US10583156B2 - Nanoparticle formulations - Google Patents

Nanoparticle formulations Download PDF

Info

Publication number
US10583156B2
US10583156B2 US15/828,971 US201715828971A US10583156B2 US 10583156 B2 US10583156 B2 US 10583156B2 US 201715828971 A US201715828971 A US 201715828971A US 10583156 B2 US10583156 B2 US 10583156B2
Authority
US
United States
Prior art keywords
myc
tat
protein
cells
polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Active - Reinstated, expires
Application number
US15/828,971
Other languages
English (en)
Other versions
US20180153939A1 (en
Inventor
Brian Curtis Turner
Yosef Refaeli
Gregory Alan Bird
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Htyr Acquisition LLC
Original Assignee
Taiga Biotechnologies Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Taiga Biotechnologies Inc filed Critical Taiga Biotechnologies Inc
Priority to US15/828,971 priority Critical patent/US10583156B2/en
Publication of US20180153939A1 publication Critical patent/US20180153939A1/en
Assigned to TAIGA BIOTECHNOLOGIES, INC. reassignment TAIGA BIOTECHNOLOGIES, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: BIRD, GREGORY ALAN, REFAELI, YOSEF, TURNER, BRIAN CURTIS
Priority to US16/742,082 priority patent/US11116796B2/en
Application granted granted Critical
Publication of US10583156B2 publication Critical patent/US10583156B2/en
Priority to US17/386,437 priority patent/US20220096545A1/en
Assigned to TAIGA BIOTECHNOLOGIES (ABC), LLC reassignment TAIGA BIOTECHNOLOGIES (ABC), LLC ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: TAIGA BIOTECHNOLOGIES, INC.
Assigned to HTYR ACQUISITION LLC reassignment HTYR ACQUISITION LLC ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: TAIGA BIOTECHNOLOGIES (ABC), LLC
Active - Reinstated legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14—Blood; Artificial blood
    • A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39566—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against immunoglobulins, e.g. anti-idiotypic antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00—Medicinal preparations characterised by special physical form
    • A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/51—Nanocapsules; Nanoparticles
    • A61K9/5107—Excipients; Inactive ingredients
    • A61K9/513—Organic macromolecular compounds; Dendrimers
    • A61K9/5169—Proteins, e.g. albumin, gelatin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/04—Immunostimulants
    • B—PERFORMING OPERATIONS; TRANSPORTING
    • B82—NANOTECHNOLOGY
    • B82Y—SPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
    • B82Y5/00—Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702—Regulators; Modulating activity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70514—CD4
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70517—CD8
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/82—Translation products from oncogenes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0636—T lymphocytes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/41—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00—Active agents used in cell culture processes, e.g. differentation
    • C12N2501/60—Transcription factors
    • C12N2501/606—Transcription factors c-Myc

