkyl or alkylene is optionally substituted with one or two C1-C6 alkyl;
- each m is individually and independently 0, 1, 2, or 3;
- p 1, 2, or 3.
- Z1 and Z2 are CR2, and Z3 is CH.
- the compound is a compound of Formula Ic,
- n 0, 1, or 2.
- R3 is —C(O)R4.
- R3 is —C(O)R4 and R4 is C1-C7 alkyl, C3-C8 cycloalkyl, —(CH 2 ) p —CN, —(CH 2 ) p —OR6, —(CH 2 ) p —NR6(R7), —(CH 2 ) p —SO 2 —C1-C6-alkyl, or —(CH 2 ) p —C4-C6-heterocyclyl, and wherein each alkyl or alkylene is optionally substituted with one or two C1-C6 alkyl.
- R3 is —C(O)R4 and R4 is C1-C7 alkyl or C3-C8 cycloalkyl, and wherein each alkyl or alkylene is optionally substituted with one or two C1-C6 alkyl.
- R3 is —C(O)—C6-C10-aryl, —C(O)—C4-C6-heterocyclyl, or —C(O)—C5-C6-heteroaryl.
- Z1 and Z2 are CR2, and Z3 is N.
- the compound of Formula I is a compound of Formula If
- n 0, 1, or 2.
- R3 is —C(O)R4.
- R3 is —C(O)—C6-C10-aryl, —C(O)—C4-C6-heterocyclyl, or —C(O)—C5-C6-heteroaryl.
- Z1 is CR2, Z2 is N, and Z3 is CH.
- the compound of Formula I is a compound of Formula Ij,
- R3 is —C(O)R4.
- R3 is —C(O)—C6-C10-aryl, —C(O)—C4-C6-heterocyclyl, or —C(O)—C5-C6-heteroaryl.
- Z1 is CR2, and Z2 and Z3 are N.
- the compound of Formula I is a compound of Formula Im
- R3 is —C(O)R4.
- R3 is —C(O)—C6-C10-aryl, —C(O)—C4-C6-heterocyclyl, or —C(O)—C5-C6-heteroaryl.
- the present invention is directed to a compound selected from the group consisting of N-(4-(2-acetamidopyridin-4-yloxy)-2,5-difluorophenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide, N-(4-(2-acetamidopyridin-4-yloxy)-5-chloro-2-fluorophenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide, N-(4-(2-acetamidopyridin-4-yloxy)-2,5-difluorophenyl)-N′-phenylcyclopropane-1,1-dicarboxamide, N-(4-(2-(2-(dimethylamino)acetamido)pyridin-4-yloxy)-2,5-difluorophenyl)-N′-(4-fluoroph
- the present invention is directed to a compound selected from the group consisting of N-(4-(2-(cyclopropanecarboxamido)pyridin-4-yloxy)-2,5-difluorophenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide, N-(2,5-difluoro-4-(2-propionamidopyridin-4-yloxy)phenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide, N-(2,5-difluoro-4-(2-isobutyramidopyridin-4-yloxy)phenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide, N-(4-(2-acetamidopyridin-4-yloxy)-2,5-difluorophenyl)-N′-(4-(4-
- the present invention comprises a method of treating mammalian disease wherein the disease etiology or progression is at least partially mediated by a kinase activity, wherein the kinase is a wildtype form, a mutant oncogenic form, an aberrant fusion protein form or a polymorph, the method comprising administering to a mammal in need thereof an effective amount of a compound of any of claims 1 - 21 .
- the disease etiology or progression is at least partially mediated by the kinase activity of c-MET, mutant oncogenic forms, aberrant fusion proteins, or polymorphs thereof.
- the invention is directed to a pharmaceutical composition, comprising a compound of any of claims 1 - 21 and a pharmaceutically acceptable carrier.
- the pharmaceutical composition further comprises an additive selected from adjuvants, excipients, diluents, or stabilizers.
- the present invention is directed to a method of treating cancer, gastrointestinal stromal tumors, hyperproliferative diseases, metabolic diseases, neurodegenerative diseases, or diseases characterized by angiogenesis, such as solid tumors, melanomas, glioblastomas, ovarian cancer; pancreatic cancer, prostate cancer, lung cancers, breast cancers, renal cancers, hepatic cancers, cervical carcinomas, metastasis of primary tumor sites, myeloproliferative diseases, chronic myelogenous leukemia, leukemias, papillary thyroid carcinoma, non-small cell lung cancer, mesothelioma, hypereosinophilic syndrome, colonic cancers, ocular diseases characterized by hyperproliferation leading to blindness including retinopathies, diabetic retinopathy, age-related macular degeneration, hypereosinophilic syndrome, rheumatoid arthritis, asthma, chronic obstructive pulmonary, mastocytosis, or mast cell leukemia, the method comprising of cancer
- the compound is administered orally, parenterally, by inhalation, or subcutaneously.
- the compounds of this disclosure include any and all possible isomers, stereoisomers, enantiomers, diastereomers, tautomers, pharmaceutically acceptable salts, and solvates thereof, as well as crystalline polymorphic forms of the disclosed compounds and any and all possible isomers, stereoisomers, enantiomers, diastereomers, tautomers, pharmaceutically acceptable salts, and solvates thereof.
- the terms “compound” and “compounds” as used in this disclosure refer to the compounds of this disclosure and any and all possible isomers, stereoisomers, enantiomers, diastereomers, tautomers, pharmaceutically acceptable salts, and solvates, and crystalline polymorphs thereof.
- alkyl refers to a straight chain alkyl, wherein alkyl chain length is indicated by a range of numbers.
- alkyl refers to an alkyl chain as defined above containing 1, 2, 3, 4, 5, or 6 carbons (i.e., C1-C6 alkyl).
- alkyl group include, but are not limited to, methyl, ethyl, propyl, butyl, pentyl, and hexyl.
- branched alkyl refers to an alkyl chain wherein a branching point in the chain exists, and the total number of carbons in the chain is indicated by a range of numbers.
- branched alkyl refers to an alkyl chain as defined above containing from 3, 4, 5, 6, 7, or 8 carbons (i.e., branched C3-C8 alkyl). Examples of a branched alkyl group include, but are not limited to, iso-propyl, iso-butyl, secondary-butyl, and tertiary-butyl.
- alkoxy refers to —O— (alkyl), wherein “alkyl” is as defined above.
- branched alkoxy refers to —O— (branched alkyl), wherein “branched alkyl” is as defined above.
- alkylene refers to an alkyl moiety interposed between two other atoms.
- alkylene refers to an alkyl moiety as defined above containing 1, 2, or 3 carbons.
- Examples of an alkylene group include, but are not limited to —CH 2 —, —CH 2 CH 2 —, and —CH 2 CH 2 CH 2 —.
- alkylene groups are branched.
- alkynyl refers to a carbon chain containing one carbon-carbon triple bond.
- alkynyl refers to a carbon chain as described above containing 2 or 3 carbons (i.e., C2-C3 alkynyl).
- alkynyl group include, but are not limited to, ethyne and propyne.
- aryl refers to a cyclic hydrocarbon, where the ring is characterized by delocalized ⁇ electrons (aromaticity) shared among the ring members, and wherein the number of ring atoms is indicated by a range of numbers.
- aryl refers to a cyclic hydrocarbon as described above containing 6, 7, 8, 9, or ring atoms (i.e., C6-C10 aryl). Examples of an aryl group include, but are not limited to, benzene, naphthalene, tetralin, indene, and indane.
- cycloalkyl refers to a monocyclic saturated carbon ring, wherein the number of ring atoms is indicated by a range of numbers.
- “cycloalkyl” refers to a carbon ring as defined above containing 3, 4, 5, 6, 7, or 8 ring atoms (i.e., C3-C8 cycloalkyl).
- Examples of a cycloalkyl group include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl.
- halogen refers to fluorine, chlorine, bromine, and iodine.
- heterocycle or “heterocyclyl” as used herein refers to a cyclic hydrocarbon, wherein at least one of the ring atoms is an O, N, or S, wherein the number of ring atoms is indicated by a range of numbers.
- Heterocyclyl moieties as defined herein have C or N bonding hands.
- a ring N atom from the heterocyclyl is the bonding atom to —C(O) to form an amide, carbamate, or urea.
- heterocyclyl refers to a cyclic hydrocarbon as described above containing 4, 5, or 6 ring atoms (i.e., C4-C6 heterocyclyl).
- heterocycle group include, but are not limited to, aziridine, oxirane, thiirane, azetidine, oxetane, thietane, pyrrolidine, tetrahydrofuran, pyran, thiopyran, thiomorpholine, thiomorpholine S-oxide, thiomorpholine'S-dioxide, oxazoline, tetrahydrothiophene, piperidine, tetrahydropyran, thiane, imidazolidine, oxazolidine, thiazolidine, dioxolane, dithiolane, piperazine, oxazine, dithiane, and dioxane.
