US11572395B2 - Fusion protein comprising an FGF-18 moiety - Google Patents
Fusion protein comprising an FGF-18 moiety Download PDFInfo
- Publication number
- US11572395B2 US11572395B2 US16/648,677 US201816648677A US11572395B2 US 11572395 B2 US11572395 B2 US 11572395B2 US 201816648677 A US201816648677 A US 201816648677A US 11572395 B2 US11572395 B2 US 11572395B2
- Authority
- US
- United States
- Prior art keywords
- moiety
- seq
- fgf
- amino acid
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active, expires
Links
- 102000003977 fibroblast growth factor 18 Human genes 0.000 title claims abstract description 187
- 108090000370 fibroblast growth factor 18 Proteins 0.000 title claims abstract description 187
- 108020001507 fusion proteins Proteins 0.000 title claims abstract description 81
- 102000037865 fusion proteins Human genes 0.000 title claims abstract description 79
- 201000008482 osteoarthritis Diseases 0.000 claims abstract description 49
- 208000015100 cartilage disease Diseases 0.000 claims abstract description 21
- 206010061762 Chondropathy Diseases 0.000 claims abstract description 17
- 206010007710 Cartilage injury Diseases 0.000 claims abstract description 15
- 238000000034 method Methods 0.000 claims description 20
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 7
- 239000008194 pharmaceutical composition Substances 0.000 claims description 6
- 238000011282 treatment Methods 0.000 abstract description 19
- 150000001413 amino acids Chemical group 0.000 description 179
- 239000003795 chemical substances by application Substances 0.000 description 59
- 210000004027 cell Anatomy 0.000 description 54
- 229950008160 tanezumab Drugs 0.000 description 47
- 230000004927 fusion Effects 0.000 description 46
- 210000000845 cartilage Anatomy 0.000 description 41
- 102100035323 Fibroblast growth factor 18 Human genes 0.000 description 38
- 101000878128 Homo sapiens Fibroblast growth factor 18 Proteins 0.000 description 38
- 208000002193 Pain Diseases 0.000 description 25
- 230000008901 benefit Effects 0.000 description 25
- 230000000694 effects Effects 0.000 description 25
- 239000012634 fragment Substances 0.000 description 24
- 108090000623 proteins and genes Proteins 0.000 description 22
- 229950000335 fasinumab Drugs 0.000 description 20
- 108091033319 polynucleotide Proteins 0.000 description 20
- 102000040430 polynucleotide Human genes 0.000 description 20
- 239000002157 polynucleotide Substances 0.000 description 20
- 229950009370 fulranumab Drugs 0.000 description 18
- 238000002347 injection Methods 0.000 description 18
- 239000007924 injection Substances 0.000 description 18
- 102000004169 proteins and genes Human genes 0.000 description 18
- 108010025020 Nerve Growth Factor Proteins 0.000 description 17
- 102000015336 Nerve Growth Factor Human genes 0.000 description 17
- 241001465754 Metazoa Species 0.000 description 15
- 210000001612 chondrocyte Anatomy 0.000 description 15
- 125000000539 amino acid group Chemical group 0.000 description 14
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 14
- 230000014509 gene expression Effects 0.000 description 14
- 150000007523 nucleic acids Chemical class 0.000 description 12
- 229950002135 sprifermin Drugs 0.000 description 12
- 108020004414 DNA Proteins 0.000 description 11
- 102000039446 nucleic acids Human genes 0.000 description 11
- 108020004707 nucleic acids Proteins 0.000 description 11
- 239000013598 vector Substances 0.000 description 11
- 206010017577 Gait disturbance Diseases 0.000 description 10
- 230000001684 chronic effect Effects 0.000 description 10
- 239000003112 inhibitor Substances 0.000 description 10
- 239000003981 vehicle Substances 0.000 description 10
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 9
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 9
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 9
- 229940024606 amino acid Drugs 0.000 description 9
- 230000006378 damage Effects 0.000 description 9
- 208000014674 injury Diseases 0.000 description 9
- 238000001356 surgical procedure Methods 0.000 description 9
- 102100037680 Fibroblast growth factor 8 Human genes 0.000 description 8
- 102100037665 Fibroblast growth factor 9 Human genes 0.000 description 8
- 241000700159 Rattus Species 0.000 description 8
- 230000004071 biological effect Effects 0.000 description 8
- 210000000988 bone and bone Anatomy 0.000 description 8
- 201000010099 disease Diseases 0.000 description 8
- JDNTWHVOXJZDSN-UHFFFAOYSA-N iodoacetic acid Chemical compound OC(=O)CI JDNTWHVOXJZDSN-UHFFFAOYSA-N 0.000 description 8
- 102100027842 Fibroblast growth factor receptor 3 Human genes 0.000 description 7
- 101710182396 Fibroblast growth factor receptor 3 Proteins 0.000 description 7
- 101001027380 Homo sapiens Fibroblast growth factor 9 Proteins 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 210000000629 knee joint Anatomy 0.000 description 7
- 239000002609 medium Substances 0.000 description 7
- 239000000203 mixture Substances 0.000 description 7
- 102000004196 processed proteins & peptides Human genes 0.000 description 7
- 108090000765 processed proteins & peptides Proteins 0.000 description 7
- 230000008439 repair process Effects 0.000 description 7
- 208000024891 symptom Diseases 0.000 description 7
- 102100035308 Fibroblast growth factor 17 Human genes 0.000 description 6
- 101001027382 Homo sapiens Fibroblast growth factor 8 Proteins 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 239000000427 antigen Substances 0.000 description 6
- 102000036639 antigens Human genes 0.000 description 6
- 108091007433 antigens Proteins 0.000 description 6
- 206010003246 arthritis Diseases 0.000 description 6
- 150000001875 compounds Chemical class 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 230000005021 gait Effects 0.000 description 6
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 5
- 102000012422 Collagen Type I Human genes 0.000 description 5
- 108010022452 Collagen Type I Proteins 0.000 description 5
- 108020004635 Complementary DNA Proteins 0.000 description 5
- 108060003951 Immunoglobulin Proteins 0.000 description 5
- 208000013201 Stress fracture Diseases 0.000 description 5
- 208000027418 Wounds and injury Diseases 0.000 description 5
- 210000001188 articular cartilage Anatomy 0.000 description 5
- 238000010804 cDNA synthesis Methods 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 210000000968 fibrocartilage Anatomy 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 102000018358 immunoglobulin Human genes 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 238000012360 testing method Methods 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- 108050002074 Fibroblast growth factor 17 Proteins 0.000 description 4
- 108090000368 Fibroblast growth factor 8 Proteins 0.000 description 4
- 108090000367 Fibroblast growth factor 9 Proteins 0.000 description 4
- 101000878124 Homo sapiens Fibroblast growth factor 17 Proteins 0.000 description 4
- 230000007547 defect Effects 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 210000002683 foot Anatomy 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 210000003127 knee Anatomy 0.000 description 4
- 239000000902 placebo Substances 0.000 description 4
- 229940068196 placebo Drugs 0.000 description 4
- 230000035755 proliferation Effects 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 102000053602 DNA Human genes 0.000 description 3
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 3
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 3
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 3
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 3
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 3
- 201000009859 Osteochondrosis Diseases 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 239000012911 assay medium Substances 0.000 description 3
- 230000001588 bifunctional effect Effects 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 231100000673 dose–response relationship Toxicity 0.000 description 3
- 230000000857 drug effect Effects 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 229940126864 fibroblast growth factor Drugs 0.000 description 3
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 3
- 230000033001 locomotion Effects 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 3
- 210000001236 prokaryotic cell Anatomy 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 230000008733 trauma Effects 0.000 description 3
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 2
- 102000000503 Collagen Type II Human genes 0.000 description 2
- 108010041390 Collagen Type II Proteins 0.000 description 2
- 241000699802 Cricetulus griseus Species 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 208000007353 Hip Osteoarthritis Diseases 0.000 description 2
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 2
- 208000003456 Juvenile Arthritis Diseases 0.000 description 2
- 208000003947 Knee Osteoarthritis Diseases 0.000 description 2
- 108091008604 NGF receptors Proteins 0.000 description 2
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 2
- 102000007339 Nerve Growth Factor Receptors Human genes 0.000 description 2
- 206010073853 Osteochondral fracture Diseases 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- 102000010292 Peptide Elongation Factor 1 Human genes 0.000 description 2
- 108010077524 Peptide Elongation Factor 1 Proteins 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- 206010065159 Polychondritis Diseases 0.000 description 2
- 108091034057 RNA (poly(A)) Proteins 0.000 description 2
- 241000714474 Rous sarcoma virus Species 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 102000007562 Serum Albumin Human genes 0.000 description 2
- 108010071390 Serum Albumin Proteins 0.000 description 2
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 2
- 230000005856 abnormality Effects 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 230000001195 anabolic effect Effects 0.000 description 2
- 210000001264 anterior cruciate ligament Anatomy 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 2
- 230000008355 cartilage degradation Effects 0.000 description 2
- 230000022159 cartilage development Effects 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 208000019069 chronic childhood arthritis Diseases 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 210000002808 connective tissue Anatomy 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000007850 degeneration Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 230000008021 deposition Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- BRZYSWJRSDMWLG-CAXSIQPQSA-N geneticin Chemical compound O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](C(C)O)O2)N)[C@@H](N)C[C@H]1N BRZYSWJRSDMWLG-CAXSIQPQSA-N 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 238000005734 heterodimerization reaction Methods 0.000 description 2
- 210000001624 hip Anatomy 0.000 description 2
- 102000057772 human FGF17 Human genes 0.000 description 2
- 102000057238 human FGF8 Human genes 0.000 description 2
- 102000057240 human FGF9 Human genes 0.000 description 2
- 210000003035 hyaline cartilage Anatomy 0.000 description 2
- 229920002674 hyaluronan Polymers 0.000 description 2
- 229960003160 hyaluronic acid Drugs 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 229960002725 isoflurane Drugs 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 210000000281 joint capsule Anatomy 0.000 description 2
- 239000010410 layer Substances 0.000 description 2
- 230000005499 meniscus Effects 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 210000000963 osteoblast Anatomy 0.000 description 2
- 208000007656 osteochondritis dissecans Diseases 0.000 description 2
- 210000004417 patella Anatomy 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 238000011552 rat model Methods 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 239000002356 single layer Substances 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- DAEPDZWVDSPTHF-UHFFFAOYSA-M sodium pyruvate Chemical compound [Na+].CC(=O)C([O-])=O DAEPDZWVDSPTHF-UHFFFAOYSA-M 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 210000005065 subchondral bone plate Anatomy 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 210000001179 synovial fluid Anatomy 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 210000002435 tendon Anatomy 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- PRDFBSVERLRRMY-UHFFFAOYSA-N 2'-(4-ethoxyphenyl)-5-(4-methylpiperazin-1-yl)-2,5'-bibenzimidazole Chemical compound C1=CC(OCC)=CC=C1C1=NC2=CC=C(C=3NC4=CC(=CC=C4N=3)N3CCN(C)CC3)C=C2N1 PRDFBSVERLRRMY-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 1
