RU2817381C1 - Cultural inactivated sorbed vaccine against foot-and-mouth disease from the strain "a/egypt/euro-sa/2022" - Google Patents
Cultural inactivated sorbed vaccine against foot-and-mouth disease from the strain "a/egypt/euro-sa/2022" Download PDFInfo
- Publication number
- RU2817381C1 RU2817381C1 RU2023122524A RU2023122524A RU2817381C1 RU 2817381 C1 RU2817381 C1 RU 2817381C1 RU 2023122524 A RU2023122524 A RU 2023122524A RU 2023122524 A RU2023122524 A RU 2023122524A RU 2817381 C1 RU2817381 C1 RU 2817381C1
- Authority
- RU
- Russia
- Prior art keywords
- euro
- foot
- mouth disease
- strain
- egypt
- Prior art date
Links
- 241000710198 Foot-and-mouth disease virus Species 0.000 title claims abstract description 184
- 229960005486 vaccine Drugs 0.000 title claims abstract description 86
- 208000007212 Foot-and-Mouth Disease Diseases 0.000 title claims abstract description 59
- 239000000427 antigen Substances 0.000 claims abstract description 33
- 102000036639 antigens Human genes 0.000 claims abstract description 33
- 108091007433 antigens Proteins 0.000 claims abstract description 33
- 241001465754 Metazoa Species 0.000 claims abstract description 30
- 239000002671 adjuvant Substances 0.000 claims abstract description 15
- 239000000463 material Substances 0.000 claims abstract description 11
- 239000013543 active substance Substances 0.000 claims abstract description 9
- 239000012678 infectious agent Substances 0.000 claims abstract description 5
- 239000000725 suspension Substances 0.000 claims description 49
- 230000002163 immunogen Effects 0.000 claims description 25
- 208000015181 infectious disease Diseases 0.000 claims description 18
- 230000000890 antigenic effect Effects 0.000 claims description 16
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 claims description 14
- 239000001397 quillaja saponaria molina bark Substances 0.000 claims description 14
- 229930182490 saponin Natural products 0.000 claims description 14
- 150000007949 saponins Chemical class 0.000 claims description 14
- 210000003734 kidney Anatomy 0.000 claims description 11
- 238000002360 preparation method Methods 0.000 claims description 9
- 231100000676 disease causative agent Toxicity 0.000 claims description 7
- 241000699673 Mesocricetus auratus Species 0.000 claims description 6
- 239000000654 additive Substances 0.000 claims description 6
- 230000000996 additive effect Effects 0.000 claims description 3
- 244000037640 animal pathogen Species 0.000 claims description 2
- 230000036541 health Effects 0.000 claims description 2
- 230000003319 supportive effect Effects 0.000 claims description 2
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 claims 1
- 229910052782 aluminium Inorganic materials 0.000 claims 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 claims 1
- 230000000694 effects Effects 0.000 abstract description 6
- 239000000126 substance Substances 0.000 abstract 1
- 210000004027 cell Anatomy 0.000 description 49
- 241000700605 Viruses Species 0.000 description 40
- 108090000623 proteins and genes Proteins 0.000 description 28
- 241000283690 Bos taurus Species 0.000 description 21
- 102000004169 proteins and genes Human genes 0.000 description 18
- 239000002609 medium Substances 0.000 description 17
- 238000004519 manufacturing process Methods 0.000 description 15
- 230000002458 infectious effect Effects 0.000 description 13
- 239000002245 particle Substances 0.000 description 12
- 238000004113 cell culture Methods 0.000 description 11
- 238000000034 method Methods 0.000 description 11
- 201000010099 disease Diseases 0.000 description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 10
- 230000002779 inactivation Effects 0.000 description 8
- 239000000203 mixture Substances 0.000 description 8
- 239000002356 single layer Substances 0.000 description 8
- 238000004458 analytical method Methods 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 230000003053 immunization Effects 0.000 description 7
- 210000002966 serum Anatomy 0.000 description 7
- 238000002255 vaccination Methods 0.000 description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 description 6
- 238000009825 accumulation Methods 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 238000010790 dilution Methods 0.000 description 6
- 239000012895 dilution Substances 0.000 description 6
- 238000004264 monolayer culture Methods 0.000 description 6
- 239000002773 nucleotide Substances 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 5
- 239000002202 Polyethylene glycol Substances 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 229920001223 polyethylene glycol Polymers 0.000 description 5
- 230000002265 prevention Effects 0.000 description 5
- 230000009385 viral infection Effects 0.000 description 5
- 241001250090 Capra ibex Species 0.000 description 4