- heteroaryl refers to a cyclic hydrocarbon, where at least one of the ring atoms is an O, N, or S, the ring is characterized by delocalized it electrons (aromaticity) shared among the ring members, and wherein the number of ring atoms is indicated by a range of numbers. Heteroaryl moieties as defined herein have C or N bonding hands. For example, in some embodiments, a ring N atom from the heteroaryl is the bonding atom to —C(O) to form an amide, carbamate, or urea.
- heteroaryl refers to a cyclic hydrocarbon as described above containing 5 or 6 ring atoms (i.e., C5-C6 heteroaryl).
- heteroaryl group include, but are not limited to, pyrrole, furan, thiene, oxazole, thiazole, isoxazole, isothiazole, imidazole, pyrazole, oxadiazole, thiadiazole, triazole, tetrazole, pyridine, pyrimidine, pyrazine, pyridazine, and triazine.
- substituted in connection with a moiety as used herein refers to a further substituent which is attached to the moiety at any acceptable location on the moiety. Unless otherwise indicated, moieties can bond through a carbon, nitrogen, oxygen, sulfur, or any other acceptable atom.
- salts as used herein embraces pharmaceutically acceptable salts commonly used to form alkali metal salts of free acids and to form addition salts of free bases.
- the nature of the salt is not critical, provided that it is pharmaceutically acceptable.
- Suitable pharmaceutically acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid.
- Exemplary pharmaceutical salts are disclosed in Stahl, P. H., Wermuth, C. C., Eds. Handbook of Pharmaceutical Salts: Properties, Selection and Use ; Verlag Helvetica Chimica Acta/Wiley-VCH: Zurich, 2002, the contents of which are hereby incorporated by reference in their entirety.
- inorganic acids are hydrochloric, hydrobromic, hydroiodic, nitric, carbonic, sulfuric and phosphoric acid.
- Appropriate organic acids include, without limitation, aliphatic, cycloaliphatic, aromatic, arylaliphatic, and heterocyclyl containing carboxylic acids and sulfonic acids, for example formic, acetic, propionic, succinic, glycolic, gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic, benzoic, anthranilic, mesylic, stearic, salicylic, p-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic, ethanesulfonic, benzenesulionic, pantothenic, toluenesulfonic, 2-hydroxyethane
- Suitable pharmaceutically acceptable salts of free acid-containing compounds disclosed herein include, without limitation, metallic salts and organic salts.
- Exemplary metallic salts include, but are not limited to, appropriate alkali metal (group Ia) salts, alkaline earth metal (group IIa) salts, and other physiological acceptable metals.
- Such salts can be made from aluminum, calcium, lithium, magnesium, potassium, sodium and zinc.
- Exemplary organic salts can be made from primary amines, secondary amines, tertiary amines and quaternary ammonium salts, for example, tromethamine, diethylamine, tetra-N-methylammonium, N,N′-dibenzylethylenediamine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine (N-methylglucamine) and procaine.
- salts as used herein embraces pharmaceutically acceptable salts commonly used to form alkali metal salts of free acids and to form addition salts of free bases.
- the nature of the salt is not critical, provided that it is pharmaceutically acceptable.
- Suitable pharmaceutically acceptable acid addition salts may be prepared from an inorganic acid or from an organic acid. Examples of such inorganic acids are hydrochloric, hydrobromic, hydroiodic, nitric, carbonic, sulfuric and phosphoric acid.
- Appropriate organic acids may be selected from aliphatic, cycloaliphatic, aromatic, arylaliphatic, and heterocyclyl containing carboxylic acids and sulfonic acids, for example formic, acetic, propionic, succinic, glycolic, gluconic, lactic, malic, tartaric, citric, ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic, benzoic, anthranilic, mesylic, stearic, salicylic, p-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic), methanesulfonic, ethanesulfonic, benzenesulfonic, pantothenic, toluenesulfonic, 2-hydroxyethanesulfonic, sulfanilic, cyclohexylaminosulfonic, algenic, 3-hydroxybutyric, galactaric and galactu
- Suitable pharmaceutically acceptable salts of free acid-containing compounds disclosed herein include metallic salts and organic salts.
- Exemplary metallic salts include, but are not limited to, appropriate alkali metal (group Ia) salts, alkaline earth metal (group IIa) salts, and other physiological acceptable metals.
- Such salts can be made from aluminum, calcium, lithium, magnesium, potassium, sodium and zinc.
- Exemplary organic salts can be made from primary amines, secondary amines, tertiary amines and quaternary ammonium salts, for example, tromethamine, diethylamine, tetra-N-methylammonium, N,N′-dibenzylethylenediamine, chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine (N-methylglucamine) and procaine.
- administer refers to either directly administering a compound or pharmaceutically acceptable salt of the compound or a composition to a subject.
- carrier encompasses carriers, excipients, and diluents, meaning a material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material involved in carrying or transporting a pharmaceutical agent from one organ, or portion of the body, to another organ or portion of the body.
- disorder is used in this disclosure to mean, and is used interchangeably with, the terms disease, condition, or illness, unless otherwise indicated.
- an effective amount and “therapeutically effective amount” are used interchangeably in this disclosure and refer to an amount of a compound that, when administered to a subject, is capable of reducing a symptom of a disorder in a subject.
- the actual amount which comprises the “effective amount” or “therapeutically effective amount” will vary depending on a number of conditions including, but not limited to, the particular disorder being treated, the severity of the disorder, the size and health of the patient, and the route of administration. A skilled medical practitioner can readily determine the appropriate amount using methods known in the medical arts.
- the isolate and “purified” as used herein refer to a component separated from other components of a reaction mixture or a natural source.
- the isolate contains at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 98% of the compound or pharmaceutically acceptable salt of the compound by weight of the isolate.
- phrases “pharmaceutically acceptable” as used herein refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio:
- the term “subject” includes, without limitation, a human or an animal.
- exemplary animals include, but are not limited to, mammals such as mouse, rat, guinea pig, dog, cat, horse, cow, pig, monkey, chimpanzee, baboon, or rhesus monkey.
- treating refers to improving at least one symptom of the subject's disorder. Treating can be curing, improving, or at least partially ameliorating the disorder.
- hydrate refers to a compound disclosed herein which is associated with water in the molecular form, i.e., in which the H—OH bond is not split, and may be represented, for example, by the formula R ⁇ H 2 O, where R is a compound disclosed herein.
- R is a compound disclosed herein.
- a given compound may form more than one hydrate including, for example, monohydrates (R ⁇ H 2 O), dihydrates (R ⁇ 2H 2 O), trihydrates (R ⁇ 3H 2 O), and the like.
- solvate refers to a compound disclosed herein which is associated with solvent in the molecular form, i.e., in which the solvent is coordinatively hound, and may be represented, for example, by the formula R ⁇ (solvent), where R is a compound disclosed herein.
- a given compound may form more than one solvate including, for example, monosolvates (R ⁇ (solvent)) or polysolvates (R ⁇ n(solvent)), wherein n is an integer greater than 1) including, for example, disolvates (R ⁇ 2(solvent)), trisolvates (R ⁇ 3(solvent)), and the like, or hemisolvates, such as, for example, R ⁇ n/2(solvent), R ⁇ n/3(solvent), R ⁇ n/4(solvent) and the like, wherein n is an integer.
- Solvents herein include mixed solvents, for example, methanol/water, and as such, the solvates may incorporate one or more solvents within the solvate.
- acid hydrate refers to a complex that may be formed through association of a compound having one or more base moieties with at least one compound having one or more acid moieties or through association of a compound having one or more acid moieties with at least one compound having one or more base moieties, said complex being further associated with water molecules so as to form a hydrate, wherein said hydrate is as previously defined and R represents the complex herein described above.
- Structural, chemical and stereochemical definitions are broadly taken from IUPAC recommendations, and more specifically from Glossary of Terms used in Physical Organic Chemistry (IUPAC Recommendations 1994) as summarized by Müller, P. Pure Appl. Chem. 1994, 66, pp. 1077-1184 and Basic Terminology of Stereochemistry (IUPAC Recommendations 1996) as summarized by Moss, G. P. Pure Appl. Chem. 1996, 68, pp. 2193-2222.
- Atropisomers are defined as a subclass of conformers which can be isolated as separate chemical species and which arise from restricted rotation about a single bond.
- Enantiomers are defined as one of a pair of molecular entities which are mirror images of each other and non-superimposable.
- Diastereomers or diastereoisomers are defined as stereoisomers other than enantiomers. Diastereomers or diastereoisomers are stereoisomers not related as mirror images. Diastereoisomers are characterized by differences in physical properties, and by some differences in chemical behavior towards achiral as well as chiral reagents.
- tautomer refers to compounds produced by the phenomenon wherein a proton of one atom of a molecule shifts to another atom. See March, Advanced Organic Chemistry: Reactions, Mechanisms and Structures, 4th Ed., John Wiley & Sons, pp. 69-74 (1992). Tautomerism is defined as isomerism of the general form
- Tautomers are readily interconvertible; the atoms connecting the groups X, Y and Z are typically any of C, H, O, or S, and G is a group which becomes an electrofuge or nucleofuge during isomerization.
- electrofuge H +
- prototropy The most common case, when the electrofuge is H + , is also known as “prototropy.”