Definitions

  • Protein aggregation refers to the process by which protein molecules assemble into stable complexes composed of two or more proteins, with the individual proteins denoted as the monomer. Aggregates are often held together by strong non-covalent contacts, and require some degree of conformational distortion (unfolding or misfolding) in order to present key stretches of amino acids that form the strong contacts between monomers. While aggregation tends to increase the stability of protein, it often does so at the cost of biological activity of the protein, decreased uniformity of the composition, and can, in some cases, increase the immunogenicity of the protein. These properties adversely affect the ability to use such proteins as a biologic for treatment.
  • the present technology relates to the controlled assembly of MYC-containing polypeptides into populations of biologically active particles of defined size range. Methods are provided herein for the production of stable preparations of MYC-containing nanoparticles that retain biologic activity. Also provided are methods using the biologically active particles for treatment, including in vitro and in vivo methods of treating cells.
  • compositions comprising MYC-containing polypeptides formulated as biologically active, stable nanoparticles.
  • the MYC-containing polypeptides comprise a fusion peptide, wherein the fusion peptide comprises: (i) a protein transduction domain; (ii) a MYC polypeptide sequence, and wherein the nanoparticles exhibit the biological activity of MYC.
  • the fusion peptide comprises SEQ ID NO: 1.
  • the fusion peptide comprises SEQ ID NO: 10.
  • compositions comprising a population of biologically active nanoparticles comprising one or more MYC-containing polypeptides.
  • the number average diameter of the biologically active nanoparticles is between about 80 nm and about 150 nm.
  • pH of the formulation is at least about pH 6.0, but is no greater than about pH 8.
  • contacting an anti-CD3 or anti-CD28 activated T-cell with the MYC-containing polypeptide nanoparticle composition under conditions suitable for T-cell proliferation augments one or more of the activation, survival, or proliferation of the T-cell compared with an anti-CD3 or anti-CD28 activated T-cell that is not contacted with the MYC polypeptide-containing composition.
  • the MYC polypeptide is acetylated.
  • the MYC-containing polypeptide comprises a MYC fusion peptide, comprising a protein transduction domain linked to a MYC polypeptide.
  • the MYC fusion peptide further comprises one or more molecules that link the protein transduction domain and the MYC polypeptide.
  • the MYC-containing polypeptide comprises a MYC fusion peptide with the following general structure: protein transduction domain-X-MYC sequence, wherein -X- is molecule that links the protein transduction domain and the MYC sequence.
  • the protein transduction domain sequence is a TAT protein transduction domain sequence.
  • the TAT protein transduction domain sequence is selected from the group consisting of TAT[48-57] and TAT[57-48].
  • the MYC polypeptide is a MYC fusion peptide comprising SEQ ID NO: 1.
  • the MYC polypeptide is a MYC fusion peptide comprising SEQ ID NO: 10.
  • the nanoparticles have a number average diameter of between about 80 nm and about 150 nm. In some embodiments, the nanoparticles have a number average diameter of between about 100 nm and about 110 nm.
  • the composition further comprises, a pharmaceutically acceptable excipient. In some embodiments, the composition is formulated for topical administration, oral administration, parenteral administration, intranasal administration, buccal administration, rectal administration, or transdermal administration.
  • the one or more immune cells comprise one or more anergic immune cells.
  • the one or more immune cells are T cells.
  • the T cells are selected from the group consisting of naive T cells, CD4+ T cells, CD8+ T cells, memory T cells, activated T cells, anergic T cells, tolerant T cells, chimeric B cells, and antigen-specific T cells.
  • the one or more immune cells are B cells.
  • the B cells are selected from the group consisting of naive B cells, plasma B cells, activated B cells, memory B cells, anergic B cells, tolerant B cells, chimeric B cells, and antigen-specific B cells.
  • hematopoietic stem cell transplantation comprising, contacting one or more hematopoietic stem cells, in vitro, with the composition provided herein comprising a population of biologically active nanoparticles comprising one or more MYC-containing polypeptides prior to transplantation of the hematopoietic stem cells.
  • methods for the preparation of a population of biologically active nanoparticles comprising one or more MYC-containing polypeptides comprising: (a) solubilizing MYC-containing polypeptides in a solubilization solution comprising a concentration of a denaturing agent to provide solubilized MYC-containing polypeptides; (b) performing a first refolding step on the solubilized MYC-containing polypeptides with a first refold buffer comprising about 0.35 to about 0.65 the concentration of the denaturing agent of step (a) and about 100 mM to about 1M alkali metal salt and/or alkaline metal salt for at least about 30 to 180 minutes to provide a first polypeptide mixture; (c) performing a second refolding step on the first polypeptide mixture with a second refold buffer comprising about 0.10 to about 0.30 the concentration of the denaturing agent of step (b) and about 100 mM to 1M
  • the first refolding step, second refolding step, and/or third refolding step comprise performing the step by buffer exchange.
  • buffer exchange is performed using tangential flow filtration.
  • the alkali metal salt comprises one more of a sodium salt, a lithium salt, and a potassium salt.
  • the alkali metal salt comprises one or more of sodium chloride (NaCl), sodium bromide, sodium bisulfate, sodium sulfate, sodium bicarbonate, sodium carbonate, lithium chloride, lithium bromide, lithium bisulfate, lithium sulfate, lithium bicarbonate, lithium carbonate, potassium chloride, potassium bromide, potassium bisulfate, potassium sulfate, potassium bicarbonate, and potassium carbonate.
  • the alkaline salt comprises one more of a magnesium salt and a calcium salt.
  • the alkaline metal salt comprises one or more of magnesium chloride, magnesium bromide, magnesium bisulfate, magnesium sulfate, magnesium bicarbonate, magnesium carbonate, calcium chloride, calcium bromide, calcium bisulfate, calcium sulfate, calcium bicarbonate, and calcium carbonate.
  • the alkali metal salt comprises sodium chloride (NaCl).
  • the first, second, and/or third refold buffers comprise about 500 mM NaCl.
  • the concentration of denaturing agent in step (a) is from about 1 M to about 10 M.
  • the denaturing agent comprises one or more of guanidine, guanidine hydrochloride, guanidine chloride, guanidine thiocyanate, urea, thiourea, lithium perchlorate, magnesium chloride, phenol, betain, sarcosine, carbamoyl sarcosine, taurine, dimethylsulfoxide (DMSO); alcohols such as propanol, butanol and ethanol; detergents, such as sodium dodecyl sulfate (SDS), N-lauroyl sarcosine, Zwittergents, non-detergent sulfobetains (NDSB), TRITON X-100, NONIDETTM P-40, the TWEENTM series and BRIJTM series; hydroxides such as sodium and potassium hydroxide.
  • SDS sodium dodecyl sulfate
  • N-lauroyl sarcosine Zwittergents, non-detergent
  • the first refold buffer, the second refold buffer, and/or third refold buffer each independently comprise a buffering agent.
  • the buffering agent comprises one or more of TRIS (Tris[hydroxymethyl]aminomethane), HEPPS (N-[2-Hydroxyethyl]piperazine-N′-[3-propane-sulfonic acid]), CAP SO (3-[Cyclohexylamino]-2-hydroxy-1-propanesulfonic acid), AMP (2-Amino-2-methyl-1propanol), CAPS (3-[Cyclohexylamino]-1-propanesulfonic acid), CHES (2[N-Cyclohexylamino]ethanesulfonic acid), arginine, lysine, and sodium borate.
  • TRIS Tris[hydroxymethyl]aminomethane
  • HEPPS N-[2-Hydroxyethyl]piperazine-N′-[3-propane
  • the buffering agent is independently present at a concentration from about 1 mM to about 1M.
  • the first refold buffer, second refold buffer, and/or third refold buffer each independently comprise an oxidizing agent and a reducing agent, wherein a mole ratio of oxidizing reagent to reducing agent is from about 2:1 to about 20:1.
  • the oxidizing agent comprises cysteine, glutathione disulfide (“oxidized glutathione”), or both.
  • the oxidizing agent is included in a concentration from about 0.1 mM to about 10 mM.
  • the reducing agent comprises one or more of beta-mercaptoethanol (BME), dithiothreitol (DTT), dithioerythritol (DTE), tris(2-carboxyethyl)phosphine, (TCEP), cystine, cysteamine, thioglycolate, glutathione, and sodium borohydride.
  • BME beta-mercaptoethanol
  • DTT dithiothreitol
  • DTE dithioerythritol
  • TCEP tris(2-carboxyethyl)phosphine
  • cystine cysteamine
  • thioglycolate glutathione
  • sodium borohydride sodium borohydride
  • the reducing agent is included in a concentration from about 0.02 mM to about 2 mM.
  • the denaturing agent comprises urea.
  • the denaturing agent comprises 6-8M urea.
  • the first, second, and/or third refold buffers comprise glutathione and/or oxidized glutathione. In some embodiments, the first, second, and/or third refold buffers comprise 5 mM glutathione and/or 1 mM oxidized glutathione. In some embodiments, the first, second, and/or third refold buffers comprise glycerol. In some embodiments, the step (f) is performed for at least 5 hours. In some embodiments, the step (f) is performed for at least 10 hours. In some embodiments, the step (f) is performed for 10-12 hours. In some embodiments, the step (f) further comprises stirring the MYC-containing polypeptides in the third refold buffer at less than 1000 rpm.
  • the methods provided herein further comprise isolating a recombinant MYC-containing polypeptide from a microbial host cell.
  • the microbial host cell is E. coli .
  • isolating a recombinant MYC-containing polypeptide from a microbial host cell comprises expressing the MYC-containing polypeptide from an inducible promoter.
  • isolating a recombinant MYC-containing polypeptide from a microbial host cell comprises purifying the MYC-containing polypeptide using affinity chromatography and/or anion exchange chromatography.
  • the MYC-containing polypeptide is acetylated.
  • the MYC-containing polypeptides of the nanoparticle compositions and methods for the production thereof provided herein are recombinant polypeptides.
  • the MYC-containing polypeptide of the nanoparticle compositions provided herein comprises a MYC fusion peptide, comprising a protein transduction domain linked to a MYC polypeptide.
  • the MYC fusion peptide further comprises one or more molecules that link the protein transduction domain and the MYC polypeptide.
  • the MYC-containing polypeptide comprises a MYC fusion peptide with the following general structure: protein transduction domain-X-MYC sequence, wherein -X- is molecule that links the protein transduction domain and the MYC sequence.
  • protein transduction domain sequence is a TAT protein transduction domain sequence.
  • TAT protein transduction domain sequence is selected from the group consisting of TAT[48-57] and TAT[57-48].
  • the MYC-containing polypeptide is a MYC fusion peptide comprising SEQ ID NO: 1.
  • the MYC-containing polypeptide is a MYC fusion peptide comprising SEQ ID NO: 10.
  • the nanoparticles have a number average diameter from about 80 nm and about 150 nm. In some embodiments, the nanoparticles have a number average diameter from about 100 nm and about 110 nm.
  • a method for the preparation of a population of biologically active nanoparticles comprising one or more MYC-containing polypeptides comprising: (a) denaturing MYC-containing polypeptides in a buffered solubilization solution comprising 6-8M Urea to provide denatured MYC-containing polypeptides; (b) performing a first refolding step on the denatured MYC-containing polypeptides with a first refold buffer comprising about 3M Urea and about 500 mM NaCl for at least about 120 minutes to provide a first polypeptide mixture; (c) performing a second refolding step on the first polypeptide mixture by buffer exchange with a second refold buffer comprising about 1.5M Urea and about 500 mM NaCl at least about 120 minutes to provide a second polypeptide mixture; (d) performing a third refolding step on the second polypeptide mixture by buffer exchange with a third refold buffer comprising
  • FIG. 1A and FIG. 1B show the effect of MYC-containing nanoparticle formulation C2A on proliferation of anti-CD3 and anti-CD28 activated T-cells using flow cytometry techniques.
  • FIG. 1A shows the proliferation of T-cells in the buffer control sample.
  • FIG. 1B shows flow the proliferation of T-cells incubated for 24 h with MYC-containing nanoparticle formulation C2A.
  • FIG. 2A and FIG. 2B show chromatograms of select MYC-containing nanoparticle formulations analyzed by Asymmetrical Flow Field-flow Fractionation (AF4) and Multiangle Laser Light Scattering (MALLS).
  • FIG. 3 shows a comparison of chromatograms derived by fractionating biologically active and inactive MYC-containing nanoparticle formulations by size exclusion chromatography (SEC) using Sepax SRT-C 2000 and 300 columns in tandem. Traces showing fractionation of biologically active nanoparticle formulations C12 and C13 and the biologically inactive formulation R147 are indicated.
  • FIG. 4A and FIG. 4B show analysis of MYC-containing nanoparticle formulation C2A using Size Exclusion Chromatography with Multi-Angle Light Scattering analysis (SEC-MALS).
  • FIG. 4A shows retention volume (ml) as a function of refractive index (left ordinate, RV ⁇ RI) or molecular size (right ordinate, RV ⁇ MW).
  • FIG. 4B shows chromatograms showing fractionation of biologically active MYC-containing nanoparticle formulations and a biologically inactive formulation.
  • FIG. 5A-D depicts size distribution of MYC-containing nanoparticles in select formulations analyzed by Dynamic Light Scattering (DLS) technique.
  • FIG. 5A depicts size distribution of MYC-containing nanoparticle formulation C2A by DLS.
  • FIG. 5B depicts size distribution of non-biologically active MYC-containing nanoparticle formulation R149 tested at a concentration of 0.5 mg/ml.
  • FIG. 5C depicts the nanoparticle size distribution of biologically active MYC-containing nanoparticle formulation C12 tested at a concentration of 0.5 mg/ml.
  • FIG. 5D shows the nanoparticle size distribution of biologically active MYC-containing nanoparticle formulation C13 tested at a concentration of 0.5 mg/ml.
  • FIG. 6A and FIG. 6B shows analysis of MYC-containing nanoparticle formulation C2A using Nanoparticle Tracking Analysis (NTA) technique.
  • FIG. 6A shows the tracings observed from triplicate determination of nanoparticle formulation C2A.
  • FIG. 6B shows the consensus tracing of the triplicate determinations derived from the analysis of C2A nanoparticle formulation shown in FIG. 6A .
  • FIG. 7 shows analysis of MYC-containing nanoparticle formulation C2B using electron microscopy technique.
  • FIG. 8 shows a comparison of Asp-N endoproteinase digests of biologically active and inactive MYC-containing nanoparticle formulations by peptide mapping analysis technique.
  • Biologically active MYC-containing nanoparticle formulations C2B, C6 and C7 (“functional”) were compared to biologically inactive MYC-containing nanoparticle formulations C4, 147 and 149 (“non-functional”).
  • FIG. 9 shows a representative peptide map for MYC-containing nanoparticle formulation C13 with the individual peptide peaks identified.
  • FIG. 10A-C shows RP-HPLC Chromatograms for nanoparticle formulation C13.
  • FIG. 10A shows the full chromatogram.
  • FIG. 10B and FIG. 10C show two different zoom views of full chromatogram in FIG. 10A .
  • FIG. 11 shows the results for Far UV CD Spectroscopy analysis of nanoparticle formulation C13 depicted as mean residues molar ellipticity (deg cm 2 per decimole) as a function of wavelength (nm).
  • FIG. 12 shows the results for Near UV CD Spectroscopy analysis of nanoparticle formulation C13 depicted as mean residues molar ellipticity (deg cm 2 per decimole) as a function of wavelength (nm).
  • FIG. 13 shows the Normalized Second Derivative Fourier transform infrared spectra (FTIR) for four separate samples of nanoparticle formulation C14 in comparison with two control samples of bovine serum albumin (BSA).
  • FTIR Normalized Second Derivative Fourier transform infrared spectra
  • FIG. 14 shows Analytical Ultracentrifugation (AUC) data for nanoparticle formulation C13.
  • FIG. 15A and FIG. 15B show Non-reduced (NR) and Reduced (R) Denaturing SEC chromatograms, respectively, for nanoparticle formulation C13.
  • the overlaid traces on each chromatogram represent testing that was performed approximately 1 month apart for samples stored at 2° C.-8° C.
  • FIG. 16A and FIG. 16B show denaturing SEC chromatograms for TAT-MYC and TAT-3AMYC nanoparticle formulations.
  • FIG. 16B shows the chromatogram for TAT-MYC.
  • TAT-MYC protein complex elutes between minutes 6 and 7.
  • Smaller protein multimers and excipient elute between minutes 8 and 15.
  • FIG. 16B shows the chromatograms for TAT-3AMYC compared to the functional TAT-MYC protein preparations.
  • the bulk of the non-functional TAT-3AMYC protein preparation is comprised of smaller protein multimers and excipient peaks can be seen eluting between minute 8 and 17.
  • FIG. 17 shows the results of a T cell potency assay.
  • TAT-MYC showed a 3 fold increase the live population T-cell population compared to no treatment (NT).
  • TAT-3AMYC showed no increase the live T-cell population compared to no treatment (NT).
  • FIG. 18 depicts size distribution of MYC-containing nanoparticles in selected formulations of Green Monkey TAT-MYC analyzed by Dynamic Light Scattering (DLS) technique.
  • DLS Dynamic Light Scattering
  • FIG. 19 shows RP-HPLC Chromatograms for Green Monkey TAT-MYC compared to human TAT-MYC.
  • FIG. 20 shows SEC-HPLC Chromatograms for Green Monkey TAT-MYC compared to human TAT-MYC.
  • FIG. 21 shows the results of a T cell potency assay for Green Monkey TAT-MYC compared to human TAT-MYC.
  • a range includes each individual member.
  • a group having 1-3 cells refers to groups having 1, 2, or 3 cells.
  • a group having 1-5 cells refers to groups having 1, 2, 3, 4, or 5 cells, and so forth.
  • a concentration of about 200 IU/mL encompasses a concentration between 160 IU/mL and 240 IU/mL.
  • administration of an agent to a subject includes any route of introducing or delivering the agent to a subject to perform its intended function. Administration can be carried out by any suitable route, including intravenously, intramuscularly, intraperitoneally, or subcutaneously. Administration includes self-administration and the administration by another.
  • amino acid refers to naturally occurring and non-naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrolysine and selenocysteine.
  • Amino acid analogs refers to agents that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • amino acids forming a polypeptide are in the D form.
  • the amino acids forming a polypeptide are in the L form.
  • a first plurality of amino acids forming a polypeptide are in the D form and a second plurality are in the L form.
  • Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, are referred to by their commonly accepted single-letter codes.
  • polypeptide “peptide,” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues.
  • the terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non-naturally occurring amino acid, e.g., an amino acid analog.
  • the terms encompass amino acid chains of any length, including full length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
  • control is an alternative sample used in an experiment for comparison purpose.
  • a control can be “positive” or “negative.”
  • a positive control a composition known to exhibit the desired therapeutic effect
  • a negative control a subject or a sample that does not receive the therapy or receives a placebo
  • the term “effective amount” or “therapeutically effective amount” refers to a quantity of an agent sufficient to achieve a desired therapeutic effect.
  • the amount of a therapeutic peptide administered to the subject may depend on the type and severity of the infection and on the characteristics of the individual, such as general health, age, sex, body weight and tolerance to drugs. It may also depend on the degree, severity and type of disease. The skilled artisan will be able to determine appropriate dosages depending on these and other factors.
  • the term “expression” refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell. The expression level of a gene may be determined by measuring the amount of mRNA or protein in a cell or tissue sample. In one aspect, the expression level of a gene from one sample may be directly compared to the expression level of that gene from a control or reference sample.
  • the expression level of a gene from one sample may be directly compared to the expression level of that gene from the same sample following administration of the compositions disclosed herein.