- 208000006820 Arthralgia Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 208000010392 Bone Fractures Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 241000251730 Chondrichthyes Species 0.000 description 1
- 208000000094 Chronic Pain Diseases 0.000 description 1
- 102100027995 Collagenase 3 Human genes 0.000 description 1
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 1
- 206010011219 Costochondritis Diseases 0.000 description 1
- 244000124209 Crocus sativus Species 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 238000011199 Dunnett post hoc test Methods 0.000 description 1
- 102000016942 Elastin Human genes 0.000 description 1
- 108010014258 Elastin Proteins 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102100031734 Fibroblast growth factor 19 Human genes 0.000 description 1
- 102000003957 Fibroblast growth factor 9 Human genes 0.000 description 1
- 206010017076 Fracture Diseases 0.000 description 1
- 108091092584 GDNA Proteins 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000577887 Homo sapiens Collagenase 3 Proteins 0.000 description 1
- 101000846394 Homo sapiens Fibroblast growth factor 19 Proteins 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- 208000004575 Infectious Arthritis Diseases 0.000 description 1
- 208000012659 Joint disease Diseases 0.000 description 1
- 208000005137 Joint instability Diseases 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- MIJPAVRNWPDMOR-ZAFYKAAXSA-N L-ascorbic acid 2-phosphate Chemical compound OC[C@H](O)[C@H]1OC(=O)C(OP(O)(O)=O)=C1O MIJPAVRNWPDMOR-ZAFYKAAXSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 229930182816 L-glutamine Natural products 0.000 description 1
- 229930182821 L-proline Natural products 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 206010052904 Musculoskeletal stiffness Diseases 0.000 description 1
- 101150111783 NTRK1 gene Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 208000008558 Osteophyte Diseases 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102000016611 Proteoglycans Human genes 0.000 description 1
- 108010067787 Proteoglycans Proteins 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 238000011530 RNeasy Mini Kit Methods 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 208000026317 Tietze syndrome Diseases 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 241000947853 Vibrionales Species 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 238000005299 abrasion Methods 0.000 description 1
- 210000003423 ankle Anatomy 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 238000011882 arthroplasty Methods 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 239000004067 bulking agent Substances 0.000 description 1
- -1 but not limited to Substances 0.000 description 1
- 206010061592 cardiac fibrillation Diseases 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 210000000038 chest Anatomy 0.000 description 1
- 208000002849 chondrocalcinosis Diseases 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 1
- 230000009918 complex formation Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 238000002316 cosmetic surgery Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 235000015872 dietary supplement Nutrition 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 238000011143 downstream manufacturing Methods 0.000 description 1
- 238000005553 drilling Methods 0.000 description 1
- 230000000773 effect on pain Effects 0.000 description 1
- 210000001162 elastic cartilage Anatomy 0.000 description 1
- 229920002549 elastin Polymers 0.000 description 1
- 210000001513 elbow Anatomy 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000013265 extended release Methods 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000002600 fibrillogenic effect Effects 0.000 description 1
- 210000004744 fore-foot Anatomy 0.000 description 1
- 230000033581 fucosylation Effects 0.000 description 1
- 108091005608 glycosylated proteins Proteins 0.000 description 1
- 102000035122 glycosylated proteins Human genes 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- ZJYYHGLJYGJLLN-UHFFFAOYSA-N guanidinium thiocyanate Chemical compound SC#N.NC(N)=N ZJYYHGLJYGJLLN-UHFFFAOYSA-N 0.000 description 1
- 210000004247 hand Anatomy 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 210000000548 hind-foot Anatomy 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 210000004276 hyalin Anatomy 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000012212 insulator Substances 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 208000024765 knee pain Diseases 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000003141 lower extremity Anatomy 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 238000013291 male lister hooded rat Methods 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 108010068617 neonatal Fc receptor Proteins 0.000 description 1
- 229940053128 nerve growth factor Drugs 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 1
- 238000012148 non-surgical treatment Methods 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 229940126701 oral medication Drugs 0.000 description 1
- 230000011164 ossification Effects 0.000 description 1
- 230000003349 osteoarthritic effect Effects 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 230000037081 physical activity Effects 0.000 description 1
- 238000000554 physical therapy Methods 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000003334 potential effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 229960002429 proline Drugs 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000002278 reconstructive surgery Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 208000009169 relapsing polychondritis Diseases 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 229920002477 rna polymer Polymers 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 201000001223 septic arthritis Diseases 0.000 description 1
- 230000012488 skeletal system development Effects 0.000 description 1
- 229940054269 sodium pyruvate Drugs 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000008925 spontaneous activity Effects 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000011477 surgical intervention Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 210000004353 tibial menisci Anatomy 0.000 description 1
- 229950003937 tolonium Drugs 0.000 description 1
- HNONEKILPDHFOL-UHFFFAOYSA-M tolonium chloride Chemical compound [Cl-].C1=C(C)C(N)=CC2=[S+]C3=CC(N(C)C)=CC=C3N=C21 HNONEKILPDHFOL-UHFFFAOYSA-M 0.000 description 1
- 210000003437 trachea Anatomy 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 230000000472 traumatic effect Effects 0.000 description 1
- 230000008736 traumatic injury Effects 0.000 description 1
- 238000007492 two-way ANOVA Methods 0.000 description 1
- 210000000689 upper leg Anatomy 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000002747 voluntary effect Effects 0.000 description 1
- 239000013585 weight reducing agent Substances 0.000 description 1
- 210000000707 wrist Anatomy 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/50—Fibroblast growth factor [FGF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2875—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF/TNF superfamily, e.g. CD70, CD95L, CD153, CD154
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- the present invention relates to new fusion proteins comprising an FGF-18 moiety fused to an anti-NGF moiety.
- Said fusion proteins can be used for the treatment of a cartilage disorder such as osteoarthritis or cartilage injury.
- Cartilage is composed of chondrocytes (cells derived from mesenchymal cells) which are dispersed in the matrix (a firm, gel-like ground substance).
- the cartilaginous matrix is produced by these cells and comprises mainly Type II collagen fibres (except fibrocartilage which also contains type I collagen fibres), proteoglycans, and elastin fibres.
- Cartilage is found among other places in the joints, the rib cage, and the ear, the nose, in the throat, in the trachea and in the intervertebral disks.
- Articular cartilage for instance, is a hyaline cartilage, having viscoelastic properties, covering the articular surfaces of bones.
- the main purpose of articular cartilage is to provide smooth surfaces in order to ensure nearly frictionless movement of articulating bones.
- Cartilage disorders broadly refer to diseases characterized by degeneration/disintegration of cartilage and abnormalities in the connective tissues which are manifested by inflammation, pain, stiffness and limitation of motion of the affected body parts. These disorders can be due to a pathology or can be the result of trauma or injury. Mature cartilage has very limited ability to self-repair, notably because mature chondrocytes have little potential for proliferation because of the limited supply with nutrients due to the absence of blood vessels in cartilage. Replacement of damaged cartilage, in particular articular cartilage, caused either by injury or disease is a major challenge for physicians, and available surgical treatment procedures are considered unpredictable and effective for only a limited time in younger patients without osteoarthritic changes.
- fibrocartilage does not have the same biomechanical properties as hyaline articular cartilage and lacks often proper lateral integration into the surrounding cartilage. For this reason, the newly synthesized fibrocartilage may breakdown more easily (expected time frame: 5-10 years).
- OA osteoarthritis
- the remaining non-surgical treatment consists notably of physical therapy, lifestyle modification (e.g. body weight reduction), supportive devices, oral drugs (e.g. non-steroidal anti-inflammatory drugs) and injection of drugs (e.g. hyaluronic acid and corticoids), and food supplementation. All these treatments are unable to stop OA disease progression.
- surgery such as joint replacement or high tibial osteotomy for the knee joint, are the remaining options for the patients.
- Tibial or femoral osteotomies may reduce symptoms, help to maintain an active lifestyle, and delay the need for total joint replacement.
- Total joint replacement can provide relief for the symptom of advanced osteoarthritis, but generally requires a significant change in a patient's lifestyle and/or activity level.
- Anti-NGF compounds is a category of molecules being described in the context of pain linked to OA.
- tanezumab, fasinumab or yet fulranumab are being developed for treating pain in OA patients, and are all currently in phases II/III clinical trials for arthritis and/or chronic pain, based on promising results in phases I to III clinical trials (Sanga et al., 2013; Tiseo et al., 2014; Brown et al. 2012).
- Fibroblast Growth factor 18 is a member of the Fibroblast Growth Factor (FGF) family of proteins. It has been shown that FGF-18 is a proliferative agent for chondrocytes and osteoblasts (Ellsworth et al., 2002; Shimoaka et al., 2002). FGF-18 has been proposed for the treatment of cartilage disorder such as osteoarthritis and cartilage injury either alone (WO2008023063) or in combination with hyaluronic acid (WO2004032849). FGF-18 is currently investigated in clinical trials for the treatment of OA.
- FGF-18 Fibroblast Growth Factor
- FGF18 provides good results in articular cartilage repair, there is a need of further molecules able to decrease pain/improve function, while maintaining the efficacy for the treatment of cartilage disorder. Indeed, pain is not only very often associated with cartilage disorders but represents the leading symptom for clinical detection of these disorders.
- the fusion proteins can be used in the treatment of a cartilage disorder.
- Said cartilage disorder is for instance osteoarthritis or cartilage injury.
- the present invention further provides the preferred amino acid sequence of said fusion proteins.