- Tautomers are defined as isomers that arise from tautomerism, independent of whether the isomers are isolable.
- ChemDraw version 8.0 or 10 was used to name structures.
- ADP is adenosine diphosphate
- ATP is adenosine triphosphate
- dba is dibenzylideneacetone
- DIEA is N,N-diisopropylethylamine
- DMA is N,N-dimethylacetamide
- DMF is N,N-dimethylformamide
- DMSO is dimethylsulfoxide
- DTT is dithiothreitol
- EGTA is ethylene glycol tetraacetic acid
- ESI electrospray ionization
- GST is glutathione S-transferase
- “h” is hour or hours
- HATU is 2-(7-Aza-1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate
- HEPES is 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid
- HPLC is
- IC 50 half maximal inhibitory concentration
- MS mass spectrometry
- min minutes
- NADH nicotinamide adenine dinucleotide
- NMR nuclear magnetic resonance
- PBS phosphate buffered saline
- RT room temperature
- THF tetrahydrofuran
- Tris tris(hydroxymethyl)aminomethane
- xantphos is 4,5-bis(diphenylphosphino)-9,9-dimethylxanthene.
- X, B, Z1, Z2, Z3, R1, R2, R3, R4, R6, R7, R25, m, n and p are as defined above for Formula I;
- each heterocyclyl and heteroaryl individually and independently has a C or N bonding hand.
- a ring N atom from the heterocyclyl is the bonding atom to —C(O) to form an amide, carbamate, or urea.
- a ring N atom from the heteroaryl is the bonding atom to —C(O) to form an amide, carbamate, or urea.
- compounds of the Formula I are compounds of the Formula Ib:
- X, R1, R2, R3, R4, R6, R7, R25, m, n and p are as defined above for Formula I;
- n 0, 1, or 2;
- compounds of the Formula I are compounds of the Formula Ic:
- R2, R3, R4, R6, R7, R25, m, n, and p are as defined above for Formula Ib.
- compounds of the Formula I are compounds of the Formula Ie:
- X, R1, R2, R3, R4, R6, R7, R25, m, n, and p are as defined above for Formula Ib.
- compounds of the Formula I are compounds of the Formula If:
- R2, R3, R4, R6, R7, R25, m, n, and p are as defined above for Formula Ib.
- compounds of the Formula I are compounds of the Formula Ih:
- X, R1, R2, R3, R4, R6, R7, R25, m, n and p are as defined above for Formula I.
- compounds of the Formula I are compounds of the Formula Ij:
- R2, R3, R4, R6, R7, R25, m, n and p are as defined above for Formula I.
- compounds of the Formula I are compounds of the Formula Il:
- X, R1, R2, R3, R4, R6, R7, R25, m, n and p are as defined above for Formula I.
- compounds of the Formula I are compounds of the Formula Im:
- R2, R3, R4, R6, R7, R25, m, n and p are as defined above for Formula I.
- X is halogen. In other embodiments, X is F or Cl. In further embodiments, X is F.
- each R1 is individually and independently halogen. In other embodiments, each R1 is individually and independently F or Cl. In further embodiments, each R1 is F.
- m is 1 and R1 is halogen. In other embodiments, m is 1 and R1 is F or Cl. In further embodiments, m is 1 and R1 is F.
- X and each R1 is individually and independently halogen. In other embodiments, X and each R1 is individually and independently F or Cl. In further embodiments, X and each R1 is F.
- m is 1 and X and each R1 is individually and independently halogen. In other embodiments, m is 1 and X and each R1 is individually and independently F or Cl. In further embodiments m is 1 and X and each R1 is F.
- R3 is —C(O)R4 and R4 is C1-C7 alkyl, C3-C8 cycloalkyl, —(CH 2 ) p —CN, —(CH 2 ) p —OR6, —(CH 2 ) p —NR6(R7), or —(CH 2 ) p —C4-C6-heterocyclyl, wherein each alkyl or alkylene is optionally substituted with one or two C1-C6 alkyl.
- one alkyl or alkylene is substituted by one C1-C6 alkyl.
- one alkyl or alkylene is substituted by one C1-alkyl.
- R3 is —C(O)—C6-C10-aryl, —C(O)—C4-C6-heterocyclyl, or —C(O)—C5-C6-heteroaryl.
- Compounds described herein rind utility in the treatment of mammalian cancers and especially human cancers including, but not limited to, solid tumors, gastric cancers, melanomas, glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer, lung cancers, non small cell lung cancer, breast cancers, kidney cancers, cervical carcinomas, metastasis of primary tumor sites, colonic cancers, myeloproliferative diseases, diseases wherein the etiology or progression is dependent on c-MET kinase activity, or on the activity of oncogenic forms-, aberrant fusion protein forms, and mutant forms of c-MET kinase.
- the compound is administered by a method selected from the group consisting of oral, parenteral, inhalation, and subcutaneous.
- the disclosed methods also include treating individuals suffering from a condition selected from the group consisting of cancer, hyperproliferative diseases, metabolic diseases, neurodegenerative diseases or diseases characterized by angiogenesis.
- These methods comprise administering to such individuals compounds disclosed herein, and especially those of section 1, said diseases including, but not limited to, solid tumors, malignant melanomas, glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer, lung cancers, breast cancers, kidney cancers, hepatic cancers, cervical carcinomas, metastasis of primary tumor sites, myeloproliferative diseases, chronic myelogenous leukemia, leukemias, papillary thyroid carcinoma, non-small cell lung cancer, mesothelioma, hypereosinophilic syndrome, gastrointestinal stromal tumors, colonic cancers, ocular diseases characterized by hyperproliferation leading to blindness including various retinopathies, diabetic retinopathy and age-related macular degeneration and hypereosinophilic syndrome, r
- compositions may form a part of a pharmaceutical composition by combining one or more such compounds with a pharmaceutically acceptable carrier.
- the compositions may include an additive selected from the group consisting of adjuvants, excipients, diluents, and stabilizers.
- carboxylic acid 2 is also, in some embodiments, first coupled with aniline 5 to yield intermediate 6, which is then in turn coupled with 3 to yield desired compound 1.
- Scheme 2 illustrates the preparation of compound 10, an example of general formula 1 (wherein R1 is F, Z1, Z2, and Z3 are CH and R3 is —C(O)CH 3 ) by the general sequence of 2 ⁇ 4 ⁇ 1 (Scheme 1).
- R1 is F
- Z1, Z2, and Z3 are CH
- R3 is —C(O)CH 3
- Scheme 2 illustrates the preparation of compound 10, an example of general formula 1 (wherein R1 is F, Z1, Z2, and Z3 are CH and R3 is —C(O)CH 3 ) by the general sequence of 2 ⁇ 4 ⁇ 1 (Scheme 1).
- R1 is F
- Z1, Z2, and Z3 are CH
- R3 is —C(O)CH 3
- Coupling agents for the later transformation include TBTU (O-(benzotriazol-1-yl)-N,N,N′,N′-tetramethyluronium tetrafluoroborate), PyBOP (benzotriazol-1-yloxy)tripyrrolidinophosphonium hexafluorophosphate), EDC (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride) and BOP-Cl (bis(2-oxo-3-oxazolidinyl)phosphonic chloride).
- Amines of the general formula 3 that are useful for the invention are prepared by standard methods familiar to those skilled in the art. Several non-limiting examples are shown in the following schemes. A mixture of phenol 14 and benzamide 15, wherein LG is a leaving group such as a halide or sulfonate, are coupled in the presence of a base such as potassium tert-butoxide and a polar aprotic solvent at elevated temperatures (e.g., 100° C.) to yield 16 (Scheme 4). Protection of the aniline NH 2 of 16 with the appropriate protecting group (PG) familiar to one skilled in the art, such as a tert-butoxycarbonyl (BOC) group, followed by subjection to Hofmann rearrangement conditions results in the formation of 17.
- PG protecting group
- BOC tert-butoxycarbonyl
- the reagent R3-LG (18) is a carboxylic acid (wherein LG is OH) that is coupled with the amino moiety of 17 using standard peptide Coupling agents, as described above.
- reagent R3-LG (18) is an activated carboxylic acid derivative, such as an acid halide (wherein LG is halo) that undergoes reaction with amine 17 to provide 3.
- Conditions for the Hofmann rearrangement include bromine in aqueous KOH or addition of oxidants such as lead tetraacetate or hypervalent iodine reagents such as bis(trifluoroacetyl)iodobenzene in pyridine. Subsequent acylation of 22 with acetyl chloride (an example of R3-LG wherein LG is chloro) in a solution of pyridine yields 23. Removal of the BOC protecting group in a solution of HCl provides amine 7, an example of amine 3 wherein Z1, Z2, and Z3 are CH and R3 is —C(O)CH 3 .
- Amines of the general formula 3 are also accessed via 26 wherein Y is a typical leaving group in transition metal mediated coupling reactions (for example, chloride, bromide, or triflate) (Scheme 7).
- Y is a typical leaving group in transition metal mediated coupling reactions (for example, chloride, bromide, or triflate) (Scheme 7).