  • expression also refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription) within a cell; (2) processing of an RNA transcript (e.g., by splicing, editing, 5′ cap formation, and/or 3′ end formation) within a cell; (3) translation of an RNA sequence into a polypeptide or protein within a cell; (4) post-translational modification of a polypeptide or protein within a cell; (5) presentation of a polypeptide or protein on the cell surface; and (6) secretion or presentation or release of a polypeptide or protein from a cell.
  • linker refers to synthetic sequences (e.g., amino acid sequences) that connect or link two sequences, e.g., that link two polypeptide domains. In some embodiments, the linker contains 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 of amino acid sequences.
  • lyophilized refers to a process by which the material (e.g., nanoparticles) to be dried is first frozen and then the ice or frozen solvent is removed by sublimation in a vacuum environment.
  • An excipient may be included in pre-lyophilized formulations to enhance stability of the lyophilized product upon storage.
  • the lyophilized sample may further contain additional excipients.
  • Immune cells refers to any cell that plays a role in the immune response.
  • Immune cells are of hematopoietic origin, and include lymphocytes, such as B cells and T cells; natural killer cells; myeloid cells, such as monocytes, macrophages, dendritic cells, eosinophils, neutrophils, mast cells, basophils, and granulocytes.
  • lymphocyte refers to all immature, mature, undifferentiated and differentiated white lymphocyte populations including tissue specific and specialized varieties. It encompasses, by way of non-limiting example, B cells, T cells, NKT cells, and NK cells. In some embodiments, lymphocytes include all B cell lineages including pre-B cells, progenitor B cells, early pro-B cells, late pro-B cells, large pre-B cells, small pre-B cells, immature B cells, mature B cells, plasma B cells, memory B cells, B-1 cells, B-2 cells and anergic AN1/T3 cell populations.
  • T-cell includes na ⁇ ve T cells, CD4+ T cells, CD8+ T cells, memory T cells, activated T cells, anergic T cells, tolerant T cells, chimeric B cells, and antigen-specific T cells.
  • B cell refers to, by way of non-limiting example, a pre-B cell, progenitor B cell, early pro-B cell, late pro-B cell, large pre-B cell, small pre-B cell, immature B cell, mature B cell, na ⁇ ve B cells, plasma B cells, activated B cells, anergic B cells, tolerant B cells, chimeric B cells, antigen-specific B cells, memory B cell, B-1 cell, B-2 cells and anergic AN1/T3 cell populations.
  • the term B cell includes a B cell that expresses an immunoglobulin heavy chain and/or light chain on its cells surface.
  • the term B cell includes a B cell that expresses and secretes an immunoglobulin heavy chain and/or light chain. In some embodiments, the term B cell includes a cell that binds an antigen on its cell-surface. In some embodiments disclosed herein, B cells or AN1/T3 cells are utilized in the processes described.
  • such cells are optionally substituted with any animal cell suitable for expressing, capable of expressing (e.g., inducible expression), or capable of being differentiated into a cell suitable for expressing an antibody including, e.g., a hematopoietic stem cell, a naive B cell, a B cell, a pre-B cell, a progenitor B cell, an early Pro-B cell, a late pro-B cell, a large pre-B cell, a small pre-B cell, an immature B cell, a mature B cell, a plasma B cell, a memory B cell, a B-1 cell, a B-2 cell, an anergic B cell, or an anergic AN1/T3 cell.
  • an animal cell suitable for expressing capable of expressing (e.g., inducible expression), or capable of being differentiated into a cell suitable for expressing an antibody
  • a hematopoietic stem cell e.g., a hematopoietic stem cell
  • MYC and “MYC gene” are synonyms. They refer to a nucleic acid sequence that encodes a MYC polypeptide.
  • a MYC gene comprises a nucleotide sequence of at least 120 nucleotides that is at least 60% to 100% identical or homologous, e.g., at least 60, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 70% to about 100% identical to sequences of NCBI Accession Number NM_002467.5.
  • the MYC gene is a proto-oncogene.
  • a MYC gene is found on chromosome 8, at 8q24.21. In certain instances, a MYC gene begins at 128,816,862 bp from pter and ends at 128,822,856 bp from pter. In certain instances, a MYC gene is about 6 kb. In certain instances, a MYC gene encodes at least eight separate mRNA sequences—5 alternatively spliced variants and 3 unspliced variants.
  • MYC protein MYC polypeptide
  • MYC sequence refers to the polymer of amino acid residues disclosed in NCBI Accession Number NP_002458.2 (provided below) or UniProtKB/Swiss-Prot:P01106.1, which is human myc isoform 2, and functional homologs, variants, analogs or fragments thereof. This sequence is shown below.
  • the MYC polypeptide is a complete MYC polypeptide sequence. In some embodiments, the MYC polypeptide is a partial MYC polypeptide sequence. In some embodiments, the MYC polypeptide is c-MYC. In some embodiments, the MYC polypeptide sequence comprises the sequence shown below:
  • the MYC polypeptide sequence comprises the sequence shown below:
  • the MYC polypeptide sequence comprises a MYC polypeptide sequence from a non-human species.
  • the non-human species is selected from the group consisting of ape, monkey, mouse, rat, hamster, guinea pig, rabbit, cat, dog, pig, sheep, goat, cow, and horse species.
  • the MYC polypeptide sequence comprises the sequence shown below, which is from Chlorocebus sabaeus (green monkey) (XP_007999715.1):
  • the MYC polypeptide sequence comprises the sequence shown below:
  • a MYC polypeptide comprises an amino acid sequence that is at least 40% to 100% identical, e.g., at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, 99%, or any other percent from about 40% to about 100% identical to the sequence of NCBI Accession Number NP002458.2 (SEQ ID NO: 2).
  • a MYC polypeptide refers to a polymer of 420, 421, 422, 423, 424, 425, 426, 427, 428, 429, 430, 431, 432, 433, 434, 435, 436, 437, 438, 439, 440, 441, 442, 443, 444, 445, 446, 447, 448, 449, 450, 451, 452, 453, 454 consecutive amino acids of NP002458.2 (SEQ ID NO: 2).
  • a MYC polypeptide refers to a polymer of 435 amino acids of NP002458.2 (SEQ ID NO: 2) that has not undergone any post-translational modifications.
  • a MYC polypeptide refers to a polymer of 435 amino acids of NP002458.2 (SEQ ID NO: 2) that has undergone post-translational modifications.
  • the MYC polypeptide is 48,804 kDa.
  • the MYC polypeptide contains a basic Helix-Loop-Helix Leucine Zipper (bHLH/LZ) domain.
  • the bHLH/LZ domain comprises the sequence of ELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKH KLEQLR (SEQ ID NO: 5).
  • the MYC polypeptide is a transcription factor (e.g., Transcription Factor 64). In some embodiments, the MYC polypeptide contains a E-box DNA binding domain. In some embodiments, the MYC polypeptide binds to a sequence comprising CACGTG. In some embodiments, the MYC polypeptide promotes one or more of cell survival and/or proliferation. In some embodiments, a MYC polypeptide includes one or more of those described above, and includes one or more post-translational modifications (e.g., acetylation). In some embodiments, the MYC polypeptides comprise one or more additional amino acid residues at the N-terminus or C-terminus of the polypeptide. In some embodiments, the MYC polypeptides are fusion proteins. In some embodiments, the MYC polypeptides are linked to one or more additional peptides at the N-terminus or C-terminus of the polypeptide.
  • a transcription factor e.g., Tran
  • Proteins suitable for use in the methods described herein also includes functional variants, including proteins having between 1 to 15 amino acid changes, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acid substitutions, deletions, or additions, compared to the amino acid sequence of any protein described herein.
  • the altered amino acid sequence is at least 75% identical, e.g., 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of any protein inhibitor described herein.
  • sequence-variant proteins are suitable for the methods described herein as long as the altered amino acid sequence retains sufficient biological activity to be functional in the compositions and methods described herein.
  • the substitutions may be conservative amino acid substitutions.
  • a “conservative amino acid substitution” is illustrated by a substitution among amino acids within each of the following groups: (1) glycine, alanine, valine, leucine, and isoleucine, (2) phenylalanine, tyrosine, and tryptophan, (3) serine and threonine, (4) aspartate and glutamate, (5) glutamine and asparagine, and (6) lysine, arginine and histidine.
  • the BLOSUM62 table is an amino acid substitution matrix derived from about 2,000 local multiple alignments of protein sequence segments, representing highly conserved regions of more than 500 groups of related proteins (Henikoff et al., (1992), Proc. Natl Acad. Sci. USA, 89:10915-10919). Accordingly, the BLOSUM62 substitution frequencies are used to define conservative amino acid substitutions that, in some embodiments, are introduced into the amino acid sequences described or disclosed herein. Although it is possible to design amino acid substitutions based solely upon chemical properties (as discussed above), the language “conservative amino acid substitution” preferably refers to a substitution represented by a BLOSUM62 value of greater than ⁇ 1.
  • an amino acid substitution is conservative if the substitution is characterized by a BLOSUM62 value of 0, 1, 2, or 3.
  • preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 1 (e.g., 1, 2 or 3), while more preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 2 (e.g., 2 or 3).
  • E-box sequence and “enhancer box sequence” are used interchangeably herein and mean the nucleotide sequence CANNTG, wherein N is any nucleotide.
  • the E-box sequence comprises CACGTG.
  • the basic helix-loop-helix domain of a transcription factor encoded by MYC binds to the E-box sequence.
  • the E-box sequence is located upstream of a gene (e.g., p21, Bc1-2, or ornithine decarboxylase).
  • the MYC polypeptide contains an E-box DNA binding domain.
  • the E-box DNA binding domain comprises the sequence of KRRTHNVLERQRRN (SEQ ID NO: 6).
  • the binding of the transcription factor encoded by MYC to the E-box sequence allows RNA polymerase to transcribe the gene downstream of the E-box sequence.
  • MYC activity or “MYC biological activity” or “biologically active MYC” includes one or more of enhancing or inducing cell survival, cell proliferation, and/or antibody production.
  • MYC activity includes enhancement of expansion of anti-CD3 and anti-CD28 activated T-cells and/or increased proliferation of long-term self-renewing hematopoietic stem cells.
  • MYC activity also includes entry into the nucleus of a cell, binding to a nucleic acid sequence (e.g., binding an E-box sequence), and/or inducing expression of MYC target genes.
  • patient refers to an animal, typically a mammal.
  • patient, subject, or individual is a mammal.
  • patient, subject or individual is a human.
  • protein transduction domain or “transporter peptide sequence” (also known as cell permeable proteins (CPP) or membrane translocating sequences (MTS)) are used interchangeably herein to refer to small peptides that are able to ferry much larger molecules into cells independent of classical endocytosis.
  • CPP cell permeable proteins
  • MTS membrane translocating sequences
  • a nuclear localization signal can be found within the protein transduction domain, which mediates further translocation of the molecules into the cell nucleus.
  • treating covers the treatment of a disease in a subject, such as a human, and includes: (i) inhibiting a disease, i.e., arresting its development; (ii) relieving a disease, i.e., causing regression of the disease; (iii) slowing progression of the disease; and/or (iv) inhibiting, relieving, or slowing progression of one or more symptoms of the disease.
  • the various modes of treatment or prevention of medical diseases and conditions as described are intended to mean “substantial,” which includes total but also less than total treatment or prevention, and wherein some biologically or medically relevant result is achieved.
  • the treatment may be a continuous prolonged treatment for a chronic disease or a single, or few time administrations for the treatment of an acute condition.
  • terapéutica as used herein means a treatment and/or prophylaxis.
  • a therapeutic effect is obtained by suppression, remission, or eradication of a disease state.
  • compositions Comprising Nanoparticulate MYC Peptides
  • compositions comprising MYC-containing polypeptides formulated as biologically active, stable nanoparticles, and methods of making and using the compositions.
  • the MYC-containing polypeptide is a fusion of a MYC polypeptide and a protein transduction domain, e.g., HIV TAT.
  • the MYC fusion polypeptide also includes one or more tag sequences.
  • the MYC fusion polypeptide comprises SEQ ID NO: 1.
  • the MYC fusion polypeptide comprises SEQ ID NO: 10.
  • biologically active MYC-containing polypeptide compositions of the present technology include, in some embodiments, nanoparticles of about 90-140 nm with molecular mass of about 10 4 -10 6 daltons. In some embodiments, the particles include about 200 molecules of MYC-containing polypeptide.
  • the biologically active nanoparticulate compositions include post-translationally modified MYC protein.
  • the protein includes at least one acetyl group.
  • MYC-containing polypeptide is recombinantly produced by microbial fermentation.
  • microbial fermentation is performed in a fermentation volume of from about 1 to about 10,000 liters, for example, a fermentation volume of about 10 to about 1000 liters.
  • the fermentation can utilize any suitable microbial host cell and culture medium.
  • E. coli is utilized as the microbial host cell.
  • other microorganisms can be used, e.g., S. cerevisiae, P. pastoris, Lactobacilli, Bacilli and Aspergilli .
  • the microbial host cell is BL-21 StarTM E. coli strain (Invitrogen).
  • the microbial host cell is BLR DE3 E. coli . strain
  • the host cells are modified to provide tRNAs for rare codons, which are employed to overcome host microbial cell codon bias to improve translation of the expressed proteins.
  • the host cells e.g., E. coli
  • the host cells transformed with a plasmid, such as pRARE (CamR), which express tRNAs for AGG, AGA, AUA, CUA, CCC, GGA codons.
  • pRARE CamR
  • Additional, suitable plasmids or constructs for providing tRNAs for particular codons are known in the art and can be employed in the methods provided.
  • Integrative or self-replicative vectors may be used for the purpose of introducing the MYC-containing polypeptide expression cassette into a host cell of choice.
  • the coding sequence for the MYC-containing polypeptide is operably linked to promoter, such as an inducible promoter.
  • Inducible promoters are promoters that initiate increased levels of transcription from DNA under their control in response to some change in culture conditions, e.g., the presence or absence of a nutrient or a change in temperature.
  • the nucleic acid encoding the MYC-containing polypeptide is codon optimized for bacterial expression.
  • promoters that are recognized by a variety of potential host cells are well known. These promoters can be operably linked to MYC-containing polypeptide-encoding DNA by removing the promoter from the source DNA, if present, by restriction enzyme digestion and inserting the isolated promoter sequence into the vector.
  • Promoters suitable for use with microbial hosts include, but are not limited to, the ⁇ -lactamase and lactose promoter systems (Chang et al., (1978) Nature, 275:617-624; Goeddel et al., (1979) Nature, 281: 544), alkaline phosphatase, a tryptophan (trp) promoter system (Goeddel (1980) Nucleic Acids Res.
  • promoters for use in bacterial systems can contain a Shine-Dalgarno (S.D.) sequence operably linked to the coding sequence.
  • the inducible promoter is the lacZ promoter, which is induced with Isopropyl ⁇ -D-1-thiogalactopyranoside (IPTG), as is well-known in the art. Promoters and expression cassettes can also be synthesized de novo using well known techniques for synthesizing DNA sequences of interest.
  • the expression vector for expression of the MYC-containing polypeptides herein is pET101/D-Topo (Invitrogen).
  • the microbial host containing the expression vector encoding the MYC-containing polypeptide is typically grown to high density in a fermentation reactor.
  • the reactor has controlled feeds for glucose.
  • a fermenter inoculum is first cultured in medium supplemented with antibiotics (e.g., overnight culture). The fermenter inoculum is then used to inoculate the fermenter culture for expression of the protein. At an OD600 of at least about 15, usually at least about 20, at least 25, at least about 30 or higher, of the fermenter culture, expression of the recombinant protein is induced.
  • IPTG is added to the fermentation medium to induce expression of the MYC-containing polypeptide.
  • the IPTG is added to the fermenter culture at an OD600 which represents logarithmic growth phase.
  • induced protein expression is maintained for around about 2 to around about 5 hours post induction, and can be from around about 2 to around about 3 hours post-induction. Longer periods of induction may be undesirable due to degradation of the recombinant protein.
  • the temperature of the reaction mixture during induction is preferably from about 28° C. to about 37° C., usually from about 30° C. to about 37° C. In particular embodiments, induction is at about 37° C.
  • the MYC-containing polypeptide is typically expressed as cytosolic inclusion bodies in microbial cells.
  • a cell pellet is collected by centrifugation of the fermentation culture following induction, frozen at ⁇ 70° C. or below, thawed and resuspended in disruption buffer.
  • the cells are lysed by conventional methods, e.g., sonication, homogenization, etc.
  • the lysate is then resuspended in solubilization buffer, usually in the presence of urea at a concentration effective to solubilize proteins, e.g., from around about 5M, 6M, 7M, 8M, 9M or greater. Resuspension may require mechanically breaking apart the pellet and stirring to achieve homogeneity.
  • the cell pellet is directly resuspended in urea buffer and mixed until homogenous.
  • the resuspension/solubilization buffer is 8M Urea, 50 mM Phosphate pH 7.5 and the suspension is passed through a homogenizer.
  • the homogenized suspension is sulfonylated.
  • the homogenized suspension is adjusted to include 200 mM Sodium Sulfite and 10 mM Sodium Tetrathionate.
  • the solution is then mixed at room temperature until homogeneous.
  • the mixed lysate is then mixed for an additional period of time to complete the sulfonylation (e.g., at 2-8° C. for ⁇ 12 hours).
  • the sulfonylated lysate was then centrifuged for an hour.
  • the supernatant containing the sulfonylated MYC-containing polypeptides is then collected by centrifugation and the cell pellet discarded.
  • the supernatant is then passed through a filter, e.g., 0.22 ⁇ m membrane filter to clarify the lysate.
  • the solubilized protein is then purified.
  • Purification methods may include affinity chromatography, reverse phase chromatography, gel exclusion chromatography, and the like.
  • affinity chromatography is used.
  • the protein is provided with an epitope tag or histidine 6 tag for convenient purification.
  • exemplary myc-containing polypeptide comprise histidine 6 tag for purification using Ni affinity chromatography using Ni— resin.
  • the Ni— resin column is equilibrated in a buffer containing urea.
  • the equilibration buffer is 6M Urea, 50 mM Phosphate, 500 mM NaCl, and 10% Glycerol solution.
  • the sulfonylated and clarified supernatant comprising the MYC-containing polypeptide is then loaded onto the Ni— resin column.
  • the column is then washed with a wash buffer, e.g., 6M Urea, 50 mM Phosphate, 10% Glycerol, 500 mM NaCl, pH 7.5.
  • the column was then washed with sequential wash buffers with decreasing salt concentration.
  • exemplary subsequent washed can include 6M Urea, 50 mM Phosphate, 10% Glycerol, and 2M NaCl, pH 7.5, followed another wash of 6M Urea, 50 mM Phosphate, 10% Glycerol, 50 mM NaCl, and 30 mM Imidazole, pH 7.5.
  • the MYC-containing polypeptide is eluted from the column by addition of elution buffer, e.g., 6M Urea, 50 mM Phosphate, 10% Glycerol, and 50 mM NaCl, pH 7.5 with a gradient from 100 to 300 mM Imidazole, and collecting fractions.
  • elution buffer e.g., 6M Urea, 50 mM Phosphate, 10% Glycerol, and 50 mM NaCl, pH 7.5 with a gradient from 100 to 300 mM Imidazole, and collecting fractions.
  • the protein containing fractions to be pooled are then filtered through a 0.22 ⁇ m membrane.
  • Assessment of protein yield can be measured using any suitable method, e.g., spectrophotometry at UV wavelength 280.
  • one or more additional purification methods can be employed to further purify the isolated MYC-containing polypeptides.