- 108010067390 Viral Proteins Proteins 0.000 description 4
- 230000006378 damage Effects 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 210000002845 virion Anatomy 0.000 description 4
- LSDGFGPIFBOTJI-UHFFFAOYSA-N 2-(aziridin-1-yl)ethanamine Chemical compound NCCN1CC1 LSDGFGPIFBOTJI-UHFFFAOYSA-N 0.000 description 3
- 108010017384 Blood Proteins Proteins 0.000 description 3
- 102000004506 Blood Proteins Human genes 0.000 description 3
- 101710172711 Structural protein Proteins 0.000 description 3
- 230000006978 adaptation Effects 0.000 description 3
- 125000003275 alpha amino acid group Chemical group 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 239000013553 cell monolayer Substances 0.000 description 3
- 238000010835 comparative analysis Methods 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 230000036039 immunity Effects 0.000 description 3
- 210000003292 kidney cell Anatomy 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- -1 polyhexamethylene guanidine hydrochloride Polymers 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 238000001179 sorption measurement Methods 0.000 description 3
- 210000000605 viral structure Anatomy 0.000 description 3
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 208000035473 Communicable disease Diseases 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- MXRIRQGCELJRSN-UHFFFAOYSA-N O.O.O.[Al] Chemical compound O.O.O.[Al] MXRIRQGCELJRSN-UHFFFAOYSA-N 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- 241000282887 Suidae Species 0.000 description 2
- 208000002399 aphthous stomatitis Diseases 0.000 description 2
- 230000000680 avirulence Effects 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 230000000052 comparative effect Effects 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 239000012535 impurity Substances 0.000 description 2
- 230000000877 morphologic effect Effects 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 150000007523 nucleic acids Chemical class 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 239000003531 protein hydrolysate Substances 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000004114 suspension culture Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 241000710189 Aphthovirus Species 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 102100031974 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Human genes 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 101000703754 Homo sapiens CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241001144416 Picornavirales Species 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 241001493546 Suina Species 0.000 description 1
- 101710140501 Sulfate adenylyltransferase subunit 2 1 Proteins 0.000 description 1
- 101710173681 Sulfate adenylyltransferase subunit 2 2 Proteins 0.000 description 1
- 102100030100 Sulfate anion transporter 1 Human genes 0.000 description 1
- 101710144481 Sulfate anion transporter 1 Proteins 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 230000027645 antigenic variation Effects 0.000 description 1
- 230000037429 base substitution Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 230000009351 contact transmission Effects 0.000 description 1
- 238000011217 control strategy Methods 0.000 description 1
- 230000000120 cytopathologic effect Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- BTWUORFYKAZQHW-UHFFFAOYSA-L disodium;2-hydroxy-3-[4-[4-[(2-hydroxy-3-sulfonatopropyl)amino]-3-methylphenyl]-2-methylanilino]propane-1-sulfonate Chemical compound [Na+].[Na+].C1=C(NCC(O)CS([O-])(=O)=O)C(C)=CC(C=2C=C(C)C(NCC(O)CS([O-])(=O)=O)=CC=2)=C1 BTWUORFYKAZQHW-UHFFFAOYSA-L 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 238000012252 genetic analysis Methods 0.000 description 1
- 230000003067 hemagglutinative effect Effects 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 230000017074 necrotic cell death Effects 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 238000010827 pathological analysis Methods 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000011886 postmortem examination Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 230000000601 reactogenic effect Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000000405 serological effect Effects 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 1
- 230000017613 viral reproduction Effects 0.000 description 1
- 230000010464 virion assembly Effects 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
Abstract
Description
Изобретение относится к области ветеринарной вирусологии и биотехнологии, а именно к разработке вакцины против ящура из штамма «A/Египет/EURO-SA/2022» культуральной инактивированной сорбированной.The invention relates to the field of veterinary virology and biotechnology, namely to the development of a culture inactivated sorbed vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022”.