- an aprotic solvent for example 1,4-dioxane
- Pd(OAc) 2 or Pd 2 (dba) 3 and xantphos in the presence of cesium carbonate at elevated temperatures between 45° C. and 110° C. yields intermediate 3 (see Buchwald, et. al. Org. Lett . (2000), 2(8): 1101).
- intermediate 28 is assembled from 26 and 6 using methods described in Scheme 3 and subsequently reacted with 27 using catalytic palladium and xantphos (vide supra) to yield compounds of formula 1.
- Amine 26 is synthesized in a variety of ways, including those shown below in the following non-limiting examples. As depicted, in Scheme 8, amino-phenol 14 and 29 (wherein LG is a leaving group in a nucleophilic substitution reaction, such as a halide or sulfonate) is coupled upon addition of a base such as potassium tert-butoxide in a solution of DMA at elevated temperatures of 80° C. to 100° C.
- a base such as potassium tert-butoxide
- General amine 26 is also accessed via the 1-fluoro-4-nitrobenzene intermediate 30 (Scheme 9).
- the coupling of 30 with 31 proceeds at temperatures ranging from 0° C. to 80° C. in the presence of a base, for example sodium hydride.
- the resultant nitro intermediate 32 is then reduced using a variety of methods familiar to one skilled in the art to afford amine 26.
- Scheme 7 A non-limiting example of Scheme 7 is illustrated in Scheme 11, beginning with intermediate 36, prepared in Scheme 10.
- 36 readily reacts with acid chloride 13 (see. Scheme 3) in the presence of triethylamine to yield chloro-pyridine 37.
- Chloro-pyridine 37 is then converted to 38, a specific example of 1 wherein R1 is F, X is F, Z1, Z2, and Z3 are CH and R3 is —C(O)CH 3 , upon treatment with acetamide (an example of R3-NH 2 27 where R3 is acetyl) and cesium carbonate in the presence of a catalytic amount of palladium acetate and xantphos.
- the reaction mixture was concentrated under reduced pressure to remove the majority of DMF in the mixture, and was then partitioned between ethyl acetate (300 mL) and 10% aqueous lithium chloride (150 mL). A precipitate formed which was removed via suction filtration and then the layers were separated. The organic layer was washed with additional 10% aqueous lithium chloride (2 ⁇ 150 mL), saturated aqueous sodium bicarbonate (150 mL) and brine (150 mL).
- Cyclopropane-1,1-dicarboxylic acid monomethylester (2 g, 13.88 mmol) was dissolved in DMF (28 mL) and 4-fluoroaniline (1.999 mL, 20.82 mmol) was added, followed by diisopropylethylamine (12.12 mL, 69.4 mmol) and O-(benzotriazol-1-yl)-N,N,N′,N′-tetramethyluronium tetrafluoroborate (8.91 g, 27.8 mmol).
- Methyl 1-((4-fluorophenyl)carbamoyl)cyclopropanecarboxylate (3.28 g, 14.00 mmol) was dissolved in THF (23.34 mL), water (11.67 mL) was added, followed by lithium hydroxide monohydrate (1.763 g, 42.0 mmol), and the mixture stirred at room temperature for 30 minutes. After this time the THF was removed under reduced pressure and the pH of the water layer was adjusted to ⁇ 5 with 2 M HCl while the solution was cooled in an ice bath. The precipitate that formed was dissolved in ethyl acetate (125 mL) and the layers were separated.
- Cyclopropane-1,1-dicarboxylic acid monomethyl ester (0.4 g, 2.78 mmol) was, dissolved in DMF (5.55 mL) and aniline (0.380 mL, 4.16 mmol) was added, followed by diisopropylethylamine (2.424 mL, 13.88 mmol) and O-(benzotriazol-1-yl)-N,N,N′,N′-tetramethyluronium tetrafluoroborate (1.782 g, 5.55 mmol).
- the reaction mixture was stirred at room temperature for 18 hours and was then diluted with ethyl acetate (70 mL) and washed with 10% aqueous lithium chloride (3 ⁇ 40 mL), saturated aqueous ammonium chloride (40 mL), saturated aqueous sodium bicarbonate (40 mL) and brine (40 mL).
- the organic layer was dried over magnesium sulfate and evaporated to yield a dark brown oil. It was purified by silica gel chromatography (0 to 20% ethyl acetate/hexane) to yield methyl 1-(phenylcarbamoyl)cyclopropanecarboxylate (0.607 g, 100% yield) as a light peach solid.
- Example A1 (2.136 g, 8.32 mmol) was dissolved in dry THF (63 mL) and triethylamine (1.508 mL, 10.82 mmol) was added. To this solution was added Example B1 (2.414 g, 9.99 mmol) in dry THF (20 mL). The mixture stirred at room temperature for 30 minutes. The triethylamine hydrochloride was removed from the reaction mixture by suction filtration.
- N-(4-(2-chloropyridin-4-yloxy)-2,5-difluorophenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (3.819 g, 8.27 mmol), acetamide (2.442 g, 41.3 mmol), cesium carbonate (4.04 g, 12.40 mmol), and xantphos (0.469 g, 0.810 mmol) were stirred in dry dioxane (59.1 mL) while argon was bubbled through the mixture for 15 minutes.
- Example A2 A solution of Example A2 (0.147 g, 0.538 mmol) in dry THF (5.38 mL) with triethylamine (0.098 mL, 0.700 mmol) was added to Example B1 (0.169 g, 0.699 mmol). The mixture was stirred under argon for 20 minutes at room temperature. The reaction mixture was then filtered through a frit in order to remove the solid triethylamine hydrochloride that had precipitated.
- N-(5-chloro-4-(2-chloropyridin-4-yloxy)-2-fluorophenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (0.200 g, 0.418 mmol)
- acetamide (0.124 g, 2.091 mmol
- cesium carbonate (0.136 g, 0.418 mmol)
- xantphos 0.017 g, 0.029 mmol
- the mixture was again degassed for five minutes, and then the reaction flask was fitted with a reflux condenser. The system was flushed with argon and then heated at 100° C. under a balloon of argon for 3 hours.
- the reaction mixture was cooled to room temperature and diluted with water (30 mL) and a 4:1 mixture of ethyl acetate and THF (150 mL). The layers were separated, and the aqueous layer was washed with additional ethyl acetate/THF solution. The organic layers were combined and concentrated to yield a sticky orange oil.
- Example A 1 (0.12 g, 0.468 mmol) was dissolved in dry THF (4.68 mL) and triethylamine (0.085 mL, 0.608 mmol) was added. This solution was added to Example 132 (0.125 g, 0.561 mmol) and the mixture stirred under argon at room temperature for 2 hours.
- reaction mixture was filtered to remove triethylamine hydrochloride salt and the filtrate was evaporated to yield a light peach oil which was purified by silica gel chromatography (10 to 50% ethyl acetate/hexane) to yield N-(4-(2-chloropyridin-4-yloxy)-2,5-difluorophenyl)-N′-phenylcyclopropane-1,1-dicarboxamide (0.164 g, 79% yield) as a clear solid.
- N-(4-(2-chloropyridin-4-yloxy)-2,5-difluorophenyl)-N′-phenylcyclopropane-1,1-dicarboxamide (0.162 g, 0.365 mmol), acetamide (0.108 g, 1.825 mmol), cesium carbonate (0.178 g, 0.548 mmol), and xantphos (0.021 g, 0.036 mmol) were combined in dry dioxane (2.61 mL) and argon was bubbled through the mixture for 5 minutes. Palladium acetate (6.15 mg, 0.027 mmol) was added, and argon was bubbled through the mixture for an additional 5 minutes.
- the reaction flask was fitted with a reflux condenser and a balloon of argon and the mixture was heated at 100° C. for 20 hours.
- the reaction mixture was cooled to room temperature and partitioned between a 4:1 mixture of ethyl acetate and THF (50 mL) and water (50 mL).
- the aqueous layer was removed and the organic layer was washed with additional water (50 mL) and brine (50 mL).
- the organic layer was dried over magnesium sulfate and evaporated under reduced pressure to yield a light peach-colored film.
- Dichloromethane (10 mL) was added and after a few minutes solid began to precipitate. Sonication was used to precipitate out more solid.
- Example A3 300 mg, 1.07 mmol
- HATU 440 mg, 3.2 mmol
- DIEA 280 mg, 2.1 mmol
- the reaction mixture was stirred at 60° C. under nitrogen overnight. After cooling to room temperature water (30 mL) was added and the solution was extracted with ethyl acetate (3 ⁇ 50 mL). The combined organics were washed with brine (3 ⁇ 50 mL), dried over sodium sulfate, and concentrated.
- N-(4-(2-Chloropyridin-4-yloxy)-2,5-difluorophenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (0.25 g, 0.541 mmol) (as prepared in Example 1), cyclopropanecarboxamide (0.092 g, 1.083 mmol), xantphos (0.014 g, 0.024 mmol), and cesium carbonate (0.265 g, 0.812 mmol) were dissolved in dry dioxane (5.41 mL) and argon was bubbled through the mixture for 5 minutes.