  • the pooled fractions from the Ni-Sepharose chromatography step are further purified by anion exchange chromatography using a Q-Sepharose resin.
  • the pool is prepared for loading onto the Q-Sepharose column by diluting the samples to the conductivity of the Q sepharose buffer (17.52 +/ ⁇ 1 mS/cm) with the second wash buffer (e.g., 6M Urea, 50 mM Phosphate, 10% Glycerol, 2M NaCl, pH 7.5) from the Ni Sepharose chromatography step.
  • the second wash buffer e.g., 6M Urea, 50 mM Phosphate, 10% Glycerol, 2M NaCl, pH 7.5
  • the diluted pool is then loaded onto the Q-Sepharose column, followed by two chase steps using a chase buffer (e.g., 6M Urea, 50 mM Phosphate, 300 mM NaCl, and 10% Glycerol), with further sequential applications of the chase buffer until the UV trace reaches baseline, indicating that the protein has eluted from the column.
  • a chase buffer e.g., 6M Urea, 50 mM Phosphate, 300 mM NaCl, and 10% Glycerol
  • compositions of the present technology can be prepared from isolated MYC-containing polypeptide according to the following methods.
  • the MYC-containing polypeptides are refolded to produce a biologically active nanoparticle.
  • the method comprises Tangential Flow Filtration (TFF), or Cross Flow Filtration.
  • TFF is a process which uses a pump to circulate a sample across the surface of membranes (i.e. “tangential” to the membrane surface) housed in a multilevel structure (cassette). The applied transmembrane pressure acts as the driving force to transport solute and small molecules through the membrane. The cross flow of liquid over the membrane surface sweeps retaining molecules from the surface, keeping them in the circulation stream.
  • the MYC-containing polypeptides are denatured with a denaturing agent, such as urea.
  • a denaturing agent such as urea.
  • the MYC-containing polypeptides are then refolded using multiple TFF steps across a ultrafiltration/diafiltration (UFDF) membrane and sequential additions of refold buffers having decreasing concentrations of the denaturing agent, e.g., urea.
  • the urea concentration of the sequential refold buffers decreases from about 3M Urea to ⁇ 0.001M or no urea.
  • the sequential refold buffers comprise Phosphate, NaCl, Glycerol, GSH, (Reduced Glutathione) and GSSG (Oxidized Glutathione)). In some embodiments, the refold buffers comprise about 50 mM Phosphate. In some embodiments, the refold buffers comprise an alkali earth metal salt. In some embodiments, alkali earth metal salt is a salt of sodium (Na), lithium (Li) or potassium (K). In some embodiments, the refold buffers comprise a sodium salt, such as NaCl. In some embodiments, the refold buffers comprise between about 100 mM to 2M concentration of an alkali earth metal salt.
  • the refold buffers comprise between about 200 mM to 1M concentration of an alkali earth metal salt. In some embodiments, the refold buffers comprise between about 500 mM to 1M concentration of an alkali earth metal salt. In some embodiments, the refold buffers comprise between about 100 mM to 2M concentration of NaCl. In some embodiments, the refold buffers comprise between about 200 mM to 1M concentration of NaCl. In some embodiments, the refold buffers comprise between about 200 mM to 800 mM concentration of NaCl. In particular embodiments, the refold buffers comprise about 200-500 mM NaCl. In some embodiments, the refold buffers comprise about 500 mM NaCl.
  • the refold buffers have an osmolarity between about 300 mOsm and 1000 mOsm. In some embodiments, the refold buffers comprise about 1 to 20% Glycerol. In some embodiments, the refold buffers comprise about 10% Glycerol. In some embodiments, the refold buffers comprise about 0.1 to 50 mM GSH, (Reduced Glutathione). In some embodiments, the refold buffers comprise about 5 mM GSH, (Reduced Glutathione). In some embodiments, the refold buffers comprise about 0.1 to 50 mM GSSG (Oxidized Glutathione)).
  • the refold buffers comprise about 1 mM GSSG (Oxidized Glutathione)). In exemplary embodiments, the refold buffers comprise 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione), and 1 mM GSSG (Oxidized Glutathione)). In some embodiments, the refold buffers have a pH value of between about 5.0 and 8.0. In some embodiments, the refold buffers have a pH value of 7.5.
  • the MYC-containing polypeptides are refolded using three TTF steps across a ultrafiltration/diafiltration (UFDF) membrane.
  • the first refold step involves an exchange of a refold buffer 1 (e.g., 3M Urea, 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)) over the course of about 120 minutes.
  • a refold buffer 1 e.g., 3M Urea, 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)
  • the second refold step involves the exchange of refold buffer 2 (1.5M Urea, 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)) over the course of approximately 120 minutes, followed by ⁇ 120 minutes of recirculation.
  • refold buffer 2 1.5M Urea, 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)
  • the third refold step involves the exchange of refold buffer 3 (50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)) over the course of approximately 120 minutes, followed by 12 hours of recirculation.
  • refold buffer 3 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)
  • the final refold solution can be filtered through a 0.2 ⁇ m membrane and protein concentration adjusted.
  • the nanoparticle formulation contains nanoparticles having a wide range of sizes and stabilities.
  • an incubation step, or equilibration step is performed after the third refold step.
  • the refolded MYC-containing polypeptides are maintained in the third refold buffer for a period of time sufficient to produce biologically active nanoparticles having a number average diameter of between about 80 nm and about 150 nm.
  • the equilibration step allows nanoparticle formulation to equilibrate into stable nanoparticles having narrower size range and more stability.
  • the number average diameter of these stable nanoparticles is between about 80 nm and about 150 nm.
  • the equilibration step is performed for a length of time of at least 5, 6, 7, 8, 9, 10, 11, or 12 hours or more. In exemplary embodiments, the equilibration is step is performed for at least or about 10-12 hours.
  • the equilibration is step involves gently stirring the nanoparticle formulation of refolded MYC-containing polypeptides in the third refold buffer. In exemplary embodiments, the equilibration is step involves stirring the formulation the MYC-containing polypeptides in the third refold buffer at less than 1000 rpm.
  • an additional exchange of final refold buffer 3 is performed to exchange the refold buffer with a formulation buffer suitable for administration, such as a buffer suitable for injection.
  • a formulation buffer suitable for administration such as a buffer suitable for injection.
  • refolded TAT-MYC in refold buffer 3 is dialyzed against a suitable formulation buffer.
  • the refolded TAT-MYC in refold buffer 3 is dialyzed using TFF across a ultrafiltration/diafiltration (UFDF) membrane.
  • the formulation buffer comprises a buffering agent.
  • the buffering agent is selected from among sodium phosphate, potassium phosphate, histidine, and citrate.
  • refolded TAT-MYC is stable in a formulation having a pH value of between 5.5 and 8.0. In exemplary embodiments, refolded TAT-MYC is stable in a formulation having a pH value of between 6.0 and 8.0. In exemplary embodiments, refolded TAT-MYC is stable in a formulation having a pH value of about 6.0, about 6.5, about 7.0, about 7.5, or about 8.0. In exemplary embodiments, refolded TAT-MYC is stable in a formulation having a pH value of about pH 7.5. In exemplary embodiments, refolded TAT-MYC is stable in a formulation of about pH 7.5+/ ⁇ pH 0.3.
  • the refolded TAT-MYC is stable in a formulation having an osmolality greater than 300 mOsm. In exemplary embodiments, the refolded TAT-MYC is stable in a formulation having an osmolality greater than 400 mOsm. In exemplary embodiments, the refolded TAT-MYC is stable in a formulation having an osmolality between 300 mOsm and 1000 mOsm, such as between 400 mOsm and 800 mOsm.
  • the refolded TAT-MYC is stable in a formulation comprising greater than 100 mM NaCl. In exemplary embodiments, the refolded TAT-MYC is stable in a formulation comprising greater than 150 mM NaCl. In exemplary embodiments, the NaCl concentration of a refolded TAT-MYC formulation is about 150 mM, 200 mM, 250 mM, 300 mM, 350 mM, 400 mM, 450 mM, 500 mM or 550 mM NaCl. In exemplary embodiments, the NaCl concentration of a refolded TAT-MYC formulation is about 500 mM +/ ⁇ 50 mM NaCl.
  • refolded TAT-MYC can be stored up to a concentration of about 1.2 mg/mL.
  • “stability” with reference to a storage condition refers the ability of the refolded TAT-MYC to retain at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more of its MYC biological activity following storage, compared to the MYC biological activity of the refolded TAT-MYC prior to storage.
  • refolded TAT-MYC is stable at ⁇ 80° C. for up to 2 years. In some embodiments, once thawed, refolded TAT-MYC is stable when stored at 4° C.
  • refolded TAT-MYC is stable when stored at 4° C. for up to 2 months. In exemplary embodiments, once thawed, refolded TAT-MYC is stable when stored at 4° C. for up to 3 months. In exemplary embodiments, once thawed, refolded TAT-MYC is stable when stored at 4° C. for up to 4 months. In exemplary embodiments, once thawed, refolded TAT-MYC is stable when stored at 4° C. for up to 5 months.
  • refolded TAT-MYC is stable when stored at 4° C. for up to 6 months or longer. In exemplary embodiments, once thawed, refolded TAT-MYC is stable when stored at 4° C. for up to 100 days or longer. Accordingly, the stability of the refolded TAT-MYC provided herein is significantly increased compared to the stability of a wild-type MYC polypeptide, which has a half-life of approximately 34 minutes (Kaptein et al. (1996) JBC 271, 18875-18884).
  • the size and mass of the nanoparticles of the present technology can be determined by methods well known in the art.
  • methods include size exclusion chromatography, high performance liquid chromatography, dynamic light scattering, nanoparticle tracking analysis, and electron microscopy.
  • the average particle size of the nanoparticles in the formulation is between about 70 nm and about 140 nm, such as between 70 nm and 140 nm. In some embodiments, the average particle size of the nanoparticles in the formulation is between about 80 nm and about 120 nm, such as between 80 nm and 120 nm. In some embodiments, the average particle size of the nanoparticles in the formulation is between about 80 nm and about 110 nm, such as between 80 nm and 110 nm. In some embodiments, the average particle size of the nanoparticles in the formulation is between about 80 nm and about 90 nm, such as between 80 nm and 90 nm.
  • the average particle size of the nanoparticles in the formulation is about 84 nm or 84 nm. In some embodiments, the average particle size of the nanoparticles in the formulation is between about 100 nm and about 120 nm, such as between 100 nm and 120 nm. In some embodiments, the average particle size of the nanoparticles in the formulation is about 111 nm or 111 nm.
  • the average molecular weight of the particles in the formulation is between about 10 3 -10 7 daltons, such as between 10 3 -10 7 daltons. In some embodiments, the average molecular weight of the particles in the formulation is between about 10 4 -10 7 daltons, such as between 10 4 -10 7 daltons. In some embodiments, the average molecular weight of the particles in the formulation is between about 10 5 -10 7 daltons, such as between 10 5 -10 7 daltons. In some embodiments, the average molecular weight of the particles in the formulation is between about 10 6 -10 7 daltons, such as between 10 6 -10 7 daltons. In some embodiments, the average molecular weight of the particles in the formulation is about 2 ⁇ 10 6 or 2 ⁇ 10 6 daltons.
  • less than about 0.01% or less than 0.01% of the nanoparticles within the composition have a particle size greater than 200 nm, greater than 300 nm, greater than 400 nm, greater than 500 nm, greater than 600 nm, greater than 700 nm, or greater than 800 nm. In some embodiments, less than about 0.001% of the nanoparticles within the composition have a particle size greater than 200 nm, greater than 300 nm, greater than 400 nm, greater than 500 nm, greater than 600 nm, greater than 700 nm, or greater than 800 nm.
  • less than about 0.01% or less than 0.01% of the nanoparticles within the composition have a particle size greater than 800 nm. In some embodiments, less than about 0.001% or less than 0.001% of the nanoparticles within the composition have a particle size greater than 800 nm.
  • less than about 0.01% or less than 0.01% of the nanoparticles within a formulation have a particle size less than 80 nm, less than 70 nm, less than 60 nm, less than 50 nm, less than 40 nm, less than 30 nm, less than 20 nm, or less than 10 nm. In some embodiments, less than about 0.001% or less than 0.001% of the nanoparticles within the composition have a particle size less than 80 nm, less than 70 nm, less than 60 nm, less than 50 nm, less than 40 nm, less than 30 nm, less than 20 nm, or less than 10 nm.
  • less than about 0.01% or less than 0.01% of the nanoparticles within the composition have a particle size less than 50 nm. In some embodiments, less than about 0.001% or less than 0.001% of the nanoparticles within the composition have a particle size less than 50 nm.
  • the biologically active nanoparticulate compositions of MYC-containing polypeptide comprise a MYC fusion protein.
  • the MYC fusion protein comprises a protein transduction domain, a MYC polypeptide that promotes one or more of cell survival or proliferation, and optionally a protein tag domain, e.g., one or more amino acid sequences that facilitate purification of the fusion protein.
  • a cell contacted with MYC polypeptide exhibits increased survival time (e.g., as compared to an identical or similar cell of the same type that was not contacted with MYC), and/or increased proliferation (e.g., as compared to an identical or similar cell of the same type that was not contacted with MYC).
  • the fusion protein comprises (a) a protein transduction domain; and (b) a MYC polypeptide sequence.
  • the fusion peptide is a peptide of Formula (I): protein transduction domain-MYC polypeptide sequence.
  • a fusion peptide disclosed herein comprises (a) a protein transduction domain; (b) a MYC polypeptide sequence; and (c) one or more molecules that link the protein transduction domain and the MYC polypeptide sequence.
  • the fusion peptide is a peptide of Formula (II): protein transduction domain-X-MYC polypeptide sequence, wherein -X- is molecule that links the protein transduction domain and the MYC polypeptide sequence.
  • -X- is at least one amino acid.
  • a fusion peptide disclosed herein comprises (a) a protein transduction domain; (b) a MYC polypeptide sequence; (c) at least two protein tags; and (d) optionally linker(s).
  • the fusion peptide is a peptide of Formula (III-VI): protein transduction domain-X-MYC polypeptide sequence-X-protein tag 1-X-protein tag 2 (Formula (III)), or protein transduction domain-MYC polypeptide sequence-X-protein tag 1-X-protein tag 2 (Formula (IV)), or protein transduction domain-MYC polypeptide sequence-protein tag 1-X-protein tag 2 (Formula (V)), or protein transduction domain-MYC polypeptide sequence-protein tag 1-protein tag 2 (Formula (VI)), wherein -X- is a linker.
  • -X- is one or more amino acids.
  • a fusion peptide disclosed herein comprises (a) a protein transduction domain; (b) a MYC polypeptide sequence; (c) a 6-histidine tag; (d) a V5 epitope tag: and (e) optionally linker(s).
  • the fusion peptide is a peptide of Formula (VII-XIV): protein transduction domain-X-MYC polypeptide sequence-X-6-histidine tag-X-V5 epitope tag (Formula (VII)), or protein transduction domain-MYC polypeptide sequence-X-6-histidine tag-X-V5 epitope tag (Formula (VIII)), or protein transduction domain-MYC polypeptide sequence-6-histidine tag-X-V5 epitope tag (Formula (IX)), or protein transduction domain-MYC polypeptide sequence-6-histidine tag-V5 epitope tag (Formula (X)), protein transduction domain-X-MYC polypeptide sequence-X-V5 epitope tag-X-6-histidine tag (Formula (XI)), or protein transduction domain-MYC polypeptide sequence-X-V5 epitope tag-X-6-histidine tag (Formula (XII)), or protein
  • the MYC fusion protein comprises one or more linker sequences.
  • the linker sequences can be employed to link the protein transduction domain, MYC polypeptide sequence, V5 epitope tag and/or 6-histidine tag of the fusion protein.
  • the linker comprises one or more amino acids.
  • the amino acid sequence of the linker comprises KGELNSKLE (SEQ ID NO: 11).
  • the linker comprises the amino acid sequence of RTG.
  • PTD Protein Transduction Domain
  • the MYC fusion protein includes a protein transduction domain.
  • Peptide transport provides an alternative for delivery of small molecules, proteins, or nucleic acids across the cell membrane to an intracellular compartment of a cell.
  • PTD protein transduction domain
  • One non-limiting example and well-characterized protein transduction domain (PTD) is a TAT-derived peptide. Frankel et al., (see, e.g., U.S. Pat. Nos. 5,804,604, 5,747,641, 5,674,980, 5,670,617, and U.S. Pat. No.
  • TAT protein transduction domain comprises an amino acid sequence of MRKKRRQRRR (SEQ ID NO: 7).
  • Penetratin can transport hydrophilic macromolecules across the cell membrane (Derossi et al., Trends Cell Biol., 8:84-87 (1998) incorporated herein by reference in its entirety). Penetratin is a 16 amino acid peptide that corresponds to amino acids 43-58 of the homeodomain of Antennapedia, a Drosophila transcription factor which is internalized by cells in culture.
  • VP22 a tegument protein from Herpes simplex virus type 1 (HSV-1), has the ability to transport proteins and nucleic acids across a cell membrane (Elliot et al., Cell 88:223-233, 1997, incorporated herein by reference in its entirety). Residues 267-300 of VP22 are necessary but may not be sufficient for transport. Because the region responsible for transport function has not been identified, the entire VP22 protein is commonly used to transport cargo proteins and nucleic acids across the cell membrane (Schwarze et al., Trends Pharmacol Sci, 21:45-48, 2000).
  • HSV-1 Herpes simplex virus type 1
  • the MYC fusion polypeptide includes a protein transduction domain.
  • the protein transduction domain comprises the protein transduction domain of one or more of TAT, penetratin, VP22, vpr, EPTD, R9, R15, VP16, and Antennapedia.
  • the protein transduction domain comprises the protein transduction domain of one or more of TAT, penetratin, VP22, vpr, and EPTD.
  • the protein transduction domain comprises the protein transduction domain of at least one of TAT, penetratin, VP22, vpr, EPTD, R9, R15, VP16, and Antennapedia.
  • the protein transduction domain comprises a synthetic protein transduction domain (e.g., polyarginine or PTD-5). In particular embodiments, the protein transduction domain comprises a TAT protein transduction domain. In some embodiments, the protein transduction domain is covalently linked to the MYC polypeptide. In some embodiments, the protein transduction domain is linked to the MYC polypeptide via a peptide bond. In some embodiments, the protein transduction domain is linked to the MYC polypeptide via a linker sequence. In some embodiments, the linker comprises a short amino acid sequence. By way of example, but not by way of limitation, in some embodiments, the linker sequences is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids in length.
  • the MYC fusion protein of the present technology can be arranged in any desired order.
  • the MYC fusion protein can be arranged in order of a) the protein transduction domain linked in frame to the MYC polypeptide, b) the MYC polypeptide linked in frame to the V5 domain, and c) the V5 domain linked in frame to the 6-histidine epitope tag.
  • the MYC fusion protein has an order of components of a) the MYC polypeptide linked in frame to the protein transduction domain, b) the protein transduction domain linked in frame to the V5 domain, and c) the V5 domain linked in frame to the 6-histidine epitope tag.
  • additional amino acid sequences can be included between each of the sequences.
  • additional amino acids can be included at the start and/or end of the polypeptide sequences.
  • the protein transduction domain is a TAT protein transduction domain. In some embodiments, the protein transduction domain is TAT [48-57] . In some embodiments, the protein transduction domain is TAT [57-48] .
  • the MYC fusion protein comprises a protein tag domain that comprises one or more amino acid sequences that facilitate purification of the fusion protein.
  • the protein tag domain comprises one or more of a polyhistidine tag, and an epitope tag.
  • exemplary tags include one or more of a V5, a histidine-tag (e.g., a 6-histidine tag), HA (hemagglutinin) tags, FLAG tag, CBP (calmodulin binding peptide), CYD (covalent yet dissociable NorpD peptide), Strepll, or HPC (heavy chain of protein C).