В соответствии с классификацией МЭБ (OIE, 2022) такое опасное, высококонтагиозное заболевание как ящур относится к списку «Болезней, общих для животных разных видов» и наносит огромный экономический ущерб [1].In accordance with the OIE classification (OIE, 2022), such a dangerous, highly contagious disease as foot and mouth disease belongs to the list of “Diseases common to animals of different species” and causes enormous economic damage [1].
В настоящее время выделяют 7 следующих серотипов вируса ящура: О, А, С, SAT-1, SAT-2, SAT-3 и Азия-1, при этом возбудитель данного заболевания, относящийся к серотипу А, является наиболее разнообразным [2], что определяет актуальность изготовления вакцин против ящура различных серотипов, а именно данного серотипа.Currently, the following 7 serotypes of foot-and-mouth disease virus are distinguished: O, A, C, SAT-1, SAT-2, SAT-3 and Asia-1, while the causative agent of this disease, belonging to serotype A, is the most diverse [2], which determines the relevance of manufacturing vaccines against foot and mouth disease of various serotypes, namely this serotype.
Серотипы вируса ящура разделены на различные топотипы, а иногда на отдельные генетические линии и даже сублинии. Различия между ними определяют при анализе нуклеотидной последовательности высоковариабельного гена 1D, который кодирует аминокислотную последовательность белка VP1 [3]. Учитывая, что возбудитель ящура является РНК-содержащим вирусом, для него характерна высокая степень мутационных процессов за счет репликации нуклеиновой кислоты. Именно по этой причине в пределах серотипа А выделяют на сегодняшний день уже более 25 генотипов.Foot-and-mouth disease virus serotypes are divided into different topotypes, and sometimes into separate genetic lineages and even sublineages. The differences between them are determined by analyzing the nucleotide sequence of the highly variable 1D gene, which encodes the amino acid sequence of the VP 1 protein [3]. Considering that the causative agent of foot-and-mouth disease is an RNA-containing virus, it is characterized by a high degree of mutation processes due to nucleic acid replication. It is for this reason that more than 25 genotypes are currently distinguished within serotype A.
Целесообразно проводить генетический анализ представителей вируса ящура для возможности тщательного исследования эпизоотической ситуации в конкретном регионе и детальном подборе оптимальной по составу вакцины против данного инфекционного агента. Важно отметить, что после переболевания животных каким-либо одним серотипом не обеспечивает иммунную защиту против другого серотипа и других генетических линий [4].It is advisable to conduct a genetic analysis of representatives of the foot-and-mouth disease virus to enable a thorough study of the epizootic situation in a particular region and a detailed selection of the optimal vaccine composition against a given infectious agent. It is important to note that after animals have been infected with any one serotype, it does not provide immune protection against another serotype and other genetic lines [4].
Для изолятов вируса ящура серотипа А характерно наибольшее генетическое разнообразие. Серотип А включает в себя 3 охарактеризованных генотипа ASIA, AFRICA, EURO-SA и одну пока еще малоизученную группу изолятов [2, 5], что приводит к проблемам при специфической профилактики ящура при применении культуральных инактивированных противоящурных вакцин. В результате возникает необходимость создания новых средств специфической профилактики в отношении ящура серотипа А.Isolates of foot-and-mouth disease virus serotype A are characterized by the greatest genetic diversity. Serotype A includes 3 characterized genotypes ASIA, AFRICA, EURO-SA and one still poorly studied group of isolates [2, 5], which leads to problems in the specific prevention of foot-and-mouth disease when using culture-inactivated foot-and-mouth disease vaccines. As a result, there is a need to create new means of specific prevention against foot and mouth disease serotype A.