- N-(4-(2-Chloropyridin-4-yloxy)-2,5-difluorophenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide 200 mg, 0.43 mmol (as prepared in Example 1), propionamide (95 mg, 1.30 mmol), xantphos (25 mg, 0.043 mmol), and cesium carbonate (280 mg, 0.86 mmol) were dissolved in dry dioxane (3 mL) and argon was bubbled through the mixture for 10 minutes. Pd 2 (dba) 3 (20 mg, 0.022 mmol) was then added, and the solution was degassed for an additional 10 minutes.
- the flask was fitted with a balloon of N 2 and slowly heated to 100° C. and stirred overnight.
- the reaction mixture was cooled to room temperature and diluted with a 4:1 mixture of ethyl acetate and THF (60 mL) and water (40 mL).
- the organic layer was separated and washed with brine and the aqueous layer was back extracted with the ethyl acetate/THF solution, which was then extracted with brine.
- N-(4-(2-Chloropyridin-4-yloxy)-2,5-difluorophenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (3 g, 6.5 mmol) (as prepared in Example 1), tert-butyl carbamate (2.3 g, 19.5 mmol), Xantphos (0.37 g, 0.65 mmol), and cesium carbonate (4.2 g, 13 mmol) were dissolved in dry dioxane (50 mL) and argon was bubbled through the mixture for 10 minutes.
- the mixture was cooled to room temperature and diluted with ethyl acetate (30 mL) and filtered to remove solids.
- the filtrate was washed with aq NaHCO 3 (30 mL) and brine (30 mL).
- the organic phase was dried over Na 2 SO 4 and evaporated at reduced pressure to give a foam.
- the foam was purified by reverse phase silica gel chromatography (35-80% acetonitrile/water/0.1% TFA). Fractions containing product were combined and evaporated at reduced pressure.
- the resultant aqueous mixture was then treated with saturated aq NaHCO 3 (4 mL) and allowed to stand.
- the solid was collected by filtration, washed with water (2 ⁇ 5 mL) and dried on high vacuum line at 80° C.
- N-(4-((2-aminopyridin-4-yl)oxy)-2,5-difluorophenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (150 mg, 0.34 mmol) (as prepared in Example 9) and 2-cyanoacetic acid (44 mg, 0.51 mmol) in DMF (2 mL) was added HATU (258 mg, 0.68 mmol) and DIEA (130 mg, 1 mmol) and the mixture was stirred at 60° C. under nitrogen overnight.
- N-(4-(2-chloropyridin-4-yloxy)-2,5-difluorophenyl)-N′-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide 160 mg, 0.34 mmol (as prepared in Example 1), 2,2-dimethyl-propionamide (100 mg, 1 mmol), xantphos (40 mg, 0.068 mmol), and cesium carbonate (222 mg, 0.68 mmol) were dissolved in dry dioxane (2 mL) and argon was bubbled through the mixture for 10 minutes. Pd(OAc) 2 (8 mg, 0.034 mmol) was then added, and the solution was degassed for an additional 10 minutes.
- e-MET kinase Activity of e-MET kinase (Seq. ID No. 2) was determined by following the production of ADP from the kinase reaction through coupling with the pyruvate kinase/lactate dehydrogenase system (e.g., Schindler et al. Science 2000, 289, pp. 1938-1942). In this assay, the oxidation of NADH (thus the decrease at A340 nm) was continuously monitored spectrophotometrically.
- the reaction mixture (100 ⁇ l) contained c-MET (c-MET residues: 956-1390, from Invitrogen, catalogue #PV3143, 6 nM), polyE4Y (1 mg/mL), MgCl 2 (10 mM), pyruvate kinase (4 units), lactate dehydrogenase (0.7 units), phosphoenol pyruvate (1 mM), and NADH (0.28 mM) in 90 mM Tris buffer containing 0.25 mM DTT, 0.2% octyl-glucoside and 1% DMSO, pH 7.5. Test compounds were incubated with c-MET (Seq. ID No. 2) and other reaction reagents at 22° C.
- ATP 100 ⁇ M
- BMG Polarstar Optima plate reader
- Activity of c-KIT kinase was determined by following the production of ADP from the kinase reaction through coupling with the pyruvate kinase/lactate dehydrogenase system (e.g., Schindler et al. Science 2000, 289, pp. 1938-1942). In this assay, the oxidation of NADH (thus the decrease at A340 nm) was continuously monitored spectrophotometrically.
- the reaction mixture (100 ⁇ l) contained c-KIT (cKIT residues T544-V976, from ProQinase, 5.4 nM), polyE4Y (1 mg/mL), MgCl 2 (10 mM), pyruvate kinase (4 units), lactate dehydrogenase (0.7 units), phosphoenol pyruvate (1 mM), and NADH (0.28 mM) in 90 mM Tris buffer containing 0.2% octyl-glucoside and 1% DMSO, pH 7.5. Test compounds were incubated with c-KIT (Seq. ID No. 1) and other reaction reagents at 22° C.
- ATP 200 ⁇ M
- BMG Polarstar Optima plate reader
- KDR kinase The activity of KDR kinase was determined by following the production of ADP from the kinase reaction through coupling with the pyruvate kinase/lactate dehydrogenase system (e.g., Schindler et al. Science 2000, 289, pp. 1938-1942). In this assay, the oxidation of NADH (thus the decrease at A340 nm) was continuously monitored spectrophotometrically. The reaction mixture (100 ⁇ l) contained KDR (Seq ID No.
- reaction rate was calculated using the 1 h to 2 h time frame. Percent inhibition was obtained by comparison of reaction rate with that of a control (i.e., with no test compound).
- IC 50 values were calculated from a series of percent inhibition values determined at a range of inhibitor concentrations using software routines as implemented in the GraphPad Prism software package.
- KDR kinase assay K2 is the same as for assay K1 except that (1) a nominal concentration of 2.1 nM of enzyme was employed (2) the reaction was pre-incubated at 30° C. for 2 h prior to initiation with ATP and (3) 1.0 mM ATP (final concentration) was used to initiate the reaction.
- KDR kinase assay K3 is the same as for assay K1 except that (1) a nominal concentration of 1.1 nM of enzyme was employed, (2) the buffer components per 100 ⁇ l reaction mixture were as follows: 75 mM Tris buffer containing 0.066% octyl-glucoside, 17 mM MgCl 2 , and 1% DMSO at pH 7.5, (3) the final concentration of DTT was 0.66 mM, (4) the reaction was pre-incubated at 30° C. for 1 h prior to initiation with ATP, and (5) 1.0 mM ATP (final concentration) was used to initiate the reaction.
- KDR protein sequence used for screening (Seq. ID No. 3) DPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKML KEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEF VPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLA RDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEF CRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQD FMS kinase Assay
- FMS kinase activity was determined by following the production of ADP from the kinase reaction through coupling with the pyruvate kinase/lactate dehydrogenase system (e.g. Schindler et al. Science 2000, 289, pp. 1938-1942). In this assay, the oxidation of NADH (thus the decrease at A340 nm) was continuously monitored spectrophotometrically.
- the reaction mixture (100 ⁇ l) contained FMS (purchased from Invitrogen or Millipore, 6 nM), polyE4Y (1 mg/mL), MgCl 2 (10 mM), pyruvate kinase (4 units), lactate dehydrogenase (0.7 units), phosphoenol pyruvate (1 mM) and NADH (0.28 mM) and ATP (500 mM) in a 90 mM Tris buffer containing 0.2% octyl-glucoside and 1% DMSO, pH 7.5.
- the inhibition reaction was started by mixing serial diluted test compound with the above reaction mixture. The absorption at 340 nm was monitored continuously for 4 hours at 30° C.
- IC 50 values were calculated from a series of percent inhibition values determined at a range of inhibitor concentrations using software routine's as implemented in the GraphPad Prism software package.
- EBC-1 cells (catalog #JCRB0820) were obtained from the Japan Health Science Research Resources Bank, Osaka, Japan. Briefly, cells were grown in DMEM supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, Calif.) at 37° C., 5% CO 2 , 95% humidity. Cells were allowed to expand until reaching 70-95% confluency at which point they were subcultured or harvested for assay use.
- test compound A serial dilution of test compound was dispensed into a 96-well black clear bottom plate (Corning, Corning, N.Y.). For each cell line, five thousand cells were added per well in 200 ⁇ L complete growth medium. Plates were incubated for 67 hours at 37° C., 5% CO 2 , 95% humidity. At the end of the incubation period 40 ⁇ L of a 440 ⁇ M solution of resazurin (Sigma, St. Louis, Mo.) in PBS was added to each well and incubated for an additional 5 hours at 37° C., 5% CO 2 , 95% humidity.
- MKN-45 cells (catalog #JCRB0254) were obtained from the Japan Health Science Research Resources Bank, Osaka, Japan. Briefly, cells were grown in RPMI 1640 media supplemented with 10% characterized fetal bovine serum (Invitrogen, Carlsbad, Calif.) at 37° C., 5% CO2, 95% humidity. Cells were allowed to expand until reaching 70-95% confluency at which point they were subcultured or harvested for assay use.