  • the protein tag domain comprise about 10 to 20 amino acids in length.
  • the protein tag domain comprises 2 to 40 amino acids in length, for example 6-20 amino acids in length.
  • two of the above listed tags are used together to form the protein tag domain.
  • the histidine tag is a 6-histidine tag. In some embodiments, the histidine tag comprises the sequence HHHHHH. In some embodiments, the fusion peptide disclosed herein comprises a V5 epitope tag. In some embodiments, the V5 tag comprises the amino acid sequence of: GKPIPNPLLGLDST. In some embodiments, the V5 tag comprises the amino acid sequence of IPNPLLGLD.
  • the protein tags may be added to the fusion protein disclosed herein by any suitable method.
  • a TAT-MYC polypeptide sequence is cloned into an expression vector encoding one or more protein tags, e.g., a polyHis-tag and/or a V5 tag.
  • a polyhistidine tag and/or a V5 tag is added by PCR (i.e., the PCR primers comprise a polyhistidine sequence and/or V5 sequence).
  • MYC fusion peptides (e.g., TAT-MYC fusion peptide) disclosed herein may be constructed by methods well known in the art.
  • a nucleotide sequence encoding a TAT-MYC fusion peptide may be generated by PCR.
  • a forward primer for a human MYC sequence comprises an in frame N-terminal 9-amino-acid sequence of the TAT protein transduction domain (e.g., RKKRRQRRR).
  • a reverse primer for a human MYC sequence is designed to remove the stop codon.
  • the PCR product is cloned into any suitable expression vector.
  • the expression vector comprises a polyhistidine tag and a V5 tag.
  • a fusion peptide disclosed herein comprises (a) TAT, and (b) c-MYC. In some embodiments, a fusion peptide disclosed herein comprises (a) TAT [48-57] , and (b) c-MYC. In some embodiments, a fusion peptide disclosed herein comprises (a) TAT [57-48] , and (b) c-MYC.
  • a fusion peptide disclosed herein comprises (a) TAT, (b) c-MYC, (c) linker(s), (d) V5 tag, and (e) 6-histidine tag.
  • a fusion peptide disclosed herein comprises (a) TAT [48-57] , (b) c-MYC, (c) linker(s), (d) V5 tag, and (e) 6-histidine tag.
  • a fusion peptide disclosed herein comprises (a) TAT [57-48] , (b) c-MYC, (c) linker(s), (d) V5 tag, and (e) 6-histidine tag.
  • the MYC portion of the MYC fusion peptide comprises any MYC polypeptide as described herein. In some embodiments, the MYC portion of the MYC fusion peptide comprises a MYC polypeptide sequence comprising the sequence shown below:
  • the MYC fusion peptide comprises SEQ ID NO: 1. In some embodiments, the MYC-fusion peptide is SEQ ID NO: 1.
  • the MYC portion of the MYC fusion peptide comprises a MYC polypeptide sequence comprising the sequence shown below:
  • the MYC fusion peptide comprises SEQ ID NO: 10; in some embodiments, the MYC-fusion peptide is SEQ ID NO: 10.
  • the fusion protein may be modified during or after synthesis to include one or more functional groups.
  • the protein may be modified to include one or more of an acetyl, phosphate, acetate, amide, alkyl, and/or methyl group. This list is not intended to be exhaustive, and is exemplary only.
  • the protein includes at least one acetyl group.
  • compositions of the present technology provide MYC activity, and are thus useful in vivo (e.g., as an adjuvant, immune system enhancer, etc.) and in vitro (e.g., to stimulate growth and proliferation of stem cells, such as hematopoietic stem cells (HSCs), to condition HSCs for enhanced engraftment following hematopoietic stem cell transplantation, induce or enhance activation, growth, proliferation, viability, or survival of an immune cell and/or enhance antibody production by an immune cell in culture, etc.).
  • stem cells such as hematopoietic stem cells (HSCs)
  • HSCs hematopoietic stem cells
  • MYC-containing nanoparticulate compositions of the present technology can be used to prime donor HSCs (e.g., the patient's isolated HSCs or third party donor's HSC) for transplantation, e.g., to patients with immune-related diseases or disorders such as, but not limited to severe combined immunodeficiency.
  • donor HSCs e.g., the patient's isolated HSCs or third party donor's HSC
  • immune-related diseases or disorders such as, but not limited to severe combined immunodeficiency.
  • SCID Severe combined immunodeficiency
  • HLA human leukocyte antigen
  • T-cell and B-cell depleted donor hematopoietic cells including hematopoietic stem and progenitor cells (HSPCs) are incubated ex vivo for one with the MYC-containing nanoparticulate compositions of the present technology (“primed”). Following incubation, the primed cells are washed and transplanted into the patient. Incubation of the donor cells with the compositions of the present technology increased proliferation of long-term self-renewing hematopoietic stem cells following transplantation.
  • HSPCs hematopoietic stem and progenitor cells
  • the donor hematopoietic cells are isolated from the patient. In some embodiments, the donor hematopoietic cells are incubated for 30 minutes, 60 minutes, 90 minutes or 120 minutes with the nanoparticulate MYC-containing compositions of the present technology. In some embodiments, the donor hematopoietic cells are incubated with 10 ⁇ g/ml, 20 ⁇ g/ml, 30 ⁇ g/ml, 40 ⁇ g/ml, 50 ⁇ g/ml, 60 ⁇ g/ml, 70 ⁇ g/ml, 80 ⁇ g/ml, 90 ⁇ g/ml, or 100 ⁇ g/ml of the nanoparticulate MYC-containing composition of the present technology.
  • cells are incubated with 50 ⁇ g/ml of a nanoparticulate MYC-containing compositions for 60 minutes.
  • the nanoparticles of the composition have an average particle size of between about 80 and 150 nm, between about 90 and 140 nm, between about 100 and 120 nm, or between about 100 and 110 nm, and comprise SEQ ID NO: 1.
  • the nanoparticles of the composition have an average particle size of between about 80 and 150 nm, between about 90 and 140 nm, between about 100 and 120 nm, or between about 100 and 110 nm, and comprise SEQ ID NO: 10.
  • pharmaceutical formulations including the nanoparticulate MYC-containing proteins described herein and optionally one or more additional therapeutic compounds and optionally, one or more pharmaceutically acceptable excipients are administered to an individual in any manner, including one or more of multiple administration routes, such as, by way of non-limiting example, oral, parenteral (e.g., intravenous, intraperitoneal, subcutaneous, intramuscular), intranasal, buccal, topical, rectal, or transdermal administration routes.
  • parenteral e.g., intravenous, intraperitoneal, subcutaneous, intramuscular
  • intranasal e.g., buccal, topical, rectal, or transdermal administration routes.
  • the pharmaceutical formulations described herein include, but are not limited to, aqueous liquid dispersions, self-emulsifying dispersions, solid solutions, liposomal dispersions, aerosols, solid dosage forms, powders, immediate release formulations, controlled release formulations, fast melt formulations, tablets, capsules, pills, delayed release formulations, extended release formulations, pulsatile release formulations, multiparticulate formulations, and mixed immediate and controlled release formulations.
  • a summary of pharmaceutical formulations is found, for example, in Remington: The Science and Practice of Pharmacy , Nineteenth Ed (Easton, Pa.: Mack Publishing Company, 1995); Hoover, John E., Remington is Pharmaceutical Sciences , Mack Publishing Co., Easton, Pa. 1975; Liberman, H. A. and Lachman, L., Eds., Pharmaceutical Dosage Forms, Marcel Decker, New York, N.Y., 1980; and Pharmaceutical Dosage Forms and Drug Delivery Systems , Seventh Ed. (Lippincott Williams & Wilkins 1999).
  • the nanoparticle formulations provided herein comprise a suitable buffer.
  • buffers include, but are not limited to Tris, sodium phosphate, potassium phosphate, histidine or citrate based buffers.
  • the formulations provided herein contain magnesium.
  • the formulations provided herein contain one or more surfactants.
  • surfactant can include a pharmaceutically acceptable excipient which is used to protect protein formulations against mechanical stresses like agitation and shearing.
  • Examples of pharmaceutically acceptable surfactants include polyoxyethylensorbitan fatty acid esters (Tween), polyoxyethylene alkyl ethers (Brij), alkylphenylpolyoxyethylene ethers (Triton-X), polyoxyethylene-polyoxypropylene copolymer (Poloxamer, Pluronic), and sodium dodecyl sulphate (SDS).
  • Suitable surfactants include polyoxyethylenesorbitan-fatty acid esters such as polysorbate 20, (sold under the trademark Tween 20®) and polysorbate 80 (sold under the trademark Tween 80®).
  • Suitable polyethylene-polypropylene copolymers are those sold under the names Pluronic® F68 or Poloxamer 188®.
  • Suitable Polyoxyethylene alkyl ethers are those sold under the trademark Brij®. Suitable alkylphenolpolyoxyethylene esthers are sold under the tradename Triton-X. When polysorbate 20 (Tween 20®) and polysorbate 80 (Tween 80®) are used they are generally used in a concentration range of about 0.001 to about 1%, of about 0.005 to about 0.2% and of about 0.01% to about 0.1% w/v (weight/volume).
  • the nanoparticle formulations provided herein comprise a stabilizer.
  • the term “stabilizer” can include a pharmaceutical acceptable excipient, which protects the active pharmaceutical ingredient and/or the formulation from chemical and/or physical degradation during manufacturing, storage and application. Chemical and physical degradation pathways of protein pharmaceuticals are reviewed by Cleland et al., Crit. Rev. Ther. Drug Carrier Syst., 70(4):307-77 (1993); Wang, Int. J. Pharm., 7S5(2): 129-88 (1999); Wang, Int. J. Pharm., 203(1-2): 1-60 (2000); and Chi et al, Pharm. Res., 20(9): 1325-36 (2003).
  • Stabilizers include but are not limited to sugars, amino acids, polyols, cyclodextrines, e.g., hydroxypropyl-beta-cyclodextrine, sulfobutylethyl-beta-cyclodextrin, beta-cyclodextrin, polyethylenglycols, e.g., PEG 3000, PEG 3350, PEG 4000, PEG 6000, albumin, human serum albumin (HSA), bovine serum albumin (BSA), salts, e.g., sodium chloride, magnesium chloride, calcium chloride, chelators, e.g., EDTA as hereafter defined.
  • stabilizers can be present in the formulation in an amount of about 10 to about 500 mM, an amount of about 10 to about 300 mM, or in an amount of about 100 mM to about 300 mM.
  • the daily dosages for a composition including fusion peptide nanoparticles described herein are from about 0.001 to 1000.0 mg/kg per body weight, such as about 0.01 to 100.0 mg/kg per body weight, such as about 0.1 to 10.0 mg/kg per body weight.
  • the foregoing range is merely suggestive, as the number of variables in regard to an individual treatment regime is large, and considerable excursions from these recommended values are not uncommon.
  • such dosages are optionally altered depending on a number of variables, not limited to the activity of the agent or composition described herein used, the disorder or condition to be treated, the mode of administration, the requirements of the individual subject, the severity of the disorder or condition being treated, and the judgment of the practitioner.
  • Toxicity and therapeutic efficacy of such therapeutic regimens are optionally determined in cell cultures or experimental animals, including, but not limited to, the determination of the LD 50 (the dose lethal to 50% of the population) and the ED 50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between the toxic and therapeutic effects is the therapeutic index, which is expressed as the ratio between LD 50 and ED 50 .
  • An agent or compositions described herein exhibiting high therapeutic indices is preferred.
  • the data obtained from cell culture assays and animal studies are optionally used in formulating a range of dosage for use in human.
  • the dosage of such an agent or composition described herein lies preferably within a range of circulating concentrations that include the ED 50 with minimal toxicity.
  • the dosage optionally varies within this range depending upon the dosage form employed and the route of administration utilized.
  • Plasmid pTAT-MYC-V5-6xHis was made by PCR amplification of the coding regions for human MYC using a forward primer that contains an in-frame N-terminal 10-amino-acid sequence of the TAT protein transduction domain of HIV-1 (MRKKRRQRRR (SEQ ID NO: 7), and a reverse primer that removes the stop codon.
  • the PCR product was cloned into pET101/D-Topo (Invitrogen) vector, which includes a C-terminal V5 epitope tag and 6-histidine protein tags.
  • BL-21 RARE cells were created by transforming BL-21 StarTM E. coli strain (Invitrogen) with pRARE (CamR), isolated from BL21 Rosetta cells (Novagen), that express tRNAs for AGG, AGA, AUA, CUA, CCC, GGA codons.
  • the cell paste was resuspended in 8M Urea, 50 mM Phosphate pH 7.5. The suspension was mixed at room temperature until homogenous. The suspension was then passed through a homogenizer. The homogenized suspension was then adjusted to include 200 mM Sodium Sulfite and 10 mM Sodium Tetrathionate. The solution was mixed at room temperature until homogeneous. The sulfonylated lysate was mixed at 2-8° C. for ⁇ 12 hours. The sulfonylated lysate was then centrifuged for an hour. The supernatant was collected and the pellet discarded. The supernatant was passed through a 0.22 ⁇ m membrane filter.
  • the sulfonylated TAT-MYC solution was purified by Ni affinity chromatography using Ni— resin.
  • the column was equilibrated in 6M Urea, 50 mM Phosphate, 500 mM NaCl, and 10% Glycerol solution.
  • the sulfonylated and clarified TAT-MYC was then loaded onto the column.
  • the column was washed with 6M Urea, 50 mM Phosphate, 10% Glycerol, 500 mM NaCl, pH 7.5.
  • the column was then washed with 6M Urea, 50 mM Phosphate, 10% Glycerol, and 2M NaCl, pH 7.5, followed another wash of 6M Urea, 50 mM Phosphate, 10% Glycerol, 50 mM NaCl, and 30 mM Imidazole, pH 7.5.
  • the product was eluted from the column by running elution buffer containing 6M Urea, 50 mM Phosphate, 10% Glycerol, and 50 mM NaCl, pH 7.5 with a gradient from 100 to 300 mM Imidazole and collecting fractions.
  • the protein containing fractions to be pooled was filtered through a 0.22 ⁇ m membrane and protein concentrations were measured using UV280.
  • the pooled fractions from the Ni-Sepharose chromatography step were further purified by anion exchange chromatography using Q-Sepharose resin.
  • the pool was prepared for loading onto the column by diluting to the conductivity of the Q sepharose buffer (17.52 +/ ⁇ 1 mS/cm) with the second wash buffer (6M Urea, 50 mM Phosphate, 10% Glycerol, 2M NaCl, pH 7.5) from the Ni Sepharose chromatography step.
  • the diluted pool was then loaded onto the column, followed by two chase steps using 6M Urea, 50 mM Phosphate, 300 mM NaCl, and 10% Glycerol, and further chase until the UV trace reached baseline.
  • Refolding of the TAT-MYC proteins in the Q-Sepharose flow-through pool from Example 1 was accomplished using tangential flow filtration-based refolding method using a UFDF (ultrafiltration/diafiltration) membrane.
  • the refolding process included a series of three refolding steps.
  • the first refolding step involved the exchange of refold buffer 1 (3M Urea, 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)) over the course of about 120 minutes.
  • the second refold step involved the exchange of refold buffer 2 (1.5M Urea, 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)) over the course of approximately 120 minutes, followed by ⁇ 120 minutes of recirculation.
  • refold buffer 2 1.5M Urea, 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)
  • the third refold step consisted of the exchange of refold buffer 3 (50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)) over the course of approximately 120 minutes, followed by 12 hours of recirculation.
  • refold buffer 3 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione)
  • the protein concentration of the TAT-MYC fusion of SEQ ID NO: 1 was measured by Bradford protein assay (Sigma) compared to a standard curve of bovine serum albumin.
  • Refolded TAT-MYC is sensitive to pH and was stable in a formulation of pH 7.5 +/ ⁇ pH 0.3. Refolded TAT-MYC is also sensitive to NaCl concentrations and was stable at about 500 mM +/ ⁇ 50 mM NaCl. Refolded TAT-MYC was also stable up to a concentration of 1.2 mg/mL. Refolded TAT-MYC is stable at ⁇ 80° C. for up to or about 2 years. Once thawed, it remains active when stored at 4° C. for up to or about a month.
  • TAT-MYC compositions were tested for activity as follows.
  • a spleen was harvested from a C57BL/6j (Jackson) mouse, and mechanically dissociated through wire mesh.
  • the red blood cells were removed, CD4 positive T cells were isolated using commercially available isolation process (Dynabead), and the T cells were activated with 1 ⁇ g/ml anti-CD3 and anti-CD28 antibody.
  • the cells were plated into a 48 well cluster dish at 1.5 ⁇ 10 6 cells per well in 1 ml of media. 24 hours later, the TAT-MYC formulation was added to the cells (a total of 12 ⁇ g per well) and incubated for 24 hours. 24 hours after adding the protein, the media was replaced and the cells were incubated for 48 hr. Cells were assessed for viability at 96 hours after the initial activation via flow cytometry (forward x side scatter). Results for C2A (prepared according to Example 2) are shown in FIG. 1 .
  • FIG. 1A shows the proliferation of untreated, activated T-cells (12.8).
  • FIG. 1B shows the proliferation of activated T-cells treated with 6 ⁇ g of TAT-MYC formulation C2A for 24 hours. As shown, proliferation of T-cells more than doubles with C2A treatment.
  • an active preparation, composition, formulation, or fraction of TAT-MYC is one that provides at least a 2-fold increase in T-cell proliferation as compared to control T-cells.
  • compositions of nanoparticulate TAT-MYC protein prepared as described in Example 2 and tested for biological activity as described in Example 3, were characterized using several diverse techniques to demonstrate that (a) TAT-MYC protein prepared by the methods of the present technology surprisingly and unexpectedly forms nanoparticles having a discreet size range; (b) only a sub-fraction of the nanoparticles within this range are biologically active, e.g., have MYC activity; and (c) activity is linked to both particle size and one or more post-translational modifications.
  • F01 and F02 Two different preparations of TAT-MYC protein, termed F01 and F02, were evaluated by Asymmetrical Flow Field-flow Fractionation (AF4) and Multi-Angle Laser Light Scattering (MALLS) at two different temperatures to provide information on mass and size distribution of all components in the sample.
  • F01 was refolded according to Example 2.
  • F02 was prepared as discussed below. The AF4-MALLS analysis illustrated that F01 includes primarily a single population of particles having a discreet size range, and that particle size is stable over time and at varying temperature.
  • F01 was prepared according to the methods of Example 2.
  • F02 was prepared as described in Example 1B. After the refold, F02 was moved for the F01 formulation, 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione), pH 7.5, to the final formulation of 50 mM Phosphate, 250 mM NaCl, 10% Glycerol, pH 7.0.
  • FIG. 2A shows the results for F01.
  • Four different samples are shown in FIG. 2A : 2 F01 samples that were run at 25° C. and 2 F01 samples that were run at 5° C. are presented.
  • a single primary peak of nearly identical relative scale is seen at about 24 to about 32 minutes for all samples at both temperatures. This is indicative of a composition comprising a stable population of particles of discreet size.
  • FIG. 2B provides results for F02. Again, four different samples are shown: 2 F02 samples run at 25° C. and 2 F02 samples run at 5° C. In contrast to the F01 results, several peaks were identified at various time points, all differing in relative scale. For peaks appearing between 10 and 20 minutes, the top trace and the third trace represent results from the samples run at 25° C.; the second and fourth trace represent the samples run at 5° C. For peaks appearing between 24 minutes and 32 minutes, the top three traces include both 5° C. samples and one of the 25° C. samples, while the lowest trace in this time frame represents the second sample run at 25° C. The peaks at the 40-minute time point show one of the 5° C. samples as the lowest trace, with the remaining three sample traces above.
  • formulations of the present technology comprise stable, TAT-MYC particles of discreet size, and have biological function.
  • TAT-MYC protein is linked to nanoparticles of discreet size
  • two functional preparations (termed “C12” and “C13”), and one non-functional preparation (“R147”), were characterized via size exclusion chromatography followed by high performance liquid chromatography as follows.
  • SEC-HPLC allows for high resolution of particle size distribution and shows two distinct peaks at about 13 and 16 minutes. While the peak at 13 minutes had active particles, the peak at 24 minutes includes active particles. Note that the peaks observed at 22-24 min are a result of excipients in the refold buffer.
  • MALS SEC-multi-angle static light scattering