- polynucleotide sequences encoding the fusion proteins of the present invention are also encompassed.
- vectors and cell lines comprising said polynucleotide sequences.
- Another embodiment of the present invention is a pharmaceutical composition
- a pharmaceutical composition comprising the fusion proteins according to the present invention with at least one excipient.
- the fusion proteins according to the present invention are for use in the treatment of a cartilage disorder, such as osteoarthritis or cartilage injury.
- FGF-18 moiety is intended to be a protein maintaining at least one biological activity of the human FGF-18 protein (i.e. Fibroblast Growth Factor 18).
- FGF-18 may be native, in its mature form, a recombinant form or a truncated form thereof.
- Biological activities of the human FGF-18 protein include notably the increase in chondrocyte or osteoblast proliferation (see WO9816644) or in cartilage formation (see WO2008023063).
- Native, or wild-type, human FGF-18 is a protein mostly produced during skeletal development and is involved in bone and cartilage formation (See Haque et al., 2007).
- Human FGF-18 was first designated zFGF-5 and is fully described in WO9816644.
- SEQ ID NO:1 corresponds to the amino acid sequence of the native human FGF-18, with a signal peptide consisting of amino acid residues 1(Met) to 27(Ala).
- the mature form of human FGF-18 corresponds to the amino acid sequence from residue 28(Glu) to residue 207(Ala) of SEQ ID NO: 1 (180 amino acids).
- FGF-18 moieties according to the invention includes also active fragments of FGF-18 such as, but not limited to, truncated version comprising or consisting of residues 28(Glu) to 196(Lys) of SEQ ID NO: 1 (said truncated form is reproduced as SEQ ID NO:2), or mutants of FGF-18 (for instance mutants having at least 80% sequence identity with SEQ ID NO:1 or with the mature form of SEQ ID NO:2). Should the FGF-18 moiety be an active fragment of FGF-18 (or a truncated form of FGF-18), said FGF-18 fragment (or said truncated form of FGF-18) preferably comprises at least 150 amino acid residues.
- active fragments of FGF-18 such as, but not limited to, truncated version comprising or consisting of residues 28(Glu) to 196(Lys) of SEQ ID NO: 1 (said truncated form is reproduced as SEQ ID NO:2), or mutants of FGF
- an FGF-18 moiety comprising SEQ ID NO:2 displays similar activities as the mature human FGF-18, e.g. it increases chondrocyte proliferation and cartilage deposition leading to repair and reconstruction for a variety of cartilaginous tissues (see WO2008023063).
- FGF-8 moiety is intended to be a protein maintaining at least one biological activity of the human FGF-8 protein (i.e. Fibroblast Growth Factor 8).
- FGF-8 may be native, in its mature form, a recombinant form, a truncated form or a mutant form thereof.
- the native form is represented in SEQ ID NO:121.
- FGF-9 moiety is intended to be a protein maintaining at least one biological activity of the human FGF-9 protein (i.e. Fibroblast Growth Factor 9).
- FGF-9 may be native, in its mature form, a recombinant form, a truncated form or a mutant form thereof. The native form is represented in SEQ ID NO:122.
- FGF9 was shown to attenuate cartilage degradation in a DMM mice model, to reduce MMP13 expression and promote type II collagen expression in OA cartilage (Zhou et al., 2016).
- FGF-17 moiety is intended to be a protein maintaining at least one biological activity of the human FGF-17 protein (i.e. Fibroblast Growth Factor 17).
- FGF-17 may be native, in its mature form, a recombinant form, a truncated form or a mutant form thereof.
- the native form is represented in SEQ ID NO:123.
- inhibitor of NGF or “anti-NGF moiety” as used herein refers to a compound that is able to bind to NGF (i.e. Nerve Growth Factor) and to inhibit the activity of said NGF, either partly or completely.
- NGF Nerve Growth Factor
- the preferred “inhibitors of NGF” according to this invention are anti-NGF antibodies, or active fragments or active variants thereof, as well as nanobodies.
- Such a compound is for instance, but not limited to, tanezumab (See SEQ ID NOs: 9-11) or active fragments or active variants thereof, fasinumab (See SEQ ID NOs: 12-13) or active fragments or active variants thereof, fulranumab (See SEQ ID NOs: 14-15) or active fragments or active variants thereof.
- ANA-02, ABT-110, ALD-906 or MEDI-578 are other examples of known NGF receptor inhibitors.
- antibody and its plural form “antibodies”, as used herein includes, inter alia, polyclonal antibodies, affinity-purified polyclonal antibodies, monoclonal antibodies, and antigen-binding fragments, such as F(ab′)2, Fab fragments, single chain variable region fragments (scFvs or shark VNAR), and single-domain antibodies (such as camelid VHH). It refers both to one-armed (monovalent; one pair of immunoglobulin chains) or two-armed (bivalent; two pairs of immunoglobulin chains) antibody. This term also includes the variants called knobs-into-holes based antibodies (Ridgway et al, 1996) and SEEDbodies (Davis et al.
- the basic structural unit of an antibody is a tetramer and consists of two identical pairs of immunoglobulin chains, each pair having one light and one heavy chain.
- a light chain has two parts: the variable domain (VL) and the constant domain (CL), which in the context of a light chain can be called constant region as well.
- a heavy chain has two parts as well: the variable domain (VH) and the constant region (CH).
- the light and heavy chain variable domains are together responsible for binding to an antigen, and the constant regions are responsible for the antibody effector functions.
- Full-length immunoglobulin “light chains” (usually about 25 kDa) are encoded by a variable domain gene at the N-terminus (usually about 110 amino acids) and a kappa or lambda constant domain (C K and C ⁇ , respectively) gene at the C-terminus.
- Full-length immunoglobulin “heavy chains” (usually about 50 kDa), are similarly encoded by a variable domain gene (usually about 116 amino acids) and one of the other constant region genes (usually about 330 amino acids) mentioned hereinafter.
- the type of heavy chain defines the antibody's isotype as IgA, IgD, IgE, IgG and IgM, respectively.
- the constant region is identical in all antibodies of the same isotype, but differs in antibodies of different isotypes.
- Heavy chains [gamma], [alpha] and [delta] have a constant region composed of three Ig constant domains (CH1, CH2, and CH3), and a hinge region for added flexibility; heavy chains [mu] and [epsilon] have a constant region composed of four Ig constant domains (CH1, CH2, CH3, and CH4) and a hinge region.
- a light or heavy chain variable domain consists of a “framework” region interrupted by three hypervariable regions. which are responsible for antigen binding.
- the hypervariable region comprises amino acid residues from a “complementarity determining region” or “CDR (Kabat et al. 1991) and/or those residues from a “hypervariable loop” (Chothia and Lesk 1987).
- CDR complementarity determining region
- FR residues are those variable domain residues other than the hypervariable region residues as herein defined. The sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
- a “human framework region” is a framework region that is substantially identical (about 85% or more, usually 90-95% or more) to the framework region of a naturally occurring human immunoglobulin.
- the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, serves to position and align the CDRs.
- the CDRs are primarily responsible for binding to an epitope of an antigen.
- Said antibodies (or immunoglobulins) can be chimeric, humanized, and fully human. They are most of the time recombinant (i.e. recombinant antibodies).
- recombinant antibodies means antibodies wherein the amino acid sequence has been varied from that of a native antibody. Because of the relevance of recombinant DNA techniques in the generation of antibodies, one need not be confined to the sequences of amino acids found in natural antibodies; antibodies can be redesigned to obtain desired characteristics. The possible variations are many and range from the changing of just one or a few amino acids to the complete redesign of, for example, the variable domain or constant region. Changes in the constant region will, in general, be made in order to improve, reduce or alter characteristics, such as complement fixation (e.g. complement dependent cytotoxicity, CDC), interaction with Fc receptors, and other effector functions (e.g. antibody dependent cellular cytotoxicity, ADCC), pharmacokinetic properties (e.g.
- complement fixation e.g. complement dependent cytotoxicity, CDC
- Fc receptors e.g. antibody dependent cellular cytotoxicity, ADCC
- ADCC antibody dependent cellular cytotoxicity
- immunoglobulins may exist in a variety of other forms including, for example, single-chain or Fv, Fab, and (Fab′)2, as well as diabodies, linear antibodies, multivalent or multispecific hybrid antibodies.
- fragment refers to an active fragment of an intact or a full-length chain antibody (here an anti-NGF antibody), usually the binding or variable region. Said portions, or fragments, should maintain at least one activity of the intact chain/antibody, i.e. they are “functional portions” or “functional fragments” or “active fragments”. Should they maintain at least one activity, they preferably maintain the target binding property.
- antibody portions include, but are not limited to, single-chain Fv, Fab, single-chain antibodies, Fv or scFv, VHH or vNAR.
- single-chain antibodies refer to antibody fragments that comprise the variable domains from both the heavy and light chains, but lack the constant regions, all within a single polypeptide chain.
- a single-chain antibody further comprises a polypeptide linker between the VH and VL domains which enables it to form the desired structure that would allow for antigen binding.
- single-chain antibodies can also be bi-specific and/or humanized.
- fragment also refers to a “Fab fragment», comprising one light chain and the variable and CH1 domains of one heavy chain.
- the heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule.
- a “Fab′ fragment” that contains one light chain and one heavy chain and contains more of the constant region, between the CH1 and CH2 domains, such that an interchain disulfide bond can be formed between two heavy chains is called a F(ab′)2 molecule.
- a “F(ab′)2” contains two light chains and two heavy chains containing a portion of the constant region between the CH1 and CH2 domains, such that an interchain disulfide bond is formed between two heavy chains.
- SEEDbody SEED for Strand-Exchange Engineered Domain; plural form: SEEDbodies
- SEEDbodies refers to a particular type of antibody comprising derivative of human IgG and IgA CH3 domains, creating complementary human SEED CH3 heterodimers that are composed of alternating segments of human IgG and IgA CH3 sequences (the resulting heterodimers are called AG part and GA part as shown in FIGS. 1 A- 1 L ). They are asymmetric fusion proteins.
- SEEDbodies and the SEED technology are described in Davis et al. 2010 or U.S. Pat. No. 8,871,912 which are incorporated herein in their entirety. They can be monovalent or bivalent.
- knock-into-holes based antibodies relates to a heavy chain heterodimerization technology as developed by Carter and co-workers in 1996 (Ridgway et al., 1996).