- test compound A serial dilution of test compound was dispensed into a 96-well black clear bottom plate (Corning, Corning, N.Y.). Five thousand cells were added per well in 200 ⁇ L complete growth medium. Plates were incubated for 67 hours at 37° C., 5% CO 2 , 95% humidity. At the end of the incubation period 40 ⁇ L of a 440 ⁇ M solution of resazurin (Sigma, St. Louis, Mo.) in PBS was added to each well and plates were incubated for an additional 5 h at 37° C., 5% CO 2 , 95% humidity.
- RON kinase Activity of RON kinase was determined by a radioactive filtration binding assay where incorporation of 33 P from 33 P- ⁇ -ATP to the substrate was measured. In this assay, detection of 33 P was indicative of RON phosphorylation activity which was directly proportional to the amount of phosphorylated peptide substrate (KKSRGDYMTMQIG).
- the reaction mixture contained: 400 nM RON, 20 mM HEPES, pH 7.5, 10 mM MgCl 2 , 2 mM MnCl 2 , 1 mM EGTA, 0.02% Brij 35, 0.02 mg/ml . . . BSA, 0.1 mM Na 3 VO 4 , and 2 mM DTT.
- the reaction mixture was incubated with compound at room temperature for 30 minutes. To initiate the reaction, an equal volume of 20 ⁇ M ATP and 0.4 mg/mL peptide substrate were added and then incubated at room temperature for 2 hours.
- the final assay conditions were: 200 nM RON, 10 ⁇ M ATP, 0.2 mg/mL substrate 20 mM HEPES, pH 7.5, 10 mM MgCl 2 , 1 mM EGTA, 0.02% Brij 35, 0.02 mg/mL BSA, 0.1 mM Na 3 VO 4 , 2 mM DTT, and 1% DMSO.
- IC 50 values were calculated from a series of % Activity values determined at a range of inhibitor concentrations using software routines as implemented in the GraphPad Prism software package.
- the reaction mixture contained: 400 nM FLT1, 20 mM HEPES, pH 7.5, 10 mM MgCl 2 , 2 mM MnCl 2 , 1 mM EGTA, 0.02% Brij 35, 0.02 mg mL BSA, 0.1 mM Na 3 VO 4 , and 2 mM DTT.
- the reaction mixture was incubated with compound at room temperature for 30 minutes. To initiate the reaction, an equal volume of 20 ⁇ M ATP and 0.2 mg/mL peptide substrate were added and then incubated at room temperature for 2 hours.
- the final assay conditions were: 200 nM FLT1, 10 ⁇ M ATP, 0.1 mg/mL substrate 20 mM HEPES, pH 7.5, 10 mM MgCl 2 , 1 mM EGTA, 0.02% Brij 35, 0.02 mg/mL BSA, 0.1 mM Na 3 VO 4 , 2 mM DTT, and 1% DMSO.
- IC 50 values were calculated from a series of % Activity values determined at a range of inhibitor concentrations using software routines as implemented in the Graph Pad Prism software package.
- RET kinase Activity of RET kinase was determined by following the production of ADP from the kinase reaction through coupling with the pyruvate kinase/lactate dehydrogenase system (see e.g., Schindler et al. Science (2000) 289: 1938-1942). In this assay, the oxidation of NADH (thus the decrease at A340 nm) was continuously monitored spectrophotometrically.
- the reaction mixture (100 ⁇ l) contained RET (amino acid residues 658-1114, from Invitrogen, 2 nM), polyE4Y (1.5 mg/ml), MgCl 2 (18 mM), pyruvate kinase (4 units), lactate dehydrogenase (0.7 units), phosphoenol pyruvate (1 mM), and NADH (0.28 mM) in 90 mM iris buffer containing 0.2% octyl-glucoside, 1 mM DTT and 1% DMSO, pH 7.5. Test compounds were incubated with RET kinase and other reaction reagents at 22° C.
- ATP 500 ⁇ M
- the absorption at 340 nm was monitored continuously for 3 hours at 30° C. on BioTek Synergy 2 Reader.
- the reaction rate was calculated using the 1 to 2 h time frame. Percent inhibition was obtained by comparison of reaction rate with that of a control (i.e., with no test compound).
- IC 50 values were calculated from a series of percent inhibition values determined at a range of inhibitor concentrations using software routines as implemented in the Graph Pad Prism software package.
- Compounds, of Formula I exhibit inhibitory activity in one or more of the aforementioned assays when evaluated at concentrations ⁇ 10 ⁇ M.
- Compound F and Compound G are almost identical, with the exception that Compound F is mono-fluorinated in the central phenyl ring whereas Compound G is di-fluorinated wherein the two fluorines are oriented para- with respect to each other in the central phenyl ring.
- Compound D potently inhibits c-MET kinase with an IC 50 value of 4 nM.
- Compound D is 6.5-fold more potent versus c-MET kinase than its mono-fluoro analog Compound E (4 nM versus 26 nM; see Table 1). This 6.5-fold greater potency versus MET kinase is unexpected in view of the c-MET inhibition data for Compound G compared to its corresponding mono-fluoro analog Compound F.
- Compound G and Compound F exhibit essentially equivalent potency versus c-MET kinase (53 nM versus 47 nM, respectively; 1.1-fold ratio of potency). See the '188 application, pp. 96-97.
- Compound H is also reported to be a potent MET kinase inhibitor, with IC 50 of 4 nM. Id.
- Compound H like Compound D, is di-fluorinated, with the two fluorines being oriented para with respect to each other in the central phenyl ring. Compound H, however, does not exhibit the selectivity against c-MET inhibition that has been observed for Compound D.
- Compound D exhibits a much higher kinase selectivity versus RON, RET, VEGFR-1, and VEGFR-2 kinases, compared to Compound E.
- RON is a very close kinase of the MET subfamily of kinases, and inhibitors of MET kinase are often not selective versus RON.
- Compound D is >1,250 fold selective of MET kinase versus RON kinase
- Compound E is only 3.85 fold of MET kinase versus RON kinase. See Table 1.
- Compound D is >825 fold selective of MET kinase versus RET kinase
- Compound E is only 1.65 fold selective of MET kinase versus RET kinase.
- Compound D is 19.75-fold selective of MET kinase versus VEGFR-1 kinase
- Compound E is significantly less selective: 6.15-fold selective of MET kinase versus VEGFR-1 kinase.
- Compound D is 13-fold selective of MET kinase versus VEGFR-2 kinase
- Compound E is significantly less selective: 4.69-fold selective of MET kinase versus VEGFR-2 kinase.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Biomedical Technology (AREA)
- Pulmonology (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Rheumatology (AREA)
- Oncology (AREA)
- Hematology (AREA)
- Pain & Pain Management (AREA)
- Hospice & Palliative Care (AREA)
- Psychiatry (AREA)
- Ophthalmology & Optometry (AREA)
- Diabetes (AREA)
- Obesity (AREA)
- Heart & Thoracic Surgery (AREA)
- Urology & Nephrology (AREA)
- Cardiology (AREA)
- Vascular Medicine (AREA)
- Immunology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Physical Education & Sports Medicine (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Pyridine Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/098,243 US20120058985A1 (en) | 2010-04-29 | 2011-04-29 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US13/480,108 US20120252849A1 (en) | 2010-04-29 | 2012-05-24 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US13/559,170 US8637672B2 (en) | 2010-04-29 | 2012-07-26 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US14/136,295 US20140194405A1 (en) | 2010-04-29 | 2013-12-20 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US14/602,781 US20150218130A1 (en) | 2010-04-29 | 2015-01-22 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US32954810P | 2010-04-29 | 2010-04-29 | |
| US13/098,243 US20120058985A1 (en) | 2010-04-29 | 2011-04-29 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/480,108 Continuation US20120252849A1 (en) | 2010-04-29 | 2012-05-24 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US13/559,170 Continuation US8637672B2 (en) | 2010-04-29 | 2012-07-26 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20120058985A1 true US20120058985A1 (en) | 2012-03-08 |