По причине сверхлегкого и быстрого распространения возбудителя ящура данное заболевание может приобретать размах эпизоотий [6]. С целью недопущения возникновения болезни в хозяйствах Российской Федерации применяется система мероприятий по борьбе и профилактике ящура, которая направлена на предупреждение заноса вируса в страну, систематическую иммунизацию крупного и мелкого рогатого скота в буферной зоне, а также проведение мониторинга иммунного статуса привитых животных. Для иммунизации животных должна применяться вакцина, изготовленная из штамма, гомологичного полевым изолятам [7-15].Due to the ultra-light and rapid spread of the foot-and-mouth disease pathogen, this disease can acquire the scope of an epizootic [6]. In order to prevent the occurrence of the disease, farms in the Russian Federation apply a system of measures to combat and prevent foot-and-mouth disease, which is aimed at preventing the introduction of the virus into the country, systematic immunization of large and small livestock in the buffer zone, as well as monitoring the immune status of vaccinated animals. To immunize animals, a vaccine made from a strain homologous to field isolates should be used [7-15].
Вспышки ящура в мире демонстрируют, что данная инфекция продолжает оставаться крайне серьезной экономической проблемой во всем мире. Для проведения эффективной кампании по вакцинации нужно наличие эффективной, безопасной вакцины, содержащей в качестве иммуногенной части антиген вируса, соответствующей эпизоотическому распространяющемуся изоляту определенного генотипа. Создание подобных вакцин является актуальной задачей.Outbreaks of foot and mouth disease around the world demonstrate that this infection continues to be an extremely serious economic problem throughout the world. Conducting an effective vaccination campaign requires the availability of an effective, safe vaccine containing as an immunogenic part a viral antigen corresponding to the epizootic spreading isolate of a specific genotype. The creation of such vaccines is an urgent task.
Достижение данной цели позволит эффективно применять вакцину в неблагополучном пункте и угрожаемой зоне для формирования иммунитета против конкретного генотипа вируса ящура.Achieving this goal will make it possible to effectively use the vaccine in disadvantaged areas and threatened areas to build immunity against a specific genotype of the foot-and-mouth disease virus.
На территории Южной Америки периодически возникают вспышки ящура генотипа A/EURO-SA, представители которого распространяются на данном континенте, а в 2022 году изоляты вируса данного генотипа были выявлены на севере Африканского континента, предположительно, за счет тесных торговых отношений стран Африканского и Южноамериканского континентов.In South America, outbreaks of foot-and-mouth disease of the A/EURO-SA genotype periodically occur, representatives of which are distributed on this continent, and in 2022, virus isolates of this genotype were identified in the north of the African continent, presumably due to close trade relations between the countries of the African and South American continents.
В последние годы усилились торгово-экономические связи России со странами Африканского континента и Южной Америки. В связи с этим, имеются риски заноса изолятов вируса ящура данного генотипа на территорию Российской Федерации.In recent years, trade and economic ties between Russia and the countries of the African continent and South America have intensified. In this regard, there are risks of introducing foot-and-mouth disease virus isolates of this genotype into the territory of the Russian Federation.
Известны производственные штаммы вируса ящура серотипа А, которые применяются для производства средств специфической профилактики ящура:Production strains of foot-and-mouth disease virus serotype A are known, which are used for the production of specific foot-and-mouth disease prevention products:
- штамм «А22/Ирак/64» (генотип A/ASIA/Iraq-64),- strain “A 22 /Iraq/64” (genotype A/ASIA/Iraq-64),
- штамм «А/Турция/06» (генотип A/ASIA/Iran-05),- strain “A/Türkiye/06” (genotype A/ASIA/Iran-05),
- штамм «А/Краснодарский/2013» (генотип A/ASIA/Iran-05SIS-10),- strain “A/Krasnodar/2013” (genotype A/ASIA/Iran-05 SIS-10 ),
- штамм «А/Забайкальский/2013» (генотип A/ASIA/Sea-97),- strain “A/Zabaikalsky/2013” (genotype A/ASIA/Sea-97),
- штамм «А №2269/ВНИИЗЖ/2015» (генотип A/ASIA/G-VII),- strain “A No. 2269/ARRIAH/2015” (genotype A/ASIA/G-VII),
- штамм «А №2205/G-IV/2018» (генотип A/AFRICA/G-IV).- strain “A No. 2205/G-IV/2018” (genotype A/AFRICA/G-IV).