  • FIG. 4A is a graph showing refractive index (hatched lines) and molecular weight (solid lines) of sample C2A formulated in 50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione), 250 mM Arg, pH 7.5.
  • FIG. 4B is the SEC trace of C2A showing relative signal of C2A refold buffer with glutathione, but no Arg (Active Sample 1), and refold buffer with Arg, but no glutathione (Active Sample 2).
  • Results shown in FIG. 4A and 4B confirm that the majority of active particles have a molecular mass of about 10 7 -10 9 daltons (see fraction at retention volume of about 12.5 mL).
  • Biologically active formulation C2A and three additional preparations, C12, C13 (both active), and R149 (inactive) assayed to determine particle size were made according to the procedures outline in Example 2. R149 was generated during a run similar to C12 and C13, but the TFF refold steps were replaced by dialysis that was conducted over a period of 6 hours. Functional C2A was made according to the procedures outline in 0080-0082, but the final formulation buffer included 250 mM Arg.
  • DLS Dynamic Light Scattering
  • D h k B ⁇ T 3 ⁇ ⁇ ⁇ ⁇ ⁇ ⁇ ⁇ ⁇ D
  • D h hydrodynamic diameter
  • k B Boltzmann's constant
  • ⁇ dynamic viscosity
  • D translational diffusion coefficient
  • T thermodynamic temperature
  • Samples and standards were analyzed on a Malvern Zetasizer Nano (s). Test samples and controls were diluted in formulation buffer to a concentration of 0.5 mg/mL prior to analysis. Samples were analyzed and sizing evaluated by intensity, number counts, and volume distribution. The reported value for the analysis was obtained from the intensity Z-Ave (d.nm) value.
  • FIGS. 5A-5D Results are shown in FIGS. 5A-5D .
  • FIG. 5A shows the DLS trace for C2A; the average particle size (diameter) was 106.2 nm.
  • FIGS. 5B-5D show DLS trace data for preparations R149 (inactive), C12 (active) and C13 (active) respectively.
  • the inactive preparation has an average particle size of 63 nm, while preparations C12 and C13 have average particle sizes of 106 and 103 nm, respectively.
  • Nanoparticle Tracking Analysis is a method for visualizing and analyzing particles in liquids that relates the rate of Brownian motion to particle size. The rate of movement is related only to the viscosity and temperature of the liquid; it is not influenced by particle density or refractive index. NTA allows the determination of a size distribution profile of small particles with a diameter of approximately 10-1000 nanometers (nm) in liquid suspension.
  • Nanoparticle size and concentrations were measured by nanoparticle tracking analysis (NTA) with a NS300 instrument (Malvern, Worchester, UK) equipped with a 488-nm laser and NTA 2.3 software. Before data acquisition, the sample was diluted 1:200-1:400 in a final volume of 400 ⁇ L and was loaded into the flow cell. Video was captured at room temperature for 60 s. The lower size detection limit was automatically set by the software.
  • NTA nanoparticle tracking analysis
  • Results are shown in FIGS. 6A and 6B .
  • NTA analysis was performed in triplicate with the active C2A preparation.
  • FIG. 6A indicates that the majority of particles in the sample are about 100 nm in size.
  • FIG. 6B shows the averaged concentration and size. A statistical breakdown of particle size in the sample is provided in the table below.
  • TAT-MYC nanoparticle formulation Fifty-microliter drops of TAT-MYC nanoparticle formulation were spotted onto parafilm and then absorbed to glow-discharged, carbon- and formvar-coated copper transmission electron microscopy (TEM) grids (G400 copper; EM Science). Grids were blotted dry on Kimwipe (Kimberly-Clark), followed by staining with uranyl acetate (2% [wt/vol]) and TEM (Philips CM10) at 80 kV. The particles were observed at ⁇ 4,800 magnification.
  • TEM transmission electron microscopy
  • FIG. 7 shows discreet particles in the 100 nm size range (dark balls). The particles are uniform in shape, and while some variation in size was noted in the micrograph, the data in sections B-E confirm that the size range of active particles is in agreement with those shown in the micrograph.
  • Peptide mapping also known as peptide fingerprinting, is a technique of forming two-dimensional patterns of peptides (on paper or gel) by partial hydrolysis of a protein followed by electrophoresis and chromatography.
  • the peptide pattern (or fingerprint) produced is characteristic for a particular protein and the technique can be used to separate a mixture of peptides.
  • TAT-MYC formulations were digested with endoprotease AspN.
  • R147 was generated during a run were the TFF refold steps were accelerated to investigate the necessity to have the refold steps take 120 min, 120 min and 14 hours as detailed under Example 2. Instead, the entire refold was achieved in 60 min.
  • Example 3 T-cell assay was made according to the procedures outlined in Example 1B, but rather then adjusting the salt and conductivity of the Q load for a flow through, this Q column was run as a bind and then eluted over a salt gradient. None of these samples showed biological activity in the Example 3 T-cell assay.
  • Protein digests were performed as follows. TAT-MYC was denatured by guanidine hydrochloride, reduced by TCEP (Tris 2-carboxyethyl phosphine), alkylated by iodoacetamide, and digested by endoproteinase Asp-N, which cleaves at the N-terminal of the aspartic acid residues. The resulting peptides were separated by reversed phase HPLC and monitored with 215 nm absorbance. Peptide identity in the peak elution profile was established by mass spectrometry. For routine protein analysis, identity may be established by visual comparison of the peak profiles in the UV-chromatogram of the sample to a reference sample.
  • Protein fragments were analyzed by HPLC. Results are shown in FIG. 8 .
  • the top three traces of FIG. 8 represent the biologically active samples.
  • the bottom three traces represent the inactive samples.
  • the primary, secondary, tertiary and quaternary structures of MYC-containing nanoparticle formulations were evaluated using an array of biochemical, biophysical and functional characterization techniques as outlined in the table below using standard techniques.
  • Nanoparticle formulation C13 was used for the majority of characterization analyses presented in this example. In some cases, data from an alternate nanoparticle formulation (either C2B or C14) is presented herein. Nanoparticle formulation C14 was also produced at a similar manufacturing scale according to essentially the same process as was utilized for nanoparticle formulation C13.
  • the myc-containing nanoparticle formulations were analyzed as described in the chart above with the addition of mass spectrometry with Electrospray Ionization (ESI) with a Time of Flight (TOF) analyzer. Because there was no UV detection during the MS run, a visual alignment of the MS Total Ion Chromatogram (TIC) and the UV chromatogram was performed to assign the observed mass to the respective UV peaks.
  • EI Electrospray Ionization
  • TOF Time of Flight
  • FIG. 9 shows a representative peptide map for MYC peptides with peptide peaks identified. The assignment of peptides for each peak is provided in the table below.
  • a reversed phase HPLC (RP-HPLC) method was employed for the quantitation of post translational modifications and product related impurities.
  • the test sample was diluted in denaturing buffer (7.5 M Guanidine HCl, 0.0625M TrisHCl pH 7.3) and separated using an Agilent AdvanceBio RP-mAb C4 column (2.1 ⁇ 150 mm, Solid core beads 3.5 ⁇ m, 450 ⁇ ).
  • the column was equilibrated at a temperature of 50° C. Elution was achieved by applying a flow rate of 0.5 mL/min and a linear gradient of 0.1% TFA (w/v) in 100% H 2 O (Eluent A) and 0.1% (w/v) TFA in 100% ACN (Eluent B) as shown in the table below. Detection was performed at 280 nm.
  • nanoparticle formulation C13 was evaluated using Circular Dichroism spectroscopy (CD) in both the “far-UV” spectral region (190-250 nm) and the “near-UV” spectral region (250-350 nm).
  • CD Circular Dichroism spectroscopy
  • the chromophore is the peptide bond and the signal arises when it is located in a regular, folded environment.
  • the near UV region can be sensitive to certain aspects of tertiary structure.
  • the chromophores are the aromatic amino acids and disulfide bonds, and the CD signals they produce are sensitive to the overall tertiary structure of the protein.
  • Nanoparticle formulation C13 was diluted to an absorbance of 0.75 AU at 280 nm for near UV, and 1.1 AU at 195 nm for far UV. Glutathione has a significant impact of sample absorbance in the UV. Thus, to increase the signal contribution from the protein, samples were buffer exchanged into reduced glutathione and glutathione free buffers. Testing parameters for the samples are shown in table below.
  • FTIR Fourier transform infrared spectroscopy
  • the resulting FTIR spectrum was buffer subtracted and min-max normalized across 1600 to 1700 cm ⁇ 1 .
  • Nine-point smoothing was applied to minimize white noise for the determination of the second derivative.
  • a quantitative analysis of spectral similarity was performed using the weighted spectral difference (WSD) algorithm.
  • Nanoparticle formulation C14 showed a significant beta structure, both sheet and turn.
  • the peak around 1649-1655 is random coil.
  • SV-AUC sedimentation velocity analytical ultracentrifugation
  • SV-AUC was performed using a Beckman-Coulter XLI, using absorbance optics. The samples required no additional preparation prior to analysis. The testing parameters are shown in the table below. Data analysis was performed using SEDFIT 15.01b using parameters as shown in the table below. AUC data are illustrated in FIG. 14 .
  • Nanoparticle formulation C13 demonstrated a large molecular weight distribution. Approximate molecular weights were determined using known buffer properties. The distribution began sharply at ⁇ 4 MDa (20.6 S) and had an apex at ⁇ 10MDa (40 S). The main population distribution extended out to ⁇ 120MDa (185 S). Low quantities of larger species extended beyond 400 S, however these species are below the limit of quantitation of the method and cannot be accurately quantified.
  • Nanoparticle formulation C13 was analyzed by denaturing size exclusion chromatography-HPLC (dSEC-HPLC). The samples were run under denaturing conditions, both reducing and non-reducing conditions utilizing a TSKgel G3000SWx1; 5 ⁇ m; A Stainless Steel 7.8 mm ⁇ 30 cm column was used to achieve size-based separation of monomer from larger molecular weight species within the sample.
  • Detection for both reducing and non-reducing conditions was performed using fluorescence for quantitation of peaks.
  • An evaluation of size distribution across peaks was achieved using multi-angle laser light scattering (MALLS).
  • the resulting chromatograms for SEC-HPLC analysis of nanoparticle formulation C13 are shown in FIG. 15 .
  • the overlaid traces on each chromatogram represent testing that was performed approximately 1 month apart for samples stored at 2-8° C., demonstrating the ability of the method to pick up changes upon storage at accelerated temperature.
  • Electron microscopy was performed for the collection of images of the three dimensional structure of nanoparticle formulation C2B.
  • a fifty-microliter drop of the nanoparticle formulation (100 ug/mL) was spotted onto parafilm and then absorbed to glow-discharged, carbon- and formvar-coated copper transmission electron microscopy (TEM) grids (G400 copper; EM Science). Grids were blotted dry on Kimwipe (Kimberly-Clark), followed by staining with uranyl acetate (2% [wt/vol]) and TEM (Philips CM10) at 80 kV. The number 100-nm particles were imaged at ⁇ 4,800 magnification. The resulting images confirm a highly ordered complex of self-assembling spheres, as shown in FIG. 7 .
  • TAT-MYC fusion protein having the sequence set forth in SEQ ID NO: 1 is a fusion protein that combines the protein transduction domain (PTD) of HIV-1 TAT fused in frame to the wild-type human MYC protein (c-MYC), followed by two tags: V5 and 6xHis.
  • TAT-3AMYC is identical to TAT-MYC, except that it contains 3 amino acid substitutions: T358A, S373A, and T400A.
  • TAT-MYC and TAT-3AMYC proteins were prepared as described above in Examples 1 and 2.
  • the fusion proteins were solubilized under denaturing conditions and then refolded into a final formulation containing salts, glycerol and reducing agent (i.e.50 mM Phosphate, 500 mM NaCl, 10% Glycerol, 5 mM GSH, (Reduced Glutathione) 1 mM GSSG (Oxidized Glutathione).
  • the nanoparticle formulations comprising TAT-MYC and TAT-3AMYC were then analyzed for their molecular weight profiles using size exclusion chromatography HPLC (SEC-HPLC). Size variants were separated with an isocratic mobile phase (4M GdnHCl, 10 mM NaOAc, pH 4.65) over a size exclusion column and were monitored on a Diode Array Detector with ultraviolet (UV) detection at 280 nM. The parameters used were as follows: Flow rate: 0.75 mL/min; Maximum pressure limit: 70.0 bar; Run time: 30 minutes; Injection Volume: 20 ⁇ L).
  • FIG. 16A shows the chromatogram of the TAT-MYC protein preparation.
  • the protein complex elutes between minutes 6 and 7. Smaller protein multimers and excipient peaks can be seen eluting between minutes 8 and 15.
  • FIG. 16B shows the chromatogram of TAT-3AMYC compared to the TAT-MYC protein preparation.
  • the TAT-3AMYC has significantly less protein complex that elutes between minutes 6 and 7.
  • the bulk of the protein preparation was comprised of smaller protein multimers and excipient peaks can be seen eluting between minute 8 and 17. This indicates that mutation of T358, 5373, and T400 to alanine are sufficient to disrupt the formation of the nanoparticle complex that elutes between minute 6 and 7 on an SEC column.
  • TAT-MYC and TAT-3AMYC fusion proteins were also assessed for potency by testing their ability to rescue activated CD4+ T-cells from apoptosis, retain a blasting phenotype, and continue to proliferate after the antigenic stimulation.
  • T cells were for the assay were obtained by harvesting Spleen and Lymph Nodes from mice. The spleen and lymph nodes were ground through the mesh screen to generate a single cell suspension in C10 culture media. The cells were transferred to a conical tube and pelleted by centrifugation at 1200 RPM for 5 min.
  • the cells were resuspended in 5 ml sterile TAC buffer (135 mM NH 4 Cl, 17 mM Tris pH 7.65) and allowed to sit in TAC buffer for 1-2 min to lyse the red blood cells. The cells were centrifuged at 1200 RPM for 5 min, washed with 10 mls of C10 media, and resuspended in 4 ml C10 medium.
  • T cells were isolated from the resuspended RBC-depleted cell mixture using anti-CD4 Dynabeads according to the manufacturer's instructions (Invitrogen Cat #11445D). Briefly, 4 ml of the resuspended cell pellet was added to a snap cap tube with 50 ⁇ l washed CD4 Dynabeads ( ⁇ 4) and incubated for 1 hour at 4° C. on a 360° Nutator. After incubating, the tubes were placed on a Dynal magnet, allowing two minutes for beads and cells to collect on the side of the tube. The supernatants (CD4 negative cells) were removed. The beads and bound cells were resuspended in 4 ml C10 media, and placed back on magnet to allow for separation.
  • the pooled isolated CD4+ cells were centrifuged at 1200 rpms for 5 minutes. The supernatant was removed and the cells were resuspended in 20 ml (5 ml/mouse) at approximately 1.5 ⁇ 10 6 cells/ml. 20 ul commercial anti-CD3 (eBiosciences Cat #16-0031-86) and 20 ul anti-CD28 antibody (clone 37N1) at 1 ul/ml were added to the tube to activate the T cells and the cells were seeded in 20 wells of 24 well dish, 1 ml of media per well and incubated 72 hr at 36° C.
  • 20 ul commercial anti-CD3 eBiosciences Cat #16-0031-86
  • 20 ul anti-CD28 antibody clone 37N1
  • the media and the cells were removed from each well from 24 well dish using media to wash cells from the bottom of each well.
  • the cells were pelleted at 1200 rpms for five minutes, resuspended in 5 ml C10 medium and transferred to 15 ml conical tube.
  • the cells were underlayed with 5 ml Ficoll-Paque and spun at 1200 rpms, five minutes.
  • the buffy coat was removed using a 4 ml glass pipette and transferred to a new 15 ml conical tube. 10 ml of C10 media was added to wash cells.
  • FIG. 17 shows a graphical representation of an activated T-cell potency assay evaluating the ability of TAT-MYC and TAT-3AMYC to rescue activated T-cell from apoptosis that follows cytokine withdrawal.
  • TAT-MYC showed a 3 fold increase in the live T-cell population after cytokine withdrawal compared to no treatment (NT).
  • TAT-3AMYC showed no increase the live population T-cell population compared to no treatment (NT). This result was in line with the chromatography data, which showed that the majority of the TAT-3AMYC does not form a complex like TAT-MYC as shown in FIG. 16B .
  • TAT-MYC forms a nanoparticle complex that can be measured by SEC-HPLC and elutes between minute 6 and 7.
  • TAT-3AMYC does not form the same nanoparticle complex as TAT-MYC. Mutation of T358, 5373, and T400 to alanine was sufficient to disrupt the formation of the complex that elutes between minutes 6 and 7 on an SEC column. Further, the function of TAT-MYC observed in a T-cell potency assay appears to correlate with formation of this complex.
  • Plasmid pTAT-MYC (Green Monkey)-V5-6xHis was made by PCR amplification of the coding regions for C. sabaeus (green monkey) MYC and replacing the nucleic acid encoding human MYC sequence in the human TAT-MYC vector of Example 1 with a portion of the green monkey MYC sequence encoding SEQ ID NO: 8, which differs from the human MYC sequence by two amino acids. Protein production and purification were performed as described in Example 1. Preparation of nanoparticulate TAT-MYC composition was performed as described in Example 2.
  • the refolded nanoparticulate compositions were assessed for nanoparticle size distribution by Dynamic Light Scattering (DLS) technique as described in Example 4(B)(3). Results are shown in FIG. 18 , which shows the DLS traces for the Green Monkey TAT-MYC nanoparticulate compositions.
  • the average particle size (diameter) for the Green Monkey TAT-MYC was about 80 nm.
  • a reversed phase HPLC (RP-HPLC) method was employed for the quantitation of post translational modifications and product related impurities in the Green Monkey TAT-MYC nanoparticulate composition.
  • the test sample was diluted in denaturing buffer (7.5 M Guanidine HCl, 0.0625M TrisHCl pH 7.3) to 1 mg/ml.
  • 2 ⁇ l of 0.5M TCEP ((tris(2-carboxyethyl)phosphine) was added to the sample, incubated at 37° C. for 30 minutes, then cooled to 2-8° C.
  • the sample was stored at 2-8° C. for up to 5 days prior to analysis.
  • the sample 50 ⁇ l ( ⁇ 5 ⁇ g) was separated using an Agilent AdvanceBio RP-mAb C4 column (2.1 ⁇ 150 mm, Solid core beads 3.5 ⁇ m, 450 ⁇ ). The column was equilibrated at a temperature of 50° C. Elution was achieved by applying a flow rate of 0.5 mL/min and a linear gradient of 0.1% TFA (w/v) in 100% H 2 O (Eluent A) and 0.1% (w/v) TFA in 100% ACN (Eluent B) as shown in the table below. Detection was performed at 215 nm. Results for the Green Monkey TAT-MYC nanoparticulate composition compared to a reference human TAT-MYC nanoparticulate composition are shown in FIG. 19 .
  • the Green Monkey TAT-MYC nanoparticulate compositions were also characterized via size exclusion chromatography followed by high performance liquid chromatography.
  • the samples were run under denaturing, non-reducing conditions utilizing a TSKgel G3000SWx1; 5 ⁇ m; A Stainless Steel 7.8 mm ⁇ 30 cm column to achieve size-based separation of monomer from larger molecular weight species within the sample. Elution was achieved using 4M Gdn HCl, 0.1M Sodium Acetate pH 4.65 as the mobile phase in an isocratic configuration. Samples were diluted 1/10 in mobile phase and vortexed for 10 seconds to mix. The samples were then incubated at 37° C. for 30 minutes before placing into the autosampler at 4° C.
  • the Green Monkey TAT-MYC nanoparticulate compositions and reference human TAT-MYC nanoparticulate compositions were also assessed for potency by testing their ability to rescue activated CD4+ T-cells from apoptosis, retain a blasting phenotype, and continue to proliferate after the antigenic stimulation.
  • the compositions were assayed for biological activity according to the potency assay described in Example 6.
  • FIG. 21 shows a graphical representation of an activated T-cell potency assay evaluating the ability of Green Monkey TAT-MYC and human TAT-MYC at various doses to increase the amount of activated T-cells having a blasting phenotype relative no treatment control.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Cell Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Epidemiology (AREA)
  • Toxicology (AREA)
  • Hematology (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Virology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Oncology (AREA)
  • Nanotechnology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Mycology (AREA)
  • Physics & Mathematics (AREA)
  • Optics & Photonics (AREA)
  • Marine Sciences & Fisheries (AREA)
US15/828,971 2016-12-02 2017-12-01 Nanoparticle formulations Active - Reinstated 2037-12-28 US10583156B2 (en)