Family
ID=44260801
Family Applications (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/098,243 Abandoned US20120058985A1 (en) | 2010-04-29 | 2011-04-29 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US13/480,108 Abandoned US20120252849A1 (en) | 2010-04-29 | 2012-05-24 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US13/559,170 Expired - Fee Related US8637672B2 (en) | 2010-04-29 | 2012-07-26 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US14/136,295 Abandoned US20140194405A1 (en) | 2010-04-29 | 2013-12-20 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US14/602,781 Abandoned US20150218130A1 (en) | 2010-04-29 | 2015-01-22 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
Family Applications After (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/480,108 Abandoned US20120252849A1 (en) | 2010-04-29 | 2012-05-24 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US13/559,170 Expired - Fee Related US8637672B2 (en) | 2010-04-29 | 2012-07-26 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US14/136,295 Abandoned US20140194405A1 (en) | 2010-04-29 | 2013-12-20 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US14/602,781 Abandoned US20150218130A1 (en) | 2010-04-29 | 2015-01-22 | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
Country Status (17)
| Country | Link |
|---|---|
| US (5) | US20120058985A1 (enExample) |
| EP (1) | EP2563362B1 (enExample) |
| JP (1) | JP5795630B2 (enExample) |
| KR (1) | KR20130109943A (enExample) |
| CN (1) | CN103068384B (enExample) |
| AU (1) | AU2011245248B2 (enExample) |
| BR (1) | BR112012027743A2 (enExample) |
| CA (1) | CA2800569A1 (enExample) |
| DK (1) | DK2563362T3 (enExample) |
| ES (1) | ES2475741T3 (enExample) |
| IL (1) | IL222728A0 (enExample) |
| MX (1) | MX2012012571A (enExample) |
| PH (1) | PH12012502142A1 (enExample) |
| PT (1) | PT2563362E (enExample) |
| RU (1) | RU2012151012A (enExample) |
| SG (2) | SG10201503394PA (enExample) |
| WO (1) | WO2011137342A1 (enExample) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130079362A1 (en) * | 2008-10-29 | 2013-03-28 | Deciphera Pharmaceuticals, Llc | Cyclopropane amides and analogs exhibiting anti-cancer and anti-proliferative activities |
| WO2014145023A1 (en) * | 2013-03-15 | 2014-09-18 | Deciphera Pharmaceuticals, Llc | 1,2,4-triazol-5-ones and analogs exhibiting anti-cancer and anti-proliferative activities |
Families Citing this family (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PH12012502142A1 (en) * | 2010-04-29 | 2017-04-21 | Deciphera Pharmaceuticals Llc | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
| CN102702121B (zh) * | 2012-04-06 | 2016-04-13 | 浙江工业大学 | 一种化合物间羟基苯基四嗪二甲酰胺及制备和应用 |
| CN102702120A (zh) * | 2012-04-06 | 2012-10-03 | 浙江工业大学 | 一种新化合物邻羟基苯基四嗪二甲酰胺及制备和应用 |
| AU2013259583A1 (en) | 2012-05-08 | 2014-11-13 | The Regents Of The University Of California | Alpha 7 nicotinic acetylcholine allosteric modulators, their derivatives and uses thereof |
| US8461179B1 (en) | 2012-06-07 | 2013-06-11 | Deciphera Pharmaceuticals, Llc | Dihydronaphthyridines and related compounds useful as kinase inhibitors for the treatment of proliferative diseases |
| ES2798899T3 (es) | 2013-02-25 | 2020-12-14 | Novartis Ag | Mutación novedosa del receptor de andrógenos |
| WO2016061231A1 (en) * | 2014-10-14 | 2016-04-21 | Deciphera Pharmaceuticals, Llc | Inhibition of tumor cell interactions with the microenvironment resulting in a reduction in tumor growth and disease progression |
| EP3206752A1 (en) * | 2014-10-14 | 2017-08-23 | Deciphera Pharmaceuticals, LLC | Inhibition of trk kinase mediated tumor growth and disease progression |
| US20170079966A1 (en) * | 2014-10-14 | 2017-03-23 | Deciphera Pharmaceuticals, Llc | Inhibition of tumor cell interactions with the microenvironment resulting in a reduction in tumor growth and disease progression |
| BR112018068681A2 (pt) | 2016-03-16 | 2019-01-15 | Bayer Cropscience Ag | derivados de n-(cianobenzil)-6-(ciclopropil-carbonilamino)-4-(fenil)-piridina-2-carboxamida e compostos relacionados como pesticidas e agentes de proteção de plantas |
| CN106349158B (zh) * | 2016-08-03 | 2020-02-28 | 杭州市西溪医院 | 一种c-Met小分子抑制剂、含其的药物组合物及其药学应用 |
| CN107793363B (zh) * | 2016-09-06 | 2021-02-26 | 上海医药工业研究院 | 一种取代芳胺基芳杂环类化合物及其作为抗肿瘤药物的应用 |
| CN106831707B (zh) * | 2016-12-28 | 2019-09-20 | 杭州市西溪医院 | 作为c-Met激酶抑制剂的苯并杂环类衍生物及其医疗用途 |
| US10180422B1 (en) | 2017-08-22 | 2019-01-15 | Scripps Health | Methods of treating a neuroendocrine tumor |
| CN109988108B (zh) * | 2017-12-29 | 2022-04-29 | 江苏豪森药业集团有限公司 | 一种卡博替尼的制备方法 |
| AU2019215081B2 (en) | 2018-01-31 | 2024-07-25 | Deciphera Pharmaceuticals, Llc. | Combination therapy for the treatment of gastrointestinal stromal tumors |
| CN111886006B (zh) | 2018-01-31 | 2024-07-09 | 德西费拉制药有限责任公司 | 治疗肥大细胞增多症的组合疗法 |
| PT3902547T (pt) | 2018-12-28 | 2023-12-04 | Deciphera Pharmaceuticals Llc | Inibidores de csf1r para utilização no tratamento do cancro |
| WO2020185812A1 (en) | 2019-03-11 | 2020-09-17 | Teva Pharmaceuticals International Gmbh | Solid state forms of ripretinib |
| SI3966206T1 (sl) | 2019-05-10 | 2023-12-29 | Deciphera Pharmaceuticals, Llc | Heteroarilaminopirimidinski amidni zaviralci avtofagije in načini njihove uporabe |
| HRP20231730T1 (hr) | 2019-05-10 | 2024-05-10 | Deciphera Pharmaceuticals, Llc | Fenilaminopirimidin amidni inhibitori autofagije i postupci njihove primjene |
| CA3143489A1 (en) | 2019-06-17 | 2020-12-24 | Deciphera Pharmaceuticals, Llc | Aminopyrimidine amide autophagy inhibitors and methods of use thereof |
| MX2022001863A (es) | 2019-08-12 | 2022-05-30 | Deciphera Pharmaceuticals Llc | Metodos para tratar los tumores del estroma gastrointestinal. |
| WO2021030405A1 (en) | 2019-08-12 | 2021-02-18 | Deciphera Pharmaceuticals, Llc | Ripretinib for treating gastrointestinal stromal tumors |
| CN119970649A (zh) | 2019-12-30 | 2025-05-13 | 德西费拉制药有限责任公司 | 非晶型激酶抑制剂制剂及其使用方法 |
| FI4084779T3 (fi) | 2019-12-30 | 2024-12-16 | Deciphera Pharmaceuticals Llc | 1-(4-bromi-5-(1-etyyli-7-(metyyliamino)-2-okso-1,2-dihydro-1,6-naftyridin-3-yyli)-2-fluorifenyyli)-3-fenyyliurean koostumuksia |
| WO2022109001A1 (en) | 2020-11-18 | 2022-05-27 | Deciphera Pharmaceuticals, Llc | Gcn2 and perk kinase inhibitors and methods of use thereof |
| EP4444429A1 (en) | 2021-12-09 | 2024-10-16 | Deciphera Pharmaceuticals, LLC | Raf kinase inhibitors and methods of use thereof |
| CN114394940B (zh) * | 2022-01-26 | 2024-01-16 | 武汉工程大学 | 一种环丙基-1,1二酰胺类化合物及其制备方法和应用 |
| US11779572B1 (en) | 2022-09-02 | 2023-10-10 | Deciphera Pharmaceuticals, Llc | Methods of treating gastrointestinal stromal tumors |
| WO2025122952A1 (en) | 2023-12-08 | 2025-06-12 | Deciphera Pharmaceuticals, Llc | Formulations of vimseltinib |
| WO2025231106A1 (en) | 2024-05-01 | 2025-11-06 | Deciphera Pharmaceuticals, Llc | Csf-1r inhibitors and methods of use thereof |
Family Cites Families (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070270421A1 (en) * | 2004-02-27 | 2007-11-22 | Tomohiro Matsushima | Novel pyridine Derivative and Pyrimidine Derivative (1) |
| US7459562B2 (en) | 2004-04-23 | 2008-12-02 | Bristol-Myers Squibb Company | Monocyclic heterocycles as kinase inhibitors |
| DK1889836T3 (da) * | 2005-08-24 | 2013-08-19 | Eisai R&D Man Co Ltd | Hidtil ukendt pyridinderivat og pyrimidinderivat |