Изолят «А / EGY / 2 / 2022» вируса ящура был выделен в ФГБУ «ВНИИЗЖ» из патологического материала, полученного от крупного рогатого скота с территории населенного пункта Giza Арабской Республики Египет в 2022 году. В результате данной работы путем адаптации к культурам клеток получен штамм «A/Египет/EURO-SA/2022».Isolate “A / EGY / 2 / 2022” of the foot-and-mouth disease virus was isolated at the Federal State Budgetary Institution “ARRIAH” from pathological material obtained from cattle from the territory of the Giza settlement of the Arab Republic of Egypt in 2022. As a result of this work, strain “A/Egypt/EURO-SA/2022” was obtained by adaptation to cell cultures.
По результатам сравнительного анализа нуклеотидных последовательностей выделенный изолят принадлежит к серотипу А, топотипу EURO-SA вируса ящура, который значительно отличается от производственных штаммов вируса ящура серотипа А (фиг. 1).According to the results of a comparative analysis of nucleotide sequences, the isolated isolate belongs to serotype A, the EURO-SA topotype of foot-and-mouth disease virus, which differs significantly from the production strains of foot-and-mouth disease virus serotype A (Fig. 1).
Как выше было отмечено, учитывая увеличение торгово-экономических взаимоотношений между Россией и странами Африканского континента и Южной Америки возникает опасность возникновения ящура генотипа A/EURO-SA в Российской Федерации и особое значение приобретает проблема возможной экстренной профилактики данного заболевания для формирования иммунитета у восприимчивых животных. Таким образом, возникла необходимость разработать вакцину против ящура из штамма «A/Египет/EURO-SA/2022» культуральную инактивированную сорбированную для обеспечения биологической безопасности территории Российской Федерации и сопредельных государств.As noted above, given the increase in trade and economic relations between Russia and the countries of the African continent and South America, there is a danger of the occurrence of foot and mouth disease of the A/EURO-SA genotype in the Russian Federation and the problem of possible emergency prevention of this disease to build immunity in susceptible animals is of particular importance. Thus, there was a need to develop a culture-inactivated, sorbed vaccine against foot-and-mouth disease from the “A/Egypt/EURO-SA/2022” strain to ensure the biological safety of the territory of the Russian Federation and neighboring countries.
Наиболее близкой предлагаемому изобретению по совокупности существенных признаков является вакцина инактивированная сорбированная против ящура серотипа А (штамм «А/Забайкальский/2013»), содержащая активное вещество в виде авирулентного и очищенного культурального антигенного материала из гомологичного возбудителю ящура штамма «А/Забайкальский/2013», полученного в чувствительной биологической системе, и целевые добавки в виде гидроксида алюминия и сапонина (адъювант): концентрация антигена (инактивированные 146S+75S компоненты вируса ящура) не менее 3,0 мкг/см3, содержание 10% раствора гидроокиси алюминия - 40% по объему, добавка в виде поддерживающей среды - до 1,0 см3 (прототип) [16].The closest to the proposed invention in terms of the totality of essential features is an inactivated sorbed vaccine against foot-and-mouth disease serotype A (strain “A/Zabaikalsky/2013”), containing the active substance in the form of avirulent and purified cultural antigenic material from the strain “A/Zabaikalsky/2013” homologous to the causative agent of foot-and-mouth disease. obtained in a sensitive biological system, and targeted additives in the form of aluminum hydroxide and saponin (adjuvant): antigen concentration (inactivated 146S+75S components of the foot-and-mouth disease virus) not less than 3.0 μg/cm 3 , content of 10% aluminum hydroxide solution - 40% in volume, the additive in the form of a supporting medium is up to 1.0 cm 3 (prototype) [16].