Priority Applications (3)

Application Number Priority Date Filing Date Title
US15/828,971 US10583156B2 (en) 2016-12-02 2017-12-01 Nanoparticle formulations
US16/742,082 US11116796B2 (en) 2016-12-02 2020-01-14 Nanoparticle formulations
US17/386,437 US20220096545A1 (en) 2016-12-02 2021-07-27 Nanoparticle formulations

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662429466P 2016-12-02 2016-12-02
US15/828,971 US10583156B2 (en) 2016-12-02 2017-12-01 Nanoparticle formulations

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/742,082 Division US11116796B2 (en) 2016-12-02 2020-01-14 Nanoparticle formulations

Publications (2)

Publication Number Publication Date
US20180153939A1 US20180153939A1 (en) 2018-06-07
US10583156B2 true US10583156B2 (en) 2020-03-10

Family

ID=62240149

Family Applications (3)

Application Number Title Priority Date Filing Date
US15/828,971 Active - Reinstated 2037-12-28 US10583156B2 (en) 2016-12-02 2017-12-01 Nanoparticle formulations
US16/742,082 Active US11116796B2 (en) 2016-12-02 2020-01-14 Nanoparticle formulations
US17/386,437 Pending US20220096545A1 (en) 2016-12-02 2021-07-27 Nanoparticle formulations

Family Applications After (2)

Application Number Title Priority Date Filing Date
US16/742,082 Active US11116796B2 (en) 2016-12-02 2020-01-14 Nanoparticle formulations
US17/386,437 Pending US20220096545A1 (en) 2016-12-02 2021-07-27 Nanoparticle formulations

Country Status (9)

Country Link
US (3) US10583156B2 (ja)
EP (2) EP4242298A2 (ja)
JP (3) JP6799683B2 (ja)
KR (1) KR20190092472A (ja)
CN (3) CN113786476A (ja)
AU (2) AU2017367730A1 (ja)
CA (1) CA3045017A1 (ja)
IL (3) IL293611A (ja)
WO (1) WO2018102678A1 (ja)

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10149898B2 (en) * 2017-08-03 2018-12-11 Taiga Biotechnologies, Inc. Methods and compositions for the treatment of melanoma
WO2020210231A1 (en) * 2019-04-08 2020-10-15 Taiga Biotechnologies, Inc. Compositions and methods for the cry opreservation of immune cells
CN111621481B (zh) * 2020-05-06 2021-06-04 广州医科大学附属第一医院（广州呼吸中心） 呼吸道病毒处理试剂及其应用
CN111631296B (zh) * 2020-05-08 2023-08-11 天津科技大学 一种以铁蛋白和橙皮素为原料构建食品功能因子传递系统的方法和应用

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0036776A2 (en) 1980-03-24 1981-09-30 Genentech, Inc. A method of creating an expression plasmid
US5652122A (en) 1989-12-21 1997-07-29 Frankel; Alan Nucleic acids encoding and methods of making tat-derived transport polypeptides
US5804604A (en) 1989-12-21 1998-09-08 Biogen, Inc. Tat-derived transport polypeptides and fusion proteins
US20140109246A1 (en) * 2012-09-24 2014-04-17 The Regents Of The University Of Colorado, A Body Corporate Methods of generating xenochimaeric mice with tumor and hematopoietic system from the same heterologous species
US20140356392A1 (en) 2008-08-28 2014-12-04 Taiga Biotechnologies, Inc. Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc
US20150164950A1 (en) 2012-07-20 2015-06-18 Taiga Biotechnologies, Inc. Enhanced reconstitution and autoreconstitution of the hematopoietic compartment
WO2016105542A2 (en) 2014-12-24 2016-06-30 Neximmune, Inc Nanoparticle compositions and methods for immunotherapy

Family Cites Families (132)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1986003780A1 (en) 1984-12-21 1986-07-03 Techniclone Research Partners I Method for electrically immortalizing lymphoid cells
DE3531430A1 (de) 1985-09-03 1987-03-05 Biotest Pharma Gmbh Verfahren zur gewinnung von komponenten aus einer fluessigkeit mit in raeumlich getrennten bereichen vorliegenden komponenten
US4963489A (en) 1987-04-14 1990-10-16 Marrow-Tech, Inc. Three-dimensional cell and tissue culture system
US4900322A (en) 1986-09-22 1990-02-13 Adams James D Blood component pooling valve and kit
US5476996A (en) 1988-06-14 1995-12-19 Lidak Pharmaceuticals Human immune system in non-human animal
US5399493A (en) 1989-06-15 1995-03-21 The Regents Of The University Of Michigan Methods and compositions for the optimization of human hematopoietic progenitor cell cultures
US5849288A (en) 1990-01-15 1998-12-15 Yeda Research And Development Co. Ltd. Method for production of monoclonal antibodies in chimeric mice or rats having xenogeneic antibody-producing cells
US6255458B1 (en) 1990-08-29 2001-07-03 Genpharm International High affinity human antibodies and human antibodies against digoxin
US5851828A (en) 1991-03-07 1998-12-22 The General Hospital Corporation Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells
US5843728A (en) 1991-03-07 1998-12-01 The General Hospital Corporation Redirection of cellular immunity by receptor chimeras
US6004811A (en) 1991-03-07 1999-12-21 The Massachussetts General Hospital Redirection of cellular immunity by protein tyrosine kinase chimeras
US6753162B1 (en) 1991-03-07 2004-06-22 The General Hospital Corporation Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells
IL101147A (en) 1991-03-07 2004-06-20 Gen Hospital Corp Change of direction of cellular immunity by chimera receptors
US5912170A (en) 1991-03-07 1999-06-15 The General Hospital Corporation Redirection of cellular immunity by protein-tyrosine kinase chimeras
AU781922B2 (en) 1991-12-17 2005-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5289858A (en) 1991-12-18 1994-03-01 Abbott Laboratories System for accommodating withdrawal of liquid from a bulk supply
US8211422B2 (en) 1992-03-18 2012-07-03 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Chimeric receptor genes and cells transformed therewith
CA2135642C (en) 1992-08-21 1999-12-14 James G. Barsoum Tat-derived transport polypeptides
US5580760A (en) 1993-02-22 1996-12-03 The United States Of America As Represented By The Department Of Health And Human Services FUSE binding protein and cDNA therefor
WO1995003402A1 (en) 1993-07-22 1995-02-02 Merck & Co., Inc. EXPRESSION OF HUMAN INTERLEUKIN-1β IN A TRANSGENIC ANIMAL
US5599705A (en) 1993-11-16 1997-02-04 Cameron; Robert B. In vitro method for producing differentiated universally compatible mature human blood cells
US6165747A (en) * 1993-12-30 2000-12-26 President & Fellows Of Harvard College Nucleic acids encoding hedgehog proteins
WO1995023512A1 (en) 1994-03-03 1995-09-08 Alexion Pharmaceuticals, Inc. Terminal complement inhibitor fusion genes and proteins
US5827642A (en) 1994-08-31 1998-10-27 Fred Hutchinson Cancer Research Center Rapid expansion method ("REM") for in vitro propagation of T lymphocytes
US6713247B1 (en) 1996-09-03 2004-03-30 Signal Pharmaceuticials, Inc. Human CNS cell lines and methods of use therefor
AU734827B2 (en) 1997-05-21 2001-06-21 Board Of Trustees Of The Leland Stanford Junior University Composition and method for enhancing transport across biological membranes
EP0893493A3 (de) 1997-07-21 2002-12-04 Aventis Pharma Deutschland GmbH Genetisch veränderte Zellen und deren Verwendung in der Prophylaxe oder Therapie von Erkrankungen
GB9720585D0 (en) 1997-09-26 1997-11-26 Smithkline Beecham Biolog Vaccine
AU1818299A (en) 1997-12-10 1999-06-28 Washington University Anti-pathogen system and methods of use thereof
DE69923550T2 (de) 1998-04-08 2006-02-16 Shionogi & Co., Ltd. Verfahren um Vorläuferzellen von Osteoklasten zu isolieren und ihre Differenzierung in Osteoklasten zu induzieren.
US6835567B1 (en) 1998-04-14 2004-12-28 Signal Pharmaceuticals, Inc. PNS cell lines and methods of use therefor
US6451558B1 (en) 1998-08-03 2002-09-17 Novartis Ag Genes in the control of hematopoiesis
US6913925B1 (en) 1998-08-12 2005-07-05 Signal Pharmaceuticals Llc Human mesencephalon cell lines and methods of use therefor
JP2003514765A (ja) 1999-02-28 2003-04-22 ワシントン ユニバーシティー 新規形質導入分子およびその使用方法
AU4070500A (en) 1999-04-05 2000-10-23 Biocrystal Limited Assay kits and methods for immune complex-mediated activation involving shed antigens
US6451601B1 (en) 1999-04-12 2002-09-17 Modex Therapeutiques, S.A. Transiently immortalized cells for use in gene therapy
US6358739B1 (en) 1999-04-12 2002-03-19 Modex Therapeutiques, S.A. Transiently immortalized cells
CA2369884C (en) 1999-04-12 2010-01-05 Modex Therapeutiques, S.A. Transiently immortalized cells for use in gene therapy
US7135287B1 (en) 1999-10-02 2006-11-14 Biosite, Inc. Human antibodies
US7311920B1 (en) 1999-10-08 2007-12-25 University Of Maryland Biotechnology Institute Virus coat protein/receptor chimeras and methods of use
DE60032927T2 (de) 1999-11-10 2007-11-08 Rigel Pharmaceuticals, Inc., South San Francisco Verfahren and zusammenstellungen, die renilla gfp enthalten
EP1103615A1 (en) 1999-11-25 2001-05-30 Universite De Geneve Vectors capable of immortalizing non-dividing cells and cells immortalized with said vectors
US20010049393A1 (en) 1999-12-07 2001-12-06 Whitehead Institute For Biomedical Research Methods for defining MYC target genes and uses thereof
EP1285577A4 (en) 2000-05-15 2007-05-09 Sonoko Habu CHIMERIC MOUSE HAVING IMMUNITY CREATED BY USE OF HUMAN CD34 POSITIVE CELLS AND USE THEREOF
US20020155127A1 (en) 2000-06-02 2002-10-24 Danher Wang Genetic vaccine against human immunodeficiency virus
US20030072794A1 (en) 2000-06-09 2003-04-17 Teni Boulikas Encapsulation of plasmid DNA (lipogenes™) and therapeutic agents with nuclear localization signal/fusogenic peptide conjugates into targeted liposome complexes
US20070248618A1 (en) 2004-03-16 2007-10-25 Cohen David I Tat-Based vaccine Compositions and Methods of Making and Using Same
EP1326969B1 (en) 2000-09-25 2009-04-15 Genetronics, Inc. Improved system for regulation of transgene expression
EP1330551A2 (en) 2000-10-30 2003-07-30 Kalobios, Inc. Affinity maturation by competitive selection
AU2872202A (en) 2000-11-01 2002-05-15 Us Gov Health & Human Serv Expression vectors able to elicit improved immune response and methods of using same
ES2295218T3 (es) 2000-12-01 2008-04-16 Central Institute For Experimental Animals Procedimiento para la produccion de un raton adecuado para el prendimiento, la diferenciacion y la proliferacion de celulas heterogeneas, raton producido mediante este procedimiento y utilizacion del raton.
WO2002057436A2 (en) 2001-01-19 2002-07-25 Gendel Limited Red blood cell from a transgenic animal as vehicle for polypeptide delivery
US7033744B2 (en) 2001-03-16 2006-04-25 Naoya Kobayashi Method for proliferating a liver cell, a liver cell obtained thereby, and use thereof
CA2457652C (en) 2001-08-31 2012-08-07 Avidex Limited Soluble t cell receptor
CN100506978C (zh) 2001-09-21 2009-07-01 中国人民解放军军事医学科学院野战输血研究所 一种新的造血干/祖细胞的富集方法及其体外定向诱导分化
GB0124391D0 (en) 2001-10-11 2001-11-28 Gene Expression Technologies L Control of gene expression
JP2005508171A (ja) 2001-11-02 2005-03-31 タノックス インコーポレーテッド Ｂ細胞悪性病変の診断及び予防に用いるためのｂ細胞リンパ腫特異抗原
US7745140B2 (en) 2002-01-03 2010-06-29 The Trustees Of The University Of Pennsylvania Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool
WO2003057171A2 (en) 2002-01-03 2003-07-17 The Trustees Of The University Of Pennsylvania Activation and expansion of t-cells using an engineered multivalent signaling platform
EP1572933A4 (en) 2002-02-13 2007-09-05 Univ Duke MODULATION OF IMMUNE RESPONSE BY POLYPEPTIDES OF RESPONSE TO STRESS BINDING TO NON PEPTIDES
CN1240439C (zh) 2002-03-28 2006-02-08 南京凯基生物科技发展有限公司 肿瘤基因开关药物
US7211191B2 (en) 2004-09-30 2007-05-01 Thermogenesis Corp. Blood component separation method and apparatus
NZ536548A (en) 2002-04-16 2007-11-30 Dana Farber Cancer Inst Inc Using stem cells to make chimeric non-human animals having tumors or the ability to develop tumors
GB2387599B (en) 2002-04-17 2005-08-10 Jason Peter Brown Methods for producing antibodies
CN1659187A (zh) 2002-05-10 2005-08-24 新世纪药品有限公司 融合铁蛋白在疫苗和其他方面的应用
CN1982332A (zh) 2002-05-16 2007-06-20 巴法里安诺迪克有限公司 Hiv调节/辅助蛋白的融合蛋白
US8034334B2 (en) 2002-09-06 2011-10-11 The United States Of America As Represented By The Secretary, Department Of Health And Human Services Immunotherapy with in vitro-selected antigen-specific lymphocytes after non-myeloablative lymphodepleting chemotherapy
JP4436319B2 (ja) 2002-10-09 2010-03-24 メディジーン リミテッド 単鎖組換えｔ細胞レセプター
ATE350480T1 (de) 2002-10-11 2007-01-15 Imvision Gmbh Moduläre antigen-transporter moleküle (mat- moleküle) zur modulierung von immunreaktionen, zugehörige konstrukte, verfahren und verwendungen
WO2004035535A2 (en) 2002-10-15 2004-04-29 Yeda Research And Development Co. Ltd. Erythrocyte differentiation factor, gene encoding same, and methods of use thereof
EP2048159B1 (en) 2002-11-09 2014-01-01 Immunocore Ltd. T cell receptor display
EP1570061A2 (en) 2002-12-05 2005-09-07 Imperial College Innovations Limited Control of apoptosis using a complex of an oligonucleotide and a regulatory peptide
DE602004008582T2 (de) * 2003-02-17 2008-05-21 Peter Burkhard Peptidische nanoteilchen als arzneimittelabgabe- und antigen-display-systeme
GB0304068D0 (en) 2003-02-22 2003-03-26 Avidex Ltd Substances
US7482016B2 (en) 2003-03-19 2009-01-27 The J. David Gladstone Institutes Immunogenic compositions comprising HIV-1 acetylated Tat polypeptides
WO2004104185A1 (en) 2003-05-08 2004-12-02 Xcyte Therapies, Inc. Generation and isolation of antigen-specific t cells
WO2005014785A2 (en) 2003-06-18 2005-02-17 The George Washington University Conditionally-immortalized hematopoietic progenitor cell lines
AU2004316996A1 (en) 2003-06-20 2005-09-15 The Regents Of The University Of California Polypeptide transduction and fusogenic peptides
IL161903A0 (en) 2003-07-17 2005-11-20 Gamida Cell Ltd Ex vivo progenitor and stem cell expansion for usein the treatment of disease of endodermally- deri ved organs
PT1691824E (pt) 2003-11-19 2009-05-28 Merck Patent Gmbh Proteínas pertencentes à família bcl-2 e seus fragmentos e sua utilização em doentes de cancro
US7705049B2 (en) 2004-01-21 2010-04-27 New York University Methods for treating non-melanoma cancers with PABA
NZ550810A (en) 2004-05-19 2009-05-31 Immunocore Ltd High affinity NY-ESO T cell receptor
AU2005246073B2 (en) 2004-05-19 2010-10-28 Adaptimmune Limited Method of improving T cell receptors
WO2006000830A2 (en) 2004-06-29 2006-01-05 Avidex Ltd Cells expressing a modified t cell receptor
US20060068469A1 (en) 2004-08-17 2006-03-30 Research Development Foundation Bacterial vector systems
GB0420963D0 (en) 2004-09-21 2004-10-20 Reneuron Ltd Hepatocyte
WO2006045064A2 (en) 2004-10-20 2006-04-27 Whitehead Institute For Biomedical Research Cultured hematopoietic stem cells and method for expansion and analysis thereof
US8795650B2 (en) 2004-12-09 2014-08-05 The Regents Of The University Of California Derivation of unlimited quantities of neutrophils or monocyte/dendritic cells
US20060156422A1 (en) 2005-01-10 2006-07-13 Medical Research Council Methods and compositions for the generation of antibodies
CN101389314A (zh) * 2005-03-14 2009-03-18 得克萨斯大学体系董事会 生物活性fus1肽和纳米颗粒-多肽复合物
US20070098715A1 (en) 2005-03-25 2007-05-03 Seth Ettenberg Antibodies against the tenascin major antigens
WO2006116512A1 (en) 2005-04-26 2006-11-02 The Board Of Trustees Of The University Of Illinois, Urbana, Il Nucleoside compounds and methods of use thereof
US8246995B2 (en) * 2005-05-10 2012-08-21 The Board Of Trustees Of The Leland Stanford Junior University Hydrophobic nanotubes and nanoparticles as transporters for the delivery of drugs into cells
WO2006125962A2 (en) 2005-05-25 2006-11-30 Medigene Limited T cell receptors which specifically bind to vygfvracl-hla-a24
US20090317377A1 (en) 2005-08-26 2009-12-24 Yeomans David C Therapy procedure for drug delivery for trigeminal pain
US20070047583A1 (en) 2005-08-29 2007-03-01 Siemens Aktiengesellschaft Method for using a short address in a packet header
IL296832A (en) 2005-10-18 2022-11-01 Nat Jewish Health A process for making red blood cells using immortal hematopoietic stem cells and erythropoietin
EP1942948A4 (en) 2005-11-04 2010-03-03 Alnylam Pharmaceuticals Inc COMPOSITIONS AND METHODS FOR INHIBITING THE EXPRESSION OF THE NAV1.8 GENE
EP1792627A1 (en) 2005-12-05 2007-06-06 ImVisioN AG Modulation of the immune response by administration of intralymphatic transduction allergen (ITAG-)-molecules
US8088379B2 (en) 2006-09-26 2012-01-03 The United States Of America As Represented By The Department Of Health And Human Services Modified T cell receptors and related materials and methods
EP2087000A2 (en) 2006-09-29 2009-08-12 Immunocore Ltd. T cell therapies
WO2008112922A2 (en) 2007-03-13 2008-09-18 National Jewish Medical And Research Center Methods for generation of antibodies
WO2009059304A2 (en) 2007-11-02 2009-05-07 Taiga Biotechnologies, Inc. Compounds for treating abnormal cellular proliferation
WO2009117439A2 (en) 2008-03-17 2009-09-24 The Scripps Research Institute Combined chemical and genetic approaches for generation of induced pluripotent stem cells
EA021131B1 (ru) 2008-05-16 2015-04-30 Тэйга Байотекнолоджис, Инк. Антитела и способы их получения
US8481492B2 (en) 2008-06-13 2013-07-09 Life & Brain Gmbh Fusion protein and use thereof
WO2010011644A2 (en) 2008-07-21 2010-01-28 Taiga Biotechnologies, Inc. Differentiated anucleated cells and method for preparing the same
EP3824884A1 (en) 2008-11-06 2021-05-26 Indiana University Research and Technology Corporation Materials and methods to enhance hematopoietic stem cells engraftment procedures
US20110318830A1 (en) * 2008-11-12 2011-12-29 The Regents Of The University Of California Compositions and methods for re-programming and re-differentiating cells
US8697854B2 (en) 2008-11-24 2014-04-15 Helmholtz Zentrum München Deutsches Forschungszentrum Für Gesundheit Und Umwelt Gmbh High affinity T cell receptor and use thereof
WO2010075249A2 (en) * 2008-12-22 2010-07-01 Genentech, Inc. A method for treating rheumatoid arthritis with b-cell antagonists
WO2010102267A2 (en) * 2009-03-06 2010-09-10 Ipierian, Inc. Tgf-beta pathway inhibitors for enhancement of cellular reprogramming of human cells
WO2011100477A2 (en) 2010-02-10 2011-08-18 Taiga Biotechnologies, Inc. Antibodies and processes for preparing the same
US20120107317A1 (en) 2010-10-27 2012-05-03 The University Of Hong Kong Use of cytoplasmic c-myc for regulating immune responses
WO2012129201A1 (en) 2011-03-22 2012-09-27 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods of growing tumor infiltrating lymphocytes in gas-permeable containers
TWI575070B (zh) * 2011-07-12 2017-03-21 傳斯堅公司 Ｈｂｖ聚合酶突變體
PT2755997T (pt) 2011-09-15 2018-10-30 Us Health Recetores de célula t que reconhecem mage restrito a hlaa1 ou hla-cw7
US9421173B2 (en) * 2011-09-21 2016-08-23 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Nano delivery systems for siRNA
US9751928B2 (en) 2012-05-03 2017-09-05 Fred Hutchinson Cancer Research Center Enhanced affinity T cell receptors and methods for making the same
JP6228191B2 (ja) * 2012-05-23 2017-11-08 ジ・オハイオ・ステート・ユニバーシティ 脂質コートされたアルブミンナノ粒子組成物と、それを作製する方法、及びそれを使用する方法
DE102012209673A1 (de) 2012-06-08 2013-12-24 Artcline Gmbh Verfahren zum Herstellen einer Leukozytenpräparation und Leukozytenpräparation
RU2020108070A (ru) 2012-07-27 2020-03-16 Дзе Борд Оф Трастиз Оф Дзе Юниверсити Оф Иллинойс Конструирование t-клеточных рецепторов
GB2508414A (en) 2012-11-30 2014-06-04 Max Delbrueck Centrum Tumour specific T cell receptors (TCRs)
US20160010058A1 (en) 2013-03-01 2016-01-14 The United States Of America, As Represented By The Secretary, Department Of Health And Human Serv Methods of producing enriched populations of tumor-reactive t cells from tumor
CA2902448C (en) 2013-03-01 2023-04-18 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods of producing enriched populations of tumor reactive t cells from peripheral blood
US10272115B2 (en) * 2013-03-11 2019-04-30 Taiga Biotechnologies, Inc. Production and use of red blood cells
US9365825B2 (en) 2013-03-11 2016-06-14 Taiga Biotechnologies, Inc. Expansion of adult stem cells in vitro
JP6933898B2 (ja) 2014-04-24 2021-09-08 ボード オブ リージェンツ, ザ ユニバーシティ オブ テキサス システムBoard Of Regents, The University Of Texas System 養子細胞治療製品を製造するための誘導多能性幹細胞の適用
EP3355922A2 (en) 2015-10-02 2018-08-08 Dana Farber Cancer Institute, Inc. Combination therapy of bromodomain inhibitors and checkpoint blockade
TWI821913B (zh) 2016-01-15 2023-11-11 美商伯克利之光生命科技公司 製造患者專一性抗癌治療劑之方法及使用該治療劑之治療方法
WO2018104909A2 (en) 2016-12-09 2018-06-14 St. Jude Children's Research Hospital Dna methylation profiling for t-cell immunotherapy
US10149898B2 (en) 2017-08-03 2018-12-11 Taiga Biotechnologies, Inc. Methods and compositions for the treatment of melanoma