- the designated ‘knob’ variant of the CH3 domain contains a replacement of a small amino acid by a larger one (T366Y).
- the opposite CH3 domain, designed for heterodimerization and referred to as ‘hole’ variant contains a Y407T mutations i.e. a replacement of a large residue with a smaller one.
- treatment within the context of this invention refers to any beneficial effect on progression of disease, including attenuation, reduction and decrease or diminishing of the pathological development after onset of disease.
- the term “pharmaceutically acceptable” is meant to encompass any carrier, which does not interfere with the effectiveness of the biological activity of the active ingredient and that is not toxic to the host to which it is administered.
- the active protein(s) may be formulated in a unit dosage form for injection in vehicles such as, but not limited to, saline, dextrose solution, serum albumin and Ringer's solution.
- cartilage disorder encompasses disorders resulting from damages due to injury, such as traumatic injury, chondropathy or arthritis.
- cartilage disorders that may be treated by the administration of the fusion proteins described herein include but are not restricted to arthritis, such as osteoarthritis, and cartilage injury.
- Degenerative diseases/disorders of the cartilage or of the joint such as chondrocalcinosis, polychondritis, relapsing polychondritis, ankylosing spondylitis or costochondritis are also encompassed by this wording.
- the International Cartilage Repair Society has proposed an arthroscopic grading system to assess the severity of the cartilage defect: grade 0: (normal) healthy cartilage, grade 1: the cartilage has a soft spot or blisters, grade 2: minor tears visible in the cartilage, grade 3: lesions have deep crevices (more than 50% of cartilage layer) and grade 4: the cartilage tear exposes the underlying (subchondral) bone.
- grade 0 normal healthy cartilage
- grade 1 the cartilage has a soft spot or blisters
- grade 2 minor tears visible in the cartilage
- grade 3 lesions have deep crevices (more than 50% of cartilage layer)
- grade 4 the cartilage tear exposes the underlying (subchondral) bone.
- osteoarthritis encompasses disorders such as osteoarthritis, rheumatoid arthritis, juvenile rheumatoid arthritis, infectious arthritis, psoriatic arthritis, Still's disease (onset of juvenile rheumatoid arthritis) or osteochondritis dissecan. It preferably includes diseases or disorders in which ones the cartilage is damaged.
- Osteoarthritis is used to intend the most common form of arthritis.
- the term “osteoarthritis” encompasses both primary osteoarthritis and secondary osteoarthritis (see for instance The Merck Manual, 17 th edition, page 449).
- Osteoarthritis may be caused by the breakdown of cartilage. Bits of cartilage may break off and cause pain and swelling in the joint between bones. Over time, the cartilage may wear away entirely, and the bones will rub together. Osteoarthritis can affect any joint but usually concerns hands, shoulders and weight-bearing joints such as hips, knees, feet, and spine. In a preferred example, the osteoarthritis may be knee osteoarthritis or hip osteoarthritis.
- osteoarthritis This wording encompasses notably the forms of osteoarthritis which are classified as stage 1 to stage 4 or grade 1 to grade 6 according to the OARSI classification system.
- the skilled person is fully aware of osteoarthritis classifications that are used in the art, in particular said OARSI assessment system (also named OOCHAS; see for instance Custers et al., 2007).
- Osteoarthritis is one of the preferred cartilage disorders that can be treated by administering the fusion proteins according to the present invention.
- cartilage injury is a cartilage disorder or cartilage damage resulting notably from a trauma. Cartilage injuries can occur notably after traumatic mechanical destruction, notably further to an accident or surgery (for instance microfracture surgery). This term “cartilage injury” also includes chondral or osteochondral fracture and damage to meniscus. Also considered within this definition is sport-related injury or sport-related wear of tissues of the joint. The term also includes microdamage or blunt trauma, a chondral fracture, an osteochondral fracture or damage to meniscus.
- subject or “patient” is intended to include (but not limited to) mammals such as humans, dogs, cows, horses, sheep, goats, cats, mice, rabbits, or rats. More preferably, the subject (or the patient) is a human.
- the fusion proteins according to the present invention maintain the activities of both FGF-18 on cartilage and NGF inhibitor on pain. Indeed, it was found, in vitro, that in overall 1) the effects of an FGF-18 moiety are preserved by the fusion to an inhibitor of NGF and 2) that an FGF-18 moiety does not affect the neutralization effect of the anti-NGF moiety. This finding was not expected because of the high molecular weight of each moiety of the fusion protein and because it is well known that fusion proteins may not exhibit the expected activities due to different refolding for instance. Also surprising, said activities are maintained, even at low dosage for each compound. In a disease setting, the advantage of the present invention will be to decrease pain/improve function, while maintaining the efficacy of FGF-18 moiety on cartilage structure.
- the present invention provides new fusion proteins comprising FGF-18 moiety fused to an anti-NGF moiety (i.e. an inhibitor of NGF, preferably an anti-NGF antibody or fragment thereof).
- an anti-NGF moiety i.e. an inhibitor of NGF, preferably an anti-NGF antibody or fragment thereof.
- the fusion protein comprises a linker between the two moieties.
- the FGF-18 moiety according to the invention as a whole can be the native form of FGF-18 as shown in SEQ ID NO:1 or its mature form (corresponding to the amino acid residue 28 to residue 207 of SEQ ID NO: 1).
- it can be a truncated form, preferably comprising at least 150 amino acid residues, such as the truncated form shown in SEQ ID NO:2 (SEQ ID NO: 2 is a mature form of a truncated FGF-18 without any leader sequence).
- Said truncated form when expressed with an additional methionine residue in its N-terminal moiety is known as sprifermin.
- truncated forms preferably comprising at least 150 amino acid residues, can also be used such as a form comprising or consisting of amino acid 1(Glu) to 167(Thr) of SEQ ID NO: 2, a form comprising or consisting of amino acid 1(Glu) to 161 (Pro) of SEQ ID NO: 2 (as represented in SEQ ID NO:3) or such as any forms having deletions of one to fifteen amino acid residues in the N-term and/or C-term moiety compared to SEQ ID NO: 2 and/or having some mutations (e.g. to diminish protease activity).
- Such truncated and/or mutated forms can be used as long as they keep the full biological activities of a native FGF-18 or of sprifermin.
- the FGF18 moiety can be an active variant having at least 80% of sequence identity with amino acid residue 28 to residue 207 of SEQ ID NO: 1 or with SEQ ID NO:2.
- said FGF18 variant has at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% of sequence identity with amino acid residue 28 to residue 207 of SEQ ID NO: 1 or with SEQ ID NO:2.
- Said (active) variants may be the result of punctual mutation(s) or of a fusion of an FGF18 moiety with a partial sequence coming from another FGF moiety, such as from an FGF8, FGF9 or FGF19 moiety. Examples of such variants are shown in SEQ ID NOs: 83-86.
- the anti-NGF moiety of the present invention has to bind and neutralize NGF.
- said anti-NGF moiety is based on an anti-NGF antibody, and is preferably an active fragment or an active variant thereof.
- the anti-NGF antibody that can be used according to the present invention is for instance tanezumab, fasinumab or fulranumab, but not limited to these antibodies.
- these anti-NGF moieties are either active fragments of anti-NGF antibodies, such as scFv, Fab active fragments, VHH or vNAR or are active variants of said anti-NGF antibodies, such as SEEDbodies or knobs-into-holes based antibodies.
- the (active) fragments of anti-NGF antibodies can be selected from the group consisting of amino acid sequences: SEQ ID NO: 22 (scFv of tanezumab), SEQ ID NO: 23 (scFv of fasinumab), SEQ ID NO: 24 (scFv of fulranumab), SEQ ID NO: 16 (VH-Fab of tanezumab), SEQ ID NO: 18 (VH-Fab of fasinumab), SEQ ID NO: 20 (VH-Fab of fulranumab), SEQ ID NO: 17 (VL-Fab of tanezumab), SEQ ID NO: 19 (VL-Fab of fasinumab) and SEQ ID NO: 21 (VL-Fab of fulranumab).
- the anti-NGF antibodies according to the invention, or portions thereof, that binds to NGF comprise a heavy chain variable domain comprising HCDR1, H-CDR2 and H-CDR3, and a light chain variable domain comprising L-CDR1, L-CDR2 and L-CDR3, wherein, 1) H-CDR1 comprises or consists of an amino acid sequence consisting of SEQ ID NO: 135, 2) H-CDR2 comprises or consists of an amino acid sequence consisting of SEQ ID NO: 136, 3) H-CDR3 comprises or consists of an amino acid sequence consisting of SEQ ID NO: 137, 4) L-CDR1 comprises or consists of an amino acid sequence consisting of SEQ ID NO: 138, 5) L-CDR2 comprises or consists of an amino acid sequence consisting of SEQ ID NO: 139 and 6) L-CDR3 comprises or consists of an amino acid sequence consisting of SEQ ID NO: 140.
- the FGF-18 moiety of the present invention can be linked, directly or via a linker, via its N-terminus or its C-terminus to the anti-NGF moiety (see FIGS. 1 A- 1 L ).
- Example of linkers that can be used indifferently in any of the constructs are represented in SEQ ID NOs: 118-120 or 127-131. The skilled person would understand that in any of the sequence identifier numbers for fusion proteins according to the present invention, he can change the linker by any other one of his choice.
- fusion protein according to the invention is an FGF-18 moiety fused to an scFv moiety
- this linkage can be done via the free VH-end or the free VL-end of the anti-NGF scFv moiety.
- fusion proteins for instance comprise 1) an amino acid sequence selected from the group comprising or consisting of any one of SEQ ID NOs: 1 to 8 as FGF-18 moiety, and 2) an amino acid sequence selected from the group comprising or consisting of any one of SEQ ID NOs: 22 to 24 as the anti-NGF moiety, and optionally 3) a linker between the FGF-18 moiety and the anti-NGF moiety.
- specific fusion proteins are for instance selected form the group consisting of (but not limited to) amino acid sequences: SEQ ID NOs: 25-27.
- the construct (or the fusion protein) according to the invention is based on a Fab as the anti-NGF moiety, it will comprise both a VH-Fab domain and a VL-Fab domain, the FGF-18 being fused to any one of the VH-Fab domain and/or the VL-Fab domain, via the C-terminus and/or the N-terminus of said Fab moiety.