В качестве чувствительной биологической системы для репродукции вируса ящура используют перевиваемую суспензионную клеточную линию почки новорожденного сирийского хомячка ВНК-21, в качестве поддерживающей среды применяют среду Игла MEM без внесения сыворотки, с добавлением ферментативного гидролизата мышц сухого, гидролизата белков крови сухого при рН среды 7,40-7,60.As a sensitive biological system for the reproduction of foot-and-mouth disease virus, a continuous suspension cell line of the kidney of a newborn Syrian hamster BNK-21 is used, as a supporting medium, Eagle MEM medium is used without adding serum, with the addition of enzymatic hydrolyzate of dry muscle, hydrolyzate of dried blood proteins at a pH of 7, 40-7.60.
Для инактивации вируса используют аминоэтилэтиленимин (АЭЭИ). При изготовлении сорбированной вакцины в качестве адъюванта служит гидроксид алюминия (Al(ОН)3). Очистку вируссодержащей суспензии от балластных примесей осуществляют с применением полигексаметиленгуанидин гидрохлорида (ПГМГ).Aminoethylethylenimine (AEEI) is used to inactivate the virus. When producing a sorbed vaccine, aluminum hydroxide (Al(OH) 3 ) is used as an adjuvant. Purification of the virus-containing suspension from ballast impurities is carried out using polyhexamethylene guanidine hydrochloride (PHMG).
Авирулентный и очищенный инактивированный антигенный материал из штамма вируса ящура серотипа А представляет собой суспензию, состоящую из 146S+75S компонентов вируса ящура, то есть не только полноценных иммуногенных частиц, но и «пустых» капсидов.Avirulent and purified inactivated antigenic material from a strain of foot-and-mouth disease virus serotype A is a suspension consisting of 146S+75S components of the foot-and-mouth disease virus, that is, not only full-fledged immunogenic particles, but also “empty” capsids.
Существенный недостаток вакцины-прототипа заключается в составе антигена, а именно, в использовании кроме 146S частиц еще и 75S компонента. По данным некоторых исследователей, в частности, Verlinden Y. et al. (2005), 75S частицы являются результатом неуспешной сборки вириона, либо временным хранилищем пентамеров и не является основным иммуногенным компонентом вакцинных препаратов.A significant drawback of the prototype vaccine lies in the composition of the antigen, namely, in the use of, in addition to 146S particles, a 75S component. According to some researchers, in particular, Verlinden Y. et al. (2005), 75S particles are the result of unsuccessful virion assembly, or temporary storage of pentamers and are not the main immunogenic component of vaccine preparations.
Существенный недостаток вакцины-прототипа также состоит в его очень низкой иммуногенной активности относительно штаммов/полевых изолятов вируса ящура неблизкородственного генотипа A/EURO-SA, циркулирующих в странах Африки и Южной Америки.A significant drawback of the prototype vaccine also lies in its very low immunogenic activity against strains/field isolates of foot-and-mouth disease virus of the non-closely related genotype A/EURO-SA circulating in Africa and South America.
Для решения этой проблемы было создано настоящее изобретение, в которое входила разработка вакцины против ящура генотипа A/EURO-SA из штамма «A/Египет/EURO-SA/2022» культуральной инактивированной сорбированной. Данная вакцина предполагает высокое содержание преимущественно 146S иммуногенного компонента в препарате.To solve this problem, the present invention was created, which included the development of a culture inactivated sorbed vaccine against foot and mouth disease genotype A/EURO-SA from the strain “A/Egypt/EURO-SA/2022”. This vaccine assumes a high content of predominantly 146S immunogenic component in the preparation.