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0036776A2 (en) 1980-03-24 1981-09-30 Genentech, Inc. A method of creating an expression plasmid
US5652122A (en) 1989-12-21 1997-07-29 Frankel; Alan Nucleic acids encoding and methods of making tat-derived transport polypeptides
US5670617A (en) 1989-12-21 1997-09-23 Biogen Inc Nucleic acid conjugates of tat-derived transport polypeptides
US5674980A (en) 1989-12-21 1997-10-07 Biogen Inc Fusion protein comprising tat-derived transport moiety
US5747641A (en) 1989-12-21 1998-05-05 Biogen Inc Tat-derived transport polypeptide conjugates
US5804604A (en) 1989-12-21 1998-09-08 Biogen, Inc. Tat-derived transport polypeptides and fusion proteins
US20140356392A1 (en) 2008-08-28 2014-12-04 Taiga Biotechnologies, Inc. Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc
US20150164950A1 (en) 2012-07-20 2015-06-18 Taiga Biotechnologies, Inc. Enhanced reconstitution and autoreconstitution of the hematopoietic compartment
US20140109246A1 (en) * 2012-09-24 2014-04-17 The Regents Of The University Of Colorado, A Body Corporate Methods of generating xenochimaeric mice with tumor and hematopoietic system from the same heterologous species
WO2016105542A2 (en) 2014-12-24 2016-06-30 Neximmune, Inc Nanoparticle compositions and methods for immunotherapy

Non-Patent Citations (20)

* Cited by examiner, † Cited by third party
Title
Bird et al., "Expansion of Human and Murine Hematopoietic Stem and progenitor Cells Ex Vivo without Genetic Modification Using MYC and Bcl-2 Fusion Proteins," PLoS One, Aug. 29, 2014, vol. 9, No. 8, pp. 1-20.
Chang, et al., "Phenotypic expression in E. coli of a DNA sequence coding for mouse dihydrofolate reductase," Nature, vol. 275, Oct. 19, 1978, pp. 617-624.
Chi, et al., "Physical Stability of Proteins in Aqueous Solution: Mechanism and Driving Forces in Nonnative Protein Aggregation," Pharm. Res., vol. 20, No. 9, Sep. 2003, pp. 1325-1336.
Cleland, et al., "The development of stable protein formulations: a close look at protein aggregation, deamidation, and oxidation," Crit. Rev. Ther. Drug Carrier Syst., vol. 70, No. 4, Jan. 1, 1993, pp. 307-377.
Deboer, et al., "The tac promoter: A functional hybrid derived from the trp and lac promoters," Proc. Natl. Acad. Sci. vol. 80, Jan. 1983, pp. 21-25.
Derossi, et al., "Trojan peptides: the penetratin system for intracellular delivery," Cell Biology, vol. 8, Feb. 1998, pp. 84-87.
Elliot, et al., "Intercellular Trafficking and Protein Delivery by a Herpesvirus Structural Protein," Cell, vol. 88, Jan. 24, 1997, pp. 223-233.
Goeddel, et al., "Direct expression in Escherichia coli of a DNA sequence coding for human growth hormone," Nature, vol. 281, Oct. 18, 1979, p. 544.
Goeddel, et al., "Synthesis of human fibroblast interferon by E. coli," Nucleic Acids Research, vol. 8, Aug. 12, 1980, p. 4057.
Heinkoff, et al., "Amino acid substitution matrices from protein blocks," Proc. Natl Acad. Sci. USA, vol. 89, Nov. 1992, pp. 10915-10919.
Huang, et al., "Negative Control of the Myc Protein by the Stress-Responsive Kinase Pak2," Molecular and Cellular Biology, vol. 24, No. 4, Feb. 2001, pp. 1582-1594.
International Search Report and Written Opinion for PCT/US2017/064206, dated Mar. 19, 2018.
Kaptein, et al., "Anti-IgM-mediated Regulation of c-myc and Its Possible Relationship to Apoptosis," JBC, vol. 271, No. 31, Aug. 2, 1996, pp. 18875-18884.
Patel et al., "The c-MYC oncoprotein is a substrate of the acetyltransferases hGCN5/PCAF and TIP60," Molecular and Cellular Biology, Dec. 1, 2004, vol. 24, No. 24, pp. 10826-10834.
Schwarze, et al., "In vivo protein transduction: intracellular delivery of biologically active proteins, compounds and DNA," Trends Pharmacol Sci, vol. 21, Feb. 2000, pp. 45-48.
Siebenlist, et al., "E. coli RNA Polymerase Interacts Homologously with Two Different Promoters," Cell, vol. 20, Jun. 1980, pp. 269-281.
Stein et al., "TAT-MYC Recombinant Fusion Protein Enhances Hematopoietic Stem Cell Graft Performance and Immune Cell Reconstitution after Transplantation," Blood, Dec. 7, 2017, vol. 130, Suppl. 1, p. 3175.
Wang, "Instability, stabilization, and formulation of liquid protein pharmaceuticals," Int. J. Pharm., vol. 185, Issue 2, Aug. 20, 1999, pp. 129-188.
Wang, "Lyophilization and development of solid protein pharmaceuticals," Int. J. Pharm., vol. 203, Issues 1-2, Aug. 2000, pp. 1-60.
Watt et al. 1983; Nucleotide sequence of cloned cDNA of human c-myc oncogene. Nature. 303:725-728. *

Also Published As

Publication number Publication date
JP2022060418A (ja) 2022-04-14
IL281425B (en) 2022-07-01
JP2020512282A (ja) 2020-04-23
EP3548425B1 (en) 2023-03-29
US20180153939A1 (en) 2018-06-07
AU2017367730A1 (en) 2019-06-06
US20220096545A1 (en) 2022-03-31
CN110177758A (zh) 2019-08-27
IL266867A (en) 2019-07-31
CN110177758B (zh) 2021-10-01
AU2023201894A1 (en) 2023-05-04
JP7270085B2 (ja) 2023-05-09
WO2018102678A1 (en) 2018-06-07
CN113307858A (zh) 2021-08-27
IL266867B (en) 2021-06-30
CA3045017A1 (en) 2018-06-07
IL293611A (en) 2022-08-01
KR20190092472A (ko) 2019-08-07
IL281425A (en) 2021-04-29
US11116796B2 (en) 2021-09-14
JP6799683B2 (ja) 2020-12-16
CN113786476A (zh) 2021-12-14
EP4242298A2 (en) 2023-09-13
JP2021038253A (ja) 2021-03-11
EP3548425A4 (en) 2020-07-29
EP3548425A1 (en) 2019-10-09
US20200222464A1 (en) 2020-07-16
JP7030934B2 (ja) 2022-03-07

Similar Documents

Publication Publication Date Title
US11116796B2 (en) Nanoparticle formulations
JP6676589B2 (ja) 薬物動態特性の改善されたコンプスタチンアナログ
JP6930756B6 (ja) Ｐ９７−ｉｄｓ融合タンパク質
EP4083212A1 (en) Mutant rsv f protein and use thereof
CN109134664B (zh) 一种经修饰的生长分化因子及其制备方法和应用
JP2020191860A (ja) Ｉｌ−３７バリアント
JP2015508993A (ja) 細胞透過能を改善した改良形の新規巨大分子伝達ドメインの開発及びその利用方法
DK3202413T3 (en) MODIFIED PEPTIDES AND ITS APPLICATION FOR THE TREATMENT OF AUTOIMMUNE DISEASES
TW202321274A (zh) 人類運鐵蛋白受體結合肽
US20220153792A1 (en) Peptide Inhibitors Targeting The CXCL12/HMGB1 Interaction And Uses Thereof
TW202434613A (zh) 人類運鐵蛋白受體結合肽
WO2022245259A1 (ru) Способ промышленной очистки ромиплостима

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

ZAAA Notice of allowance and fees due

Free format text: ORIGINAL CODE: NOA

ZAAB Notice of allowance mailed

Free format text: ORIGINAL CODE: MN/=.

AS Assignment

Owner name: TAIGA BIOTECHNOLOGIES, INC., COLORADO

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:TURNER, BRIAN CURTIS;REFAELI, YOSEF;BIRD, GREGORY ALAN;REEL/FRAME:050925/0698

Effective date: 20191101

STCF Information on status: patent grant

Free format text: PATENTED CASE

FEPP Fee payment procedure

Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

AS Assignment

Owner name: TAIGA BIOTECHNOLOGIES (ABC), LLC, CALIFORNIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:TAIGA BIOTECHNOLOGIES, INC.;REEL/FRAME:066186/0624

Effective date: 20230509

LAPS Lapse for failure to pay maintenance fees

Free format text: PATENT EXPIRED FOR FAILURE TO PAY MAINTENANCE FEES (ORIGINAL EVENT CODE: EXP.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STCH Information on status: patent discontinuation

Free format text: PATENT EXPIRED DUE TO NONPAYMENT OF MAINTENANCE FEES UNDER 37 CFR 1.362

AS Assignment

Owner name: HTYR ACQUISITION LLC, PENNSYLVANIA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:TAIGA BIOTECHNOLOGIES (ABC), LLC;REEL/FRAME:067133/0520

Effective date: 20240405

FP Lapsed due to failure to pay maintenance fee

Effective date: 20240310

FEPP Fee payment procedure

Free format text: PETITION RELATED TO MAINTENANCE FEES FILED (ORIGINAL EVENT CODE: PMFP); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

PRDP Patent reinstated due to the acceptance of a late maintenance fee

Effective date: 20240701

STCF Information on status: patent grant

Free format text: PATENTED CASE