- fusion proteins for instance comprise 1) an amino acid sequence selected from the group comprising or consisting of any one of SEQ ID NOs: 1 to 8 or 83-87 as FGF-18 moiety, and 2) an amino acid sequence selected from the group comprising or consisting of any one of SEQ ID NOs: 16 to 21 as the anti-NGF moiety, and optionally 3) a linker, which can be selected amongst the group comprising or consisting of any one of SEQ ID NOs: 118-120 or 127-131, between the FGF-18 moiety and the anti-NGF moiety.
- specific fusion proteins are for instance selected form the group consisting of (but not limited to) amino acid sequences: SEQ ID NOs: 28 to 53.
- the fusion protein will also comprise a regular VL-Fab.
- VL-Fab examples of such molecule are for instance, but not limited to, a combination of SEQ ID NO: 37 and SEQ ID NO: 17, SEQ ID NO: 40 and SEQ ID NO: 17 or SEQ ID NO: 46 and SEQ ID NO: 17.
- the fusion protein will also comprise a regular VH-Fab.
- Fab molecule comprises both a VH-Fab domain and a VL-Fab domain
- said molecule can comprise i) the VH-Fab domain comprises an amino acid sequence selected from the group comprising or consisting of any one of SEQ ID NOs: 1 to 8 or 83-87 fused to an amino acid sequence selected from the group comprising or consisting of any one of SEQ ID NOs: 16, 18 or 20, optionally with a linker between the two amino acid sequence moieties; and the VL-Fab domain comprises to an amino acid sequence selected from the group comprising or consisting of any one of SEQ ID NOs: 17, 19 or 21, ii) the VL-Fab domain comprises an amino acid sequence selected from the group comprising or consisting of any one of SEQ ID NOs: 1 to 8 or 83-87 fused to an amino acid sequence selected from the group comprising or consisting of any one of SEQ ID NOs: 17, 19 or 21, optionally with a linker between the two amino acid sequence moieties; and the VH-Fab domain comprises to an amino acid sequence
- Examples of such molecule are for instance, but not limited to, a combination of 1) SEQ ID NO: 28 and SEQ ID NO: 16, 2) SEQ ID NO: 31 and SEQ ID NO: 16, 3) SEQ ID NO: 40 and SEQ ID NO: 16, 4) SEQ ID NO: 41 and SEQ ID NO: 16 or 4) SEQ ID NO: 42 and SEQ ID NO: 16 (HOF3).
- the fusion protein according to the invention is an FGF-18 moiety fused to a SEEDbody form of an anti-NGF antibody
- a monovalent form of the SEEDbody will preferably be used (i.e. they will usually not form a homodimer comprising two full heavy chains and two light chains).
- a SEEDbody (as a monomer) consists of one full light chain comprising both variable and constant domains (such as the ones disclosed as SEQ ID NO:11, 13 or 15), one full heavy chain comprising both variable and constant domains (such as the ones disclosed as SEQ ID NOs: 56, 58, 60, 65, 71 or 96) as well as one partial heavy chain comprising only constant domains CH2 and CH3 of a SEEDbody (such as the ones disclosed as amino acid residues 185 to 414 of SEQ ID NO: 54, amino acid residues 180 to 409 of SEQ ID NO: 55, amino acid residues 180 to 409 of 57 or yet amino acid residues 180 to 409 of SEQ ID NO: 59, SEQ ID NO: 102 or SEQ ID NO: 107).
- the partial heavy chain is asymmetric to its counterpart on the full heavy chain (e.g. should the full heavy chain be a GA form, the partial heavy chain will be an AG form and vice versa).
- the FGF-18 moiety will be linked to the SEEDbody via the partial heavy chain (see FIG. 1 B or 1 D )), its full heavy chain or the light chain (see FIG. 1 C ), either in C-terminus or in N-terminus.
- Non-limiting examples of such FGF-18 moiety fused to an AG form are for instance selected form the group consisting of amino acid sequences SEQ ID NOs: 54, 55, 57, 59, 62, 66-70, 77-82, 91-95, 101 or 103-106.
- Non-limiting examples of such FGF-18 moiety fused to a GA form are for instance selected form the group consisting of amino acid sequences SEQ ID NOs: 72-76, 90, 97-100 or 108.
- Non-limiting examples of such FGF-18-SEEDbodies are for instance selected form the group consisting of amino acid sequences (each SEEDbody is formed by three sequences, here respectively FGF-18-partial heavy chain; full heavy chain and light chain): 1) SEQ ID NOs: 54, 56 and 11 (MBE626), 2) SEQ ID NOs: 55, 56 and 11, 3) SEQ ID NOs: 57, 58 and 13, 4) SEQ ID NOs: 59, 60 and 15, 5) SEQ ID NOs: 90, 71 and 11 (HO124), 6) SEQ ID NOs: 97, 96 and 11 (HO110), or 7) SEQ ID NOs: 100, 96 and 11 (HO113).
- FGF-18 moiety fused to the light chain are for instance selected form the group consisting of amino acid sequences: 40-44 or 124-126.
- Non-limiting examples of such FGF-18-SEEDbodies are for instance selected form the group consisting of amino acid sequences (each SEEDbody is formed by three sequences, here respectively full heavy chain; partial heavy chain and FGF-18-light chain): 1) SEQ ID NOs: 71, 102 and 126 (HO114), 2) SEQ ID NOs: 96, 102 and any one of 40-44 or 124-126, 3) 56, 107 and 40 or 124, 4) 58, 107 and 40 or 124 or 5) 60, 107 and 40 or 124.
- FGF-18 moiety when the fusion protein according to the invention is an FGF-18 moiety fused to an active IgG variant form of an anti-NGF antibody, FGF-18 moiety will be linked to the active IgG variant via its heavy chain or its light chain, either in C-terminus or in N-terminus.
- FGF-18-IgG fusions are for instance selected form the group consisting of amino acid sequences (each fusion protein is formed by two sequences, i.e.
- SEQ ID NOs: 9 or 10 and 61 1) SEQ ID NOs: 9 or 10 and 61, 2) SEQ ID NOs: 62 and 11, 3) SEQ ID NOs: 63 and 9 or 10, 4) SEQ ID NOs: 64 and 11, 5) SEQ ID NOs: 88 or 89 and 11, 6) SEQ ID NOs: 9 or 10 and 124 or 7) 5) SEQ ID NOs: 9 or 10 and 125.
- the fusion proteins according to the present invention as a whole can be expressed with a molecule leader in the N-term.
- amino acid sequences having at least 80% or more, at least 85% or more, at least 90% or more, at least 95% or more, or at least 99% or more sequence identity to the heavy chain variable region sequences or to full or partial heavy chain amino acid sequences disclosed herein are also provided.
- amino acid sequences having at least 85% or more, at least 90% or more, at least 95% or more, or at least 99% or more sequence identity to the light chain variable region sequences disclosed herein are also provided.
- nucleic acid molecule or a polynucleotide, encoding any of the fusion proteins herein described, or a complementary strand or degenerated sequence thereof.
- nucleic acid molecule or interchangeably “polynucleotide” encompass all different types of nucleic acids, including without limitation deoxyribonucleic acids (e.g., DNA, cDNA, gDNA, synthetic DNA, etc.), ribonucleic acids (e.g., RNA) and peptide nucleic acids (PNA).
- the nucleic acid molecule is a DNA molecule, such as a double-stranded DNA molecule or a cDNA molecule.
- isolated means nucleic acid molecules that have been identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the natural source.
- An isolated nucleic acid molecule is other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from the specific nucleic acid molecule as it exists in natural cells.
- a degenerate sequence designates any nucleotide sequence encoding the same amino acid sequence as a reference nucleotide sequence, but comprising a distinct nucleotide sequence as a result of the genetic code degeneracy.
- the fusion protein according to the invention is an FGF-18 moiety linked to an active scFv fragment of an active anti-NGF moiety
- said fusion protein is encoded as a single molecule, i.e. the nucleotide sequence comprises the nucleotides needed to encode the two moieties as a whole.
- the fusion protein according to the invention is an FGF-18 moiety linked to a Fab moiety or an active IgG variant
- one polynucleotide encodes the heavy chain of any one of the fusion proteins of the invention
- another polynucleotide encodes the light chain of any one of the fusion proteins of the invention.
- its encoding sequence will be attached to the encoding sequence of either the heavy chain or the light chain, in its N-term or in its C-terminus.
- the fusion protein according to the invention is an FGF-18 moiety linked to a SEEDbody
- one polynucleotide encodes the full heavy chain of any one of the fusion proteins of the invention
- another polynucleotide encodes the partial heavy chain fused to the FGF-18 moiety of any one of the fusion proteins of the invention
- another one encodes the light chain of any one of the fusion proteins of the invention.
- the polynucleotide sequences encoding said proteins are usually preceded by a leader sequence.
- Non-limiting examples of the polynucleotide sequences that can be used according to the inventions are for instance those of SEQ ID NOs: 109-117 and 132.
- polynucleotides encoding the fusion proteins according to the present invention can be optimized. Therefore, polynucleotide sequences having at least 90% or more, at least 95% or more, or at least 99% or more sequence identity to the polynucleotide sequences encoding the heavy chain variable region sequences disclosed herein, such as the preferred polynucleotide sequences listed above, are also provided.
- polynucleotide sequences having at least 90% or more, at least 95% or more, or at least 99% or more sequence identity to the polynucleotide sequences encoding the light chain variable region sequences disclosed herein, such as the preferred polynucleotide sequences listed above, are also provided.
- a further embodiment of this invention is a vector comprising a DNA encoding any of the fusion proteins described herein.
- the vector may be any cloning or expression vector, integrative or autonomously replicating, functional in any prokaryotic or eukaryotic cell.
- the vector may be a plasmid, cosmid, virus, phage, episome, artificial chromosome, and the like.
- the vector may comprise the entire or part of the coding sequences for both the heavy and light chain, or either of the light and heavy chain coding sequences, or any portions thereof.
- these coding sequences may each be operably linked to a promoter.
- the promoter may be the same or different for the heavy and light chain coding sequences.
- the heavy and light chain coding sequences may also be operably linked to one single promoter, in this case the coding sequences for the heavy and light chains may preferably be separated by an internal ribosomal entry site (IRES) or via viral 2A peptides.