Технический результат от использования предлагаемого изобретения заключается в расширении арсенала инактивированных культуральных сорбированных вакцин для защиты животных против изолятов и штаммов вируса ящура серотипа А и, в частности, генотипа A/EURO-SA.The technical result from the use of the proposed invention is to expand the arsenal of inactivated culture-sorbed vaccines to protect animals against isolates and strains of foot-and-mouth disease virus serotype A and, in particular, genotype A/EURO-SA.
Указанный технический результат достигнут созданием вакцины против ящура генотипа A/EURO-SA из штамма «A/Египет/EURO-SA/2022» культуральной инактивированной сорбированной, охарактеризованной следующей совокупностью признаков, отраженных ниже.The specified technical result was achieved by creating a vaccine against foot-and-mouth disease genotype A/EURO-SA from the strain “A/Egypt/EURO-SA/2022”, a culture-inactivated sorbed vaccine, characterized by the following set of characteristics reflected below.
Разработанная вакцина в 1,0 см3 препарата содержит следующие основные компоненты: 1) активное вещество в виде авирулентного и очищенного антигенного материала из гомологичного возбудителю инфекции штамма «A/Египет/EURO-SA/2022» (генотип A/EURO-SA) вируса ящура, репродуцированного предпочтительно в перевиваемой суспензионной клеточной линии ВНК-21/SUSP/ARRIAH, в количестве не менее 5,0 мкг; 2) гидроксид алюминия 10%-ный коллоидный раствор с содержанием 45% по объему (4,5% в пересчете на сухое вещество), 3) сапонин в количестве не менее 1,2 мг, 4) поддерживающая среда - до 1,0 см3.The developed vaccine in 1.0 cm 3 of the drug contains the following main components: 1) the active substance in the form of avirulent and purified antigenic material from the strain “A/Egypt/EURO-SA/2022” (genotype A/EURO-SA) of the virus homologous to the causative agent of the infection foot and mouth disease, preferably reproduced in the continuous suspension cell line BHK-21/SUSP/ARRIAH, in an amount of at least 5.0 μg; 2) aluminum hydroxide 10% colloidal solution containing 45% by volume (4.5% in terms of dry matter), 3) saponin in an amount of at least 1.2 mg, 4) supporting medium - up to 1.0 cm 3 .
Штамм «A/Египет/EURO-SA/2022», который получен путем адаптации изолята «А / EGY/ 2 / 2022», депонирован во Всероссийской государственной коллекции экзотических типов вирусов ящура и других патогенов животных (ГКШМ) ФГБУ «ВНИИЗЖ» под регистрационным номером: №482 - деп / 23-32 - ГКШМ ФГБУ «ВНИИЗЖ».The strain “A/Egypt/EURO-SA/2022,” which was obtained by adapting the isolate “A/EGY/ 2/2022,” was deposited in the All-Russian State Collection of Exotic Types of Foot-and-Mouth Disease Viruses and Other Animal Pathogens (GKSM) of the Federal State Budgetary Institution “ARRIAH” under registration number: No. 482 - dep / 23-32 - GKShM FSBI "ARRIAH".
Штамм адаптирован к первично-трипсинизированным монослойным клеткам линии свиной почки (СП) и перевиваемым клеточным линиям из почки новорожденного сирийского хомячка (ВНК-21/SUSP/ARRIAH), почки свиньи (IB-RS-2) и почки сибирского горного козерога (ПСГК-30).The strain is adapted to primary trypsinized monolayer cells of the porcine kidney line (SP) and continuous cell lines from newborn Syrian hamster kidney (BNK-21/SUSP/ARRIAH), pig kidney (IB-RS-2) and Siberian mountain ibex kidney (PSGK- thirty).