| US8003662B2 (en) | 2006-01-30 | 2011-08-23 | Array Biopharma, Inc. | Heterobicyclic thiophene compounds and methods of use |
| CA2661333C (en) | 2006-08-23 | 2014-08-05 | Eisai R&D Management Co., Ltd. | Salt of phenoxypyridine derivative or crystal thereof and process for producing the same |
| US7790885B2 (en) | 2006-08-31 | 2010-09-07 | Eisai R&D Management Co., Ltd. | Process for preparing phenoxypyridine derivatives |
| US7790756B2 (en) | 2006-10-11 | 2010-09-07 | Deciphera Pharmaceuticals, Llc | Kinase inhibitors useful for the treatment of myleoproliferative diseases and other proliferative diseases |
| US20080255155A1 (en) | 2006-10-18 | 2008-10-16 | Stephane Raeppel | Kinase inhibitors and uses thereof |
| KR20090090365A (ko) | 2007-02-23 | 2009-08-25 | 에자이 알앤드디 매니지먼트 가부시키가이샤 | Hgfr 유전자 증폭 세포주에 대하여 우수한 세포 증식 억제 효과 및 항종양 효과를 나타내는 피리딘 유도체 또는 피리미딘 유도체 |
| WO2009033084A1 (en) | 2007-09-06 | 2009-03-12 | Array Biopharma Inc. | Pyrazolo-pyridines as tyrosine kinase inhibitors |
| JP2009132660A (ja) | 2007-11-30 | 2009-06-18 | Eisai R & D Management Co Ltd | 食道癌治療用組成物 |
| US20090227556A1 (en) * | 2008-01-31 | 2009-09-10 | Eisai R&D Management Co., Ltd. | Receptor tyrosine kinase inhibitors comprising pyridine and pyrimidine derivatives |
| JPWO2009104520A1 (ja) | 2008-02-18 | 2011-06-23 | エーザイ・アール・アンド・ディー・マネジメント株式会社 | フェノキシピリジン誘導体の製造方法(2) |
| TW201035017A (en) * | 2008-09-26 | 2010-10-01 | Smithkline Beecham Corp | Preparation of a quinolinyloxydiphenylcyclopropanedicarboxamide |
| EP2365752B1 (en) * | 2008-10-29 | 2014-09-24 | Deciphera Pharmaceuticals, Llc | Cyclopropane amides and analogs exhibiting anti-cancer and anti-proliferative activities |
| WO2010064300A1 (ja) | 2008-12-02 | 2010-06-10 | エーザイ・アール・アンド・ディー・マネジメント株式会社 | 食道癌治療用組成物 |
| JP2010178651A (ja) | 2009-02-04 | 2010-08-19 | Eisai R & D Management Co Ltd | Hgfr阻害物質の作用検定方法 |
| PH12012502142A1 (en) * | 2010-04-29 | 2017-04-21 | Deciphera Pharmaceuticals Llc | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
-
2011
- 2011-04-29 PH PH1/2012/502142A patent/PH12012502142A1/en unknown
- 2011-04-29 CN CN201180031486.XA patent/CN103068384B/zh not_active Expired - Fee Related
- 2011-04-29 BR BR112012027743A patent/BR112012027743A2/pt active Search and Examination
- 2011-04-29 RU RU2012151012/04A patent/RU2012151012A/ru not_active Application Discontinuation
- 2011-04-29 PT PT117194217T patent/PT2563362E/pt unknown
- 2011-04-29 WO PCT/US2011/034556 patent/WO2011137342A1/en not_active Ceased
- 2011-04-29 CA CA2800569A patent/CA2800569A1/en not_active Abandoned
- 2011-04-29 MX MX2012012571A patent/MX2012012571A/es active IP Right Grant
- 2011-04-29 ES ES11719421.7T patent/ES2475741T3/es active Active
- 2011-04-29 AU AU2011245248A patent/AU2011245248B2/en not_active Ceased
- 2011-04-29 JP JP2013508280A patent/JP5795630B2/ja not_active Expired - Fee Related
- 2011-04-29 SG SG10201503394PA patent/SG10201503394PA/en unknown
- 2011-04-29 EP EP11719421.7A patent/EP2563362B1/en not_active Not-in-force
- 2011-04-29 SG SG2012079760A patent/SG185073A1/en unknown
- 2011-04-29 US US13/098,243 patent/US20120058985A1/en not_active Abandoned
- 2011-04-29 DK DK11719421.7T patent/DK2563362T3/da active
- 2011-04-29 KR KR1020127031316A patent/KR20130109943A/ko not_active Ceased
-
2012
- 2012-05-24 US US13/480,108 patent/US20120252849A1/en not_active Abandoned
- 2012-07-26 US US13/559,170 patent/US8637672B2/en not_active Expired - Fee Related
- 2012-10-28 IL IL222728A patent/IL222728A0/en unknown
-
2013
- 2013-12-20 US US14/136,295 patent/US20140194405A1/en not_active Abandoned
-
2015
- 2015-01-22 US US14/602,781 patent/US20150218130A1/en not_active Abandoned
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130079362A1 (en) * | 2008-10-29 | 2013-03-28 | Deciphera Pharmaceuticals, Llc | Cyclopropane amides and analogs exhibiting anti-cancer and anti-proliferative activities |
| US8486951B2 (en) * | 2008-10-29 | 2013-07-16 | Deciphera Pharmaceuticals, Llc | Cyclopropane amides and analogs exhibiting anti-cancer and anti-proliferative activities |
| WO2014145023A1 (en) * | 2013-03-15 | 2014-09-18 | Deciphera Pharmaceuticals, Llc | 1,2,4-triazol-5-ones and analogs exhibiting anti-cancer and anti-proliferative activities |
Also Published As
| Publication number | Publication date |
|---|---|
| US8637672B2 (en) | 2014-01-28 |
| SG10201503394PA (en) | 2015-06-29 |
| JP2013525458A (ja) | 2013-06-20 |
| RU2012151012A (ru) | 2014-06-10 |
| EP2563362A1 (en) | 2013-03-06 |
| MX2012012571A (es) | 2013-04-05 |
| US20140194405A1 (en) | 2014-07-10 |
| SG185073A1 (en) | 2012-12-28 |
| ES2475741T3 (es) | 2014-07-11 |
| AU2011245248B2 (en) | 2016-01-07 |
| US20150218130A1 (en) | 2015-08-06 |
| CA2800569A1 (en) | 2011-11-03 |
| BR112012027743A2 (pt) | 2017-03-14 |
| WO2011137342A1 (en) | 2011-11-03 |
| CN103068384A (zh) | 2013-04-24 |
| IL222728A0 (en) | 2012-12-31 |
| US20120322834A1 (en) | 2012-12-20 |
| JP5795630B2 (ja) | 2015-10-14 |
| AU2011245248A1 (en) | 2012-12-20 |
| HK1184392A1 (zh) | 2014-01-24 |
| DK2563362T3 (da) | 2014-06-23 |
| US20120252849A1 (en) | 2012-10-04 |
| KR20130109943A (ko) | 2013-10-08 |
| PH12012502142A1 (en) | 2017-04-21 |
| PT2563362E (pt) | 2014-07-11 |
| CN103068384B (zh) | 2015-03-11 |
| EP2563362B1 (en) | 2014-03-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8637672B2 (en) | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities | |
| US8921565B2 (en) | Pyridone amides and analogs exhibiting anti-cancer and anti-proliferative activities | |
| US8569319B2 (en) | Pyridone amides and analogs exhibiting anti-cancer and anti-proliferative activities | |
| JP7461927B2 (ja) | 癌免疫療法剤としての新規エクトヌクレオチドピロホスファターゼ/ホスホジエステラーゼ-1(ENPP1)の置換3H-イミダゾ[4,5-c]ピリジンおよび1H-ピロロ[2,3-c]ピリジンシリーズならびにインターフェロン遺伝子刺激因子(STING)調節剤 | |
| US9012635B2 (en) | Pyridone amides and analogs exhibiting anti-cancer and anti-proliferative activities | |
| AU2006203828B2 (en) | CXCR4 antagonists for the treatment of medical disorders | |
| JP2021191770A (ja) | 抗癌活性及び抗増殖活性を呈する2−アミノピリミジン−6−オン及び類似体 | |
| CA2493660A1 (en) | Process for preparing quinolin antibiotic intermediates | |
| US7109203B2 (en) | Sulfonamide derivatives | |
| CA2824415A1 (en) | Benzamide derivatives as p2x7 receptor antagonists | |
| WO2018090792A1 (zh) | 一种选择性布鲁顿酪氨酸激酶抑制剂及其应用 | |
| HK1184392B (en) | Cyclopropyl dicarboxamides and analogs exhibiting anti-cancer and anti-proliferative activities |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: DECIPHERA PHARMACEUTICALS, LLC, KANSAS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:FLYNN, DANIEL L.;KAUFMAN, MICHAEL D.;REEL/FRAME:026496/0755 Effective date: 20110609 |
|
| AS | Assignment |
Owner name: DECIPHERA PHARMACEUTICALS, LLC, KANSAS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:FLYNN, DANIEL L.;KAUFMAN, MICHAEL D.;REEL/FRAME:027543/0069 Effective date: 20111107 |
|
| AS | Assignment |
Owner name: BRIGHTSTAR ASSOCIATES LLC, KANSAS Free format text: SECURITY AGREEMENT;ASSIGNOR:DECIPHERA PHARMACEUTICALS, LLC;REEL/FRAME:028503/0011 Effective date: 20040129 |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
|
| AS | Assignment |
Owner name: DECIPHERA PHARMACEUTICALS, LLC, KANSAS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:FLYNN, DANIEL L.;KAUFMAN, MICHAEL D.;REEL/FRAME:032485/0769 Effective date: 20111107 |
|
| AS | Assignment |
Owner name: DECIPHERA PHARMACEUTICALS, LLC, MASSACHUSETTS Free format text: RELEASE BY SECURED PARTY;ASSIGNOR:BRIGHTSTAR ASSOCIATES, LLC;REEL/FRAME:037359/0866 Effective date: 20151222 |