- IRS internal ribosomal entry site
- Suitable promoters for eukaryotic gene expression are, for example, promoters derived from viral genes such as the murine or human cytomegalovirus (CMV), the mouse bi-directional CMV promoter, the rous sarcoma virus (RSV) promoter or the human elongation factor-1 alpha (EF-1 ⁇ ) promoter, which are well known to the person skilled in the art.
- the vector may comprise regulatory elements, such as a promoter, terminator, enhancer, selection marker, origin of replication, insulator etc.
- the appropriate nucleic acid sequence may be inserted into the vector by a variety of procedures. In general, DNA is inserted into an appropriate restriction endonuclease site(s) using techniques known in the art. Construction of suitable vectors containing one or more of these components employs standard ligation techniques which are known to the skilled artisan.
- a further embodiment of the present invention is a recombinant host cell, wherein said cell comprises one or more nucleic acid molecule(s)/polynucleotide(s) or one or more vector(s) as defined above.
- the host cell may be a prokaryotic or eukaryotic cell.
- prokaryotic cells include bacteria, such as E. coli .
- eukaryotic cells are yeast cells, plant cells, mammalian cells and insect cells including any primary cell culture or established cell line (e.g., 3T3, Vero, HEK293, TN5, etc.).
- Suitable host cells for the expression of glycosylated proteins are derived from multicellular organisms.
- CHO e.g. CHO—S, ExpiCHOTM, CHO-k1 or CHO-LF
- HEK293 e.g. 293, 293-6E or Expi293TM
- NS0 e.g. SP2/0 and COS cells.
- the fusion proteins of the present invention may be produced by any technique known in the art, such as by recombinant technologies, chemical synthesis, cloning, ligations, or combinations thereof. Many books and reviews provide teachings on how to clone and produce recombinant proteins using vectors and prokaryotic or eukaryotic host cells.
- a yeast expression system or engineered/glycoengineered CHO cell lines can be advantageously used.
- an engineered/glycoengineered yeast expression system or engineered/glycoengineered CHO cell lines can be advantageously used.
- Another embodiment of this invention is therefore a method of producing a fusion protein of the present invention, the method comprising culturing a recombinant host cell of the invention under conditions allowing expression of the nucleic acid molecule(s) encoding any of the fusion proteins described herein or portions thereof, and recovering/isolating the fusion protein(s) produced.
- the fusion protein(s) as produced may be glycosylated or not, may be fucosylated or not or may contain other post-translational modifications depending on the host cell type used.
- the method of producing a fusion protein of the present invention may further comprise the steps of purifying the fusion proteins, and/or formulating said fusion proteins, into a pharmaceutical composition.
- RNA can be prepared using guanidinium isothiocyanate extraction followed by isolation by centrifugation in a CsCl gradient (Chirgwin et al. 1979).
- Poly(A)+ RNA is prepared from total RNA using the method of Aviv and Leder (Aviv and Leder 1972).
- Complementary DNA (cDNA) is prepared from poly(A)+ RNA using known methods.
- genomic DNA can be isolated.
- Polynucleotides encoding the fusion proteins are then identified and isolated by, for example, hybridization or PCR.
- the fusion proteins are part of pharmaceutical formulations.
- the fusion proteins of the invention may be formulated as pharmaceutical composition, i.e. together with at least one pharmaceutically acceptable carrier, excipient(s) or the like.
- pharmaceutically acceptable is meant to encompass any carrier, excipient or the like, which does not interfere with effectiveness of the biological activity of the active ingredient and that is not toxic to the patient to which it is administered.
- the at least one excipient is for instance selected from the group consisting of a buffer, a surfactant, a salt, an antioxidant, a isotonicity agent, a bulking agent, a stabilizer or any combination thereof.
- the fusion protein(s) may be formulated in a unit dosage form for injection in vehicles such as saline, dextrose solution, serum albumin and Ringer's solution or any kind of known buffers.
- vehicles such as saline, dextrose solution, serum albumin and Ringer's solution or any kind of known buffers.
- Formulations for intraarticular application will comply with most of the requirements that also apply to other injection formulations, i.e., they need to be sterile and compatible with the physiological conditions at the application site (e.g., knee joint, synovial fluid).
- the excipients used for intraarticular injection may also be present in other injection formulations, e.g., for intravenous or subcutaneous application.
- Such formulations of fusion proteins, including at least one further pharmaceutically acceptable carrier, excipients or the like, are also useful in the context of the present invention.
- the fusion proteins are used for treating cartilage disorders, such as osteoarthritis or cartilage injury.
- cartilage disorders such as osteoarthritis or cartilage injury.
- they can be used for treating articular cartilage defects in synovial joints that are, for instance, due to superficial fibrillation (early osteoarthritis), cartilage degeneration due to osteoarthritis, and chondral or osteochondral defects due to injury or disease.
- the fusion proteins may also be used for treating joint disease caused by osteochondritis dissecans and degenerative joint diseases.
- the fusion proteins will be useful for autogenous or allogenic cartilage expansion and transfer for reconstruction of extensive tissue defects.
- the fusion proteins according to the invention can be used to repair cartilage damage in conjunction with lavage of the joint, stimulation of bone marrow, abrasion arthroplasty, subchondral drilling, or microfracture of the subchondral bone.
- the cartilage disorder to be treated according to the invention is osteoarthritis, such as knee osteoarthritis or hip osteoarthritis.
- the osteoarthritis to be treated can be, for example, and not limited to, primary osteoarthritis or secondary osteoarthritis, as well as osteoarthritis which is classified as stage 1 to stage 4 or grade 1 to grade 6 according to the OARSI classification system.
- the cartilage disorder to be treated according to the invention is cartilage injury with or without surgical interventions as microfractures. Additionally, after the growth of cartilage due to the administration of the fusion proteins according to the invention, a surgical treatment may be necessary to suitably contour the newly formed cartilage surface.
- the treatment comprises peri-synovial administration, intra-synovial administration, peri-articular administration or intra-articular administration of the fusion proteins according to the invention.
- Said fusion proteins can be applied by direct injection into the synovial fluid of the joint or directly into the defect, either alone or complexed with a suitable carrier for extended release of protein (e.g. sustained-release formulations) or restricted local release.
- the intraarticular administration is done in a joint selected from joint of the hip, knee, elbow, wrist, ankle, spine, feet, finger, toe, hand, shoulder, ribs, shoulder blades, thighs, shins, heels and along the bony points of the spine.
- the intraarticular administration is done in the joint of the hip or the knee.
- FIGS. 1 A- 1 L Structure of an FGF-18 moiety linked to a scFv moiety via the free VL part of said ScFv moiety.
- FIG. 1 B Structure of an FGF-18 moiety linked to a SEEDbody moiety via the N-term of the partial heavy chain of said SEEDbody, herein a AG part.
- FIG. 1 C Structure of an FGF-18 moiety linked to a SEEDbody moiety via the C-term of the light chain of said SEEDbody.
- FIG. 1 D Structure of an FGF-18 moiety linked to a SEEDbody moiety via the C-term of the partial heavy chain of said SEEDbody, herein a AG part.
- FIG. 1 A Structure of an FGF-18 moiety linked to a scFv moiety via the free VL part of said ScFv moiety.
- FIG. 1 B Structure of an FGF-18 moiety linked to a SEEDbody moiety via the N-term of the partial heavy chain of said SEEDbody, herein a AG
- FIG. 1 E Structure of an FGF-18 moiety linked to a Fab moiety via the N-terminus of the light chain fusion
- FIG. 1 F Structure of an FGF-18 moiety linked to a Fab moiety via the N-terminus heavy chain fusion.
- FIG. 1 G Structure of an FGF-18 moiety linked to a Fab moiety via the C-terminus light chain fusion.
- FIG. 1 H Structure of an FGF-18 moiety linked to a Fab moiety via the C-terminus heavy chain fusion
- FIG. 1 I Structure of an FGF-18 moiety linked to an IgG-moiety via the N-terminus light chain fusion
- FIG. 1 J Structure of an FGF-18 moiety linked to an IgG-moiety via the N-terminus heavy chain fusion.
- FIG. 1 K Structure of an FGF-18 moiety linked to an IgG-moiety via the C-terminus light chain fusion.
- FIG. 1 L Structure of an FGF-18 moiety linked to an IgG-moiety via the C-terminus heavy chain fusion.
- FIGS. 2 A- 2 B FIG. 2 A ) Cell proliferation and type I collagen expression in porcine chondrocytes in monolayer cultured seven days with rhFGF18, the construct FGF18 scFv Tanezumab or MBE626.
- FIG. 2 B cell morphology (actin staining) of porcine chondrocytes in monolayer cultured five days with rhFGF18, the construct FGF18 scFv Tanezumab or MBE626 at 50.04 nM.
- FIGS. 3 A- 3 B FIG. 3 A ) Design of the in vivo study to analyse gait disturbance in the MIA rat model. Intraarticular injections were made at day 1 after induction of osteoarthritis pain by 3 mg/joint MIA. Tanezumab was injected i.v. at the same time. Gait disturbance has been analysed by catwalk analysis.
- FIG. 3 B Dose dependent symptomatic benefit by FGF18-scFv-tanezumab during MIA induced osteoarthritis pain. Shown is the time course of the average of the % of contralateral hind paw print ⁇ SEM of 7-8 rats/group ⁇ SEM.
- FIGS. 4 A- 4 C show of the in vivo study to analyze gait disturbance in the ACLT tMx rat model of chronic osteoarthritis.
- FIG. 4 B Gait disturbance over time. 100% gait quality corresponds to equal weight bearing at both hind paws.
- FIGS. 5 A- 5 B FIG. 5 A
- FIG. 7 Cartilage structure determined by histology scoring. Shown is the mean ⁇ SEM of 18 animals/group.
- SEQ ID NO: 1 Amino acid sequence of the native human FGF-18 MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLG RRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTA LMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
- SEQ ID NO: 2 Amino acid sequence of a recombinant truncated FGF-18 (trFGF-18) EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQ VRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNY
- the FGF18 moiety used as a control was sprifermin. It corresponds to a polypeptide having an amino acid sequence according to SEQ ID NO:2 with an additional Met residue at the N-terminus (as it is expressed in E. coli ).
- the anti-NGF moiety used as a control was tanezumab.
- the proteins were expressed using transient transfection of ExpiCHOTM cells with ExpiFectamineTM Reagent, at 1-liter scale.
- the cell count was between 7.0 ⁇ 10 6 vc/ml and 10.0 ⁇ 10 6 vc/ml at the day of transfection and the viability was higher than 95%.
- the culture was diluted to 6 ⁇ 10 6 vc/ml in 750 ml.
- ExpiCHOTM Expression medium was used as transfection medium.
- ExpiFectamineTM was diluted within 28 ml OptiProTM and gently mixed.
- the DNA molecules encoding the protein(s) of interest (encoding any one of the proteins having an amino acid sequence selected from the group consisting of SEQ ID NOs: 1-82) were added to 30 ml OptiProTM and gently mixed.
- ExpiFectamineTM and DNA solution was mixed and the complex immediately added to the cells. No complex formation time was necessary. Cells were incubated at 36.5° C. and 5% CO 2 . 20 hours post transfection the cultures were supplemented with 4.5 ⁇ l enhancer and 180 ml feed.
- BaF3/FGFR3 cell assay BaF3 cells expressing FGFR3 and growing only upon FGFR3 activation. Metabolic activity is measured via ATP (with ATP lite) and is proportional to the cell number. BaF3/FGFR3 cells were cultured and passaged in RPMI 1640 medium with 2 mM L-Glutamine, 1 mM Sodium Pyruvate, Penicillin/Streptomycin 1 ⁇ , 0.6 mg/mL G-418, 50 nM beta-mercaptoethanol and 50 ng/mL IL3.
- U2OS TrkA-P75 assay U2OS cells expressing TrkA and p75 (NGF receptors) were used. In presence of NGF the receptors dimerize and emit luminescence.
- U2OS TrkA-p75 cells (Discoverx, Cat. No. 93-0529C3) were cultured in McCoy medium with geneticin 0.2 mg/ml, hygromycin 0.1 mg/mL and FCS 10%.
- 50 000 cells/well were inoculated in a white 96 well plate in 90 ⁇ L of assay medium (MEM ⁇ with HEPES 10 mM, Penicillin/Streptomycin 0.5 ⁇ , FCS 2%) and cultured overnight at 37° C.
- NGF 600 ng/mL was then mixed 1:1 v/v with increasing concentrations of the test compound (20 ⁇ of the final desired concentration in the wells) and incubated 1 h at room temperature. 10 ⁇ L of the NGF/test compound mixture was then added to the cells for 3 h at room temperature. Receptor activation was measured with the Pathhunter Bioassay detection kit (Discoverx, Cat. No. 93-0933E) according to the recommendation of the manufacturer. Tanezumab was tested as a control at 0.457, 1.37, 4.12, 12.36, 37, 111.1, 333.3, and 1 000 ng/mL (corresponding to 0.003 to 6.86 nM). The FGF18_anti-NGF constructs were tested at the same equimolar concentrations. Resulting IC50s were calculated with the PadPrism Software v7.0.
- Porcine chondrocytes were isolated from the cartilage of a femoral head of a pig hip. Cells were first inoculated at 20 000 cells/cm 2 and cultivated for one week in DMEMHG with 10% FCS, 50 ⁇ g/mL ascorbate-2-phosphate and 0.4 mM L-Proline.
- chondrocytes were inoculated in a 24-well plate at 15 000 cells/well in one mL of the same medium as is or supplemented with different concentrations rhFGF18 or the FGF18_anti-NGF constructs (equimolar to rhFGF18). Cells were cultured for seven days. At the end of the culture, cells were either counted with a ViCellTM Cell analyzer (from Beckman Coulter) or lysed for RNA isolation and gene expression. RNA was isolated with the RNeasy minikit (Qiagen, Cat. No. 74104) according to the recommendation of the manufacturer.
- RNA concentration and quality was then analysed by an Agilent Bioanalyser with a Agilent RNA 6000 Nano Chip (Agilent, Cat. No. G2938-80023).
- the reverse transcription was realized with the SuperScript III First-Strand Synthesis SuperMix.
- the cDNA was then digested by RNAse H to digest RNA and analysed by qPCR with the SYBRGreen Jumpstart Taq Ready Mix in presence of the reverse and forward primer for type I collagen at 200 nM each (Forward (SEQ ID NO: 133): 5′-AAAGGATCTCCTGGTGAAGC-3′ and Reverse (SEQ ID NO: 134): 5′-CCTGAGTGGAAGAGTGGAGA-3′).
- the reaction was performed in the thermocycler Mx3000P from Agilent technologies.
- chondrocytes were inoculated in a 96-well plate at 1 000 cells/well in 200 ⁇ L of the same medium as is or supplemented with different concentrations of rhFGF18 (10, 100 and 1 000 ng/mL) or the FGF18_anti-NGF constructs (equimolar to rhFGF18). Cells were cultured for five days. Subsequently, cells were fixed with 4% (w/v) paraformaldehyde in PBS, 15 min., washed in PBS three times and then permeabilized with 0.2% (v/v) Triton X100 in PBS, 5 min. at room temperature.
- the fixed and permeabilized cells were washed three times with PBS and stained with Hoechst 33342 (1/400, Invitrogen Cat No. H1399) and Phalloidin-Alex 488 (1/40, Invitrogen, Cat No. A12379) in PBS for 1 h at room temperature. Finally, the cells were washed three times with PBS. Images were acquired with an inverted microscope (Zeiss, Axio Observer) using a filter set for green and blue fluorescence.
- results for FGF18 scFv Tanezumab rhFGF18 and FGF18scFv-Tanezumab were tested at 0.015, 0.05, 0.15, 0.5, 1.5, 5, 15 and 50 nM.
- the effect of the construct FGF18 scFv Tanezumab was less pronounced than the effect of rhFGF18.
- both molecules increased dose-dependently the cell proliferation and decreased type I collagen expression ( FIG. 2 A ).
- results for MBE626 rhFGF18 and MBE626 were tested at 0.504, 5.04 and 50.4 nM.
- the effect of MBE626 on chondrocyte proliferation was less pronounced than the effect of rhFGF18 but reached 65% of the effect of rhFGF18 at 50.04 nM.
- Regarding the inhibition of type I collagen expression both molecules performed similarly.
- MBE626 induced cell rounding as rhFGF18 did ( FIG. 2 B ).
- the objective of this study was to determine the dose response (potency) of intraarticular (i.art.) FGF18-scFv (human recombinant FGF18 fused to single chain Fragment of antibody against NGF) on monoiodoacetate (MIA) induced gait disturbance (pain like behavior) in comparison to tanezumab injected i.v.
- FGF18-scFv human recombinant FGF18 fused to single chain Fragment of antibody against NGF
- MIA monoiodoacetate
- This system uses an illuminated glass bottom tunnel where paw contact areas on the glass is brightly illuminated and recorded by a video camera from below. Rats are day night inverted and analyzed during the dark, active phase. Walking through the tunnel (acquired area) must be completely voluntary and within a 10-sec time frame. For each animal, three independent runs were acquired. If an animal stops or stands up during video acquisition the data of that run is deleted. If the rat does not perform the catwalk within 5 minutes the next animal will be tested without obtaining any data. The Noldus Catwalk XT 10.0 software is then assigning the paw prints to a certain position (e.g. left forepaw). For a description of gait performance/disturbance the parameter print length is calculated as % of contralateral.
- the % of contralateral value is averaged for each run to obtain single animal values.
- different doses of FGF18-scFv-tanezumab from 0.03 to 100 ⁇ g/joint or PBS were injected intra articular into the diseased right knee joint at day 1 after MIA injection. Tanezumab was injected i.v. at the same time (at a high dose of 1 mg/kg).
- the vehicle group received 30 ⁇ g/joint PBS intraarticular. Each group consisted of 7 animals.
- FIG. 3 A shows the principle of the study.
- Example 5 Duration of the Symptomatic Benefit by the Fusion Protein after One i. Art. Injection in a Chronic OA-Model (ACLT tMx Model)
- the objective of this study was to determine the benefit of novel bi-functional molecules, tested at one high dose, on gait disturbance after surgery induced chronic osteoarthritis.
- the vehicle group received 30 ⁇ g/joint PBS intraarticular. As positive reference, tanezumab was injected i.v. at the same time. Each group of animals comprised 9 to 10 animals.
- FIG. 4 A shows the principle of the study.
- Example 6 Dose Dependent Symptomatic and Structural Benefit by the Fusion Protein MBE626 after Three i. Art. Injection with Monthly Interval in a Chronic OA-Model (ACLT pMx Model)
- the objective of this study was to determine the benefit of novel bi-functional molecules after chronic repetitive application on structure and symptoms in the same experiment.
- FIG. 5 A shows the principle of the study.
- MBE626 caused with all tested doses an immediate and long-lasting benefit on gait disturbance ( FIG. 5 B ). After the first injection, this effect was dose dependent which the exception that 27 ⁇ g/joint was somewhat less effective at several time points. The strongest benefit was seen with the highest dose (90 ⁇ g/joint) reaching 40% benefit over placebo ( FIG. 6 ). In comparison, the positive reference tanezumab (i.v.) showed 87% benefit over placebo. At the endpoint (day 98), histology investigation revealed a trend for an increase in the pro-anabolic score with higher doses of MBE626 ( FIG. 7 ).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Physical Education & Sports Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Rheumatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Microbiology (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP17192467 | 2017-09-21 | ||
EP17192467.3 | 2017-09-21 | ||
EP17192467 | 2017-09-21 | ||
EP18182696 | 2018-07-10 | ||
EP18182696 | 2018-07-10 | ||
EP18182696.7 | 2018-07-10 | ||
PCT/EP2018/075432 WO2019057805A1 (en) | 2017-09-21 | 2018-09-20 | FUSION PROTEIN COMPRISING A FRACTION FGF-18 |
Publications (2)
Publication Number | Publication Date |
---|---|
US20200299347A1 US20200299347A1 (en) | 2020-09-24 |
US11572395B2 true US11572395B2 (en) | 2023-02-07 |
Family
ID=63557503
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/648,677 Active 2038-11-25 US11572395B2 (en) | 2017-09-21 | 2018-09-20 | Fusion protein comprising an FGF-18 moiety |
Country Status (15)
Country | Link |
---|---|
US (1) | US11572395B2 (zh) |
EP (1) | EP3684791A1 (zh) |
JP (1) | JP7237945B2 (zh) |
KR (1) | KR20200054300A (zh) |
CN (1) | CN111132997A (zh) |
AU (1) | AU2018337686B2 (zh) |
BR (1) | BR112020005035A2 (zh) |
CA (1) | CA3074483A1 (zh) |
CL (1) | CL2020000733A1 (zh) |
IL (1) | IL273271A (zh) |
MX (1) | MX2020003211A (zh) |
PH (1) | PH12020550099A1 (zh) |
RU (1) | RU2020113713A (zh) |
SG (1) | SG11202001772SA (zh) |
WO (1) | WO2019057805A1 (zh) |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2020086758A1 (en) * | 2018-10-23 | 2020-04-30 | Dragonfly Therapeutics, Inc. | Heterodimeric fc-fused proteins |
CN113151185B (zh) * | 2020-11-17 | 2023-06-23 | 苏州仁端生物医药科技有限公司 | 分泌抗fgf18单克隆抗体杂交瘤细胞株及其单抗、应用 |
WO2023019121A2 (en) * | 2021-08-09 | 2023-02-16 | Merck Patent Gmbh | Proteins that decouple t cell-mediated tumor cytotoxicity from release of pro-inflammatory cytokines |
CN117721115A (zh) * | 2022-09-06 | 2024-03-19 | 深圳瑞吉生物科技有限公司 | 用于治疗骨关节炎的mRNA及其制备方法与应用 |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8207115B2 (en) * | 2006-08-25 | 2012-06-26 | Ares Trading S.A. | Treatment of cartilage disorders with FGF-18 |
US8809499B2 (en) * | 2009-08-20 | 2014-08-19 | Chongqing Fagen Biomedical Inc. | Fusion protein of human fibroblast growth factor-21 and exendin-4 |
WO2015114150A1 (en) | 2014-02-02 | 2015-08-06 | Medimmune Limited | Chimeric protein composed of ngf antagonist domain and a tnfa antagonist domain |
US9505829B2 (en) * | 2010-08-19 | 2016-11-29 | Zoetis Belgium S.A. | Anti-NGF antibodies and their use |
WO2017025611A1 (en) | 2015-08-13 | 2017-02-16 | Merck Patent Gmbh | Combination composition comprising fgf-18 compound |
Family Cites Families (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
IL129379A (en) | 1996-10-16 | 2008-12-29 | Zymogenetics Inc | Fibroblast growth factor homologues |
US7470665B2 (en) * | 1999-12-02 | 2008-12-30 | Zymogenetics, Inc. | Methods for targeting cells that express fibroblast growth receptor-3 or -2 |
US6855510B2 (en) * | 2001-03-20 | 2005-02-15 | Dana Farber Cancer Institute, Inc. | Pharmaceuticals and methods for treating hypoxia and screening methods therefor |
EP2354791A1 (en) * | 2001-12-04 | 2011-08-10 | Merck Patent GmbH | Immunocytokines with modulated selectivity |
EP1551426B1 (en) | 2002-10-07 | 2014-06-25 | ZymoGenetics, Inc. | Methods of administering fgf18 |
CN1980952A (zh) * | 2004-02-23 | 2007-06-13 | 伯瑞恩药物私人有限公司 | 多聚化hiv融合抑制物 |
WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
US10982008B2 (en) * | 2014-12-05 | 2021-04-20 | Merck Patent Gmbh | Domain-exchanged antibody |
-
2018
- 2018-09-20 KR KR1020207011323A patent/KR20200054300A/ko not_active Application Discontinuation
- 2018-09-20 AU AU2018337686A patent/AU2018337686B2/en active Active
- 2018-09-20 US US16/648,677 patent/US11572395B2/en active Active
- 2018-09-20 RU RU2020113713A patent/RU2020113713A/ru unknown
- 2018-09-20 JP JP2020516660A patent/JP7237945B2/ja active Active
- 2018-09-20 MX MX2020003211A patent/MX2020003211A/es unknown
- 2018-09-20 CN CN201880061326.1A patent/CN111132997A/zh active Pending
- 2018-09-20 WO PCT/EP2018/075432 patent/WO2019057805A1/en unknown
- 2018-09-20 CA CA3074483A patent/CA3074483A1/en active Pending
- 2018-09-20 SG SG11202001772SA patent/SG11202001772SA/en unknown
- 2018-09-20 BR BR112020005035-0A patent/BR112020005035A2/pt unknown
- 2018-09-20 EP EP18769208.2A patent/EP3684791A1/en active Pending
-
2020
- 2020-03-12 IL IL273271A patent/IL273271A/en unknown
- 2020-03-20 CL CL2020000733A patent/CL2020000733A1/es unknown
- 2020-03-20 PH PH12020550099A patent/PH12020550099A1/en unknown
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8207115B2 (en) * | 2006-08-25 | 2012-06-26 | Ares Trading S.A. | Treatment of cartilage disorders with FGF-18 |
US8809499B2 (en) * | 2009-08-20 | 2014-08-19 | Chongqing Fagen Biomedical Inc. | Fusion protein of human fibroblast growth factor-21 and exendin-4 |
US9505829B2 (en) * | 2010-08-19 | 2016-11-29 | Zoetis Belgium S.A. | Anti-NGF antibodies and their use |
WO2015114150A1 (en) | 2014-02-02 | 2015-08-06 | Medimmune Limited | Chimeric protein composed of ngf antagonist domain and a tnfa antagonist domain |
WO2017025611A1 (en) | 2015-08-13 | 2017-02-16 | Merck Patent Gmbh | Combination composition comprising fgf-18 compound |
US20180236032A1 (en) | 2015-08-13 | 2018-08-23 | Merck Patent Gmbh | Combination composition comprising fgf-18 compound |
Non-Patent Citations (5)
Title |
---|
Davis et al. Protein Engineering, Design & Selection 23(4): 195-202, 2010. * |
Martel-Pelletier et al. (Bone 51: 297-311, 2012). * |
Spierings et al. (PAIN 154: 1603-1612, 2013). * |
Vinatier, C. et al. "Osteoarthritis: from pathogenic mechanisms and recent clinical developments to novel prospective therapeutic options" Drug Discovery Today, 2016, pp. 1932-1937, vol. 21, No. 12. |
Written Opinion in International Application No. PCT/EP2018/075432, prepared by Authorized Officer Franz Chavanne, posted in PatentScope on Mar. 28, 2019, dated Nov. 16, 2018, pp. 1-8. |
Also Published As
Publication number | Publication date |
---|---|
BR112020005035A2 (pt) | 2020-09-15 |
AU2018337686B2 (en) | 2023-04-20 |
MX2020003211A (es) | 2020-09-21 |
KR20200054300A (ko) | 2020-05-19 |
RU2020113713A3 (zh) | 2022-03-03 |
AU2018337686A1 (en) | 2020-03-19 |
SG11202001772SA (en) | 2020-04-29 |
PH12020550099A1 (en) | 2020-09-14 |
RU2020113713A (ru) | 2021-10-21 |
CA3074483A1 (en) | 2019-03-28 |
JP2020536511A (ja) | 2020-12-17 |
IL273271A (en) | 2020-04-30 |
CL2020000733A1 (es) | 2020-10-02 |
EP3684791A1 (en) | 2020-07-29 |
CN111132997A (zh) | 2020-05-08 |
WO2019057805A1 (en) | 2019-03-28 |
JP7237945B2 (ja) | 2023-03-13 |
US20200299347A1 (en) | 2020-09-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11572395B2 (en) | Fusion protein comprising an FGF-18 moiety | |
US20220089668A1 (en) | Targeted mutant interferon-beta and uses thereof | |
CN102775493B (zh) | IL-1β结合抗体及其片段 | |
RU2670743C2 (ru) | Способы лечения состояний антителами, которые связывают рецептор колониестимулирующего фактора 1 (csf1r) | |
JP5089582B2 (ja) | TNFαを阻害する安定な可溶性抗体 | |
ES2704007T3 (es) | Anticuerpos anti-factor de crecimiento nervioso y procedimientos de preparación y uso de los mismos | |
EP2681242B1 (en) | Sclerostin and dkk-1 bispecific binding agents | |
JP2017522892A (ja) | Cdh19およびcd3に対する抗体コンストラクト | |
US20030223989A1 (en) | CD137 agonists to treat patients with IgE-mediated conditions | |
TW201305198A (zh) | Dkk1抗體及使用方法 | |
KR20080032046A (ko) | 항-인터루킨2 항체 | |
CN102656190A (zh) | 用于在视网膜神经纤维层变性治疗中使用的针对rgm a蛋白质的单克隆抗体 | |
MX2008013459A (es) | Composiciones de anticuerpos glucagon/compuesto de peptido 1 similar al glucagon (glp-1). | |
EP3298037B1 (en) | Anti-dkk-1-anti-rankl bispecific antibody compounds | |
JP2021518132A (ja) | Gipr抗体及びglp−1とのその融合タンパク質、並びにその医薬組成物及び用途 | |
CN115066253A (zh) | Il2突变蛋白 | |
US20240254245A1 (en) | Antigen binding molecule specifically binding to rankl and ngf, and medical use thereof | |
RU2745453C2 (ru) | Комбинированная композиция, содержащая соединение fgf-18 | |
US20240076371A1 (en) | Compositions and methods for treating osteoarthritis, rheumatoid arthritis, and joint and tendon disorders | |
ES2905682T3 (es) | Anticuerpos anti-factor de crecimiento nervioso y métodos de preparación y uso de los mismos |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
AS | Assignment |
Owner name: MERCK PATENT GMBH, GERMANY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:ARES TRADING S.A.;REEL/FRAME:063265/0718 Effective date: 20230403 Owner name: ARES TRADING S.A., SWITZERLAND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:MERCK KGAA;REEL/FRAME:063265/0713 Effective date: 20230330 Owner name: MERCK KGAA, GERMANY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GIGOUT, ANNE;BRENNEIS, CHRISTIAN;RYSIOK, THOMAS;AND OTHERS;SIGNING DATES FROM 20230228 TO 20230316;REEL/FRAME:063265/0704 |
|
CC | Certificate of correction |