Для изготовления вакцины в качестве чувствительной биологической системы используют перевиваемую суспензионную культуру клеток ВНК-21/SUSP/ARRIAH, а в качестве поддерживающей среды применяют среду Игла DMEM без внесения сыворотки, но с добавлением гидролизата белков крови в количестве 5% от общего объема при рН среды 7,45-7,65. Инактивацию впервые для данного штамма при изготовлении вакцины проводят с использованием аминоэтилэтиленимина (АЭЭИ) с концентрацией 0,035% от объема вируссодержащей суспензии. Инактивированный вирус очищают от балластных примесей с помощью полигексаметиленгуанидина (ГГГМГ), который впервые относительного данного штамма при изготовлении вакцинного препарата вносят в суспензию до концентрации 0,025% от общего объема.To produce the vaccine, a continuous suspension cell culture BHK-21/SUSP/ARRIAH is used as a sensitive biological system, and Eagle DMEM medium is used as a supporting medium without adding serum, but with the addition of blood protein hydrolyzate in an amount of 5% of the total volume at pH of the medium 7.45-7.65. Inactivation for the first time for this strain during vaccine production is carried out using aminoethylethylenimine (AEEI) with a concentration of 0.035% of the volume of the virus-containing suspension. The inactivated virus is purified from ballast impurities using polyhexamethylene guanidine (GGYMG), which for the first time relative to this strain during the manufacture of the vaccine preparation is added to the suspension to a concentration of 0.025% of the total volume.
Авирулентный и очищенный антиген штамма «А/Египет/EURO-SA/2022» вируса ящура представляет собой суспензию, содержащую преимущественно инактивированный 146S иммуногенный компонент вируса ящура. Концентрацию компонента в продукте оценивают с помощью количественного варианта реакции связывания комплемента (РСК) [17]. Для приготовления вакцины используют вирусный материал, содержащий в 1,0 см3 не менее 5,0 мкг инактивированных иммуногенных 146S частиц вируса ящура. Необходимую концентрацию иммуногенного компонента в вакцинном препарате обеспечивают благодаря концентрированию антигена с помощью сорбирования на поверхности коллоидных частиц гидроксида алюминия (Al(ОН)3).The avirulent and purified antigen of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” is a suspension containing predominantly the inactivated 146S immunogenic component of the foot-and-mouth disease virus. The concentration of the component in the product is assessed using a quantitative version of the complement fixation reaction (CRR) [17]. To prepare the vaccine, use viral material containing at least 5.0 μg of inactivated immunogenic 146S particles of foot-and-mouth disease virus per 1.0 cm 3 . The required concentration of the immunogenic component in the vaccine preparation is ensured by concentrating the antigen through sorption on the surface of colloidal particles of aluminum hydroxide (Al(OH) 3 ).
Вакцину против ящура из штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA культуральную инактивированную сорбированную получают путем смешивания очищенного антигена и 10%-ной суспензии гидроксида алюминия в соотношении 55% на 45% по объему, соответственно. Для усиления иммунного ответа используют сапонин в концентрации не менее 1,2 мг/см3. Полученная вакцина представляет собой суспензию, содержащую частицы не растворимого в воде гидроксида алюминия, несущие на своей поверхности инактивированные полные частицы вируса ящура, которые обеспечивают формирование иммунитета животного организма.A culture inactivated sorbed vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA is prepared by mixing the purified antigen and a 10% suspension of aluminum hydroxide in a ratio of 55% to 45% by volume, respectively. To enhance the immune response, saponin is used at a concentration of at least 1.2 mg/cm 3 . The resulting vaccine is a suspension containing particles of water-insoluble aluminum hydroxide, carrying on its surface inactivated complete particles of the foot-and-mouth disease virus, which ensure the formation of immunity in the animal body.
Предлагаемое изобретение включает следующую совокупность существенных признаков, обеспечивающих получение технического результата во всех случаях, на которые спрашивается правовая охрана:The proposed invention includes the following set of essential features that ensure obtaining a technical result in all cases for which legal protection is sought:
1. Вакцина против ящура генотипа A/EURO-SA из штамма «A/Египет/EURO-SA/2022» культуральная инактивированная сорбированная.1. Vaccine against foot and mouth disease genotype A/EURO-SA from the strain “A/Egypt/EURO-SA/2022”, culture inactivated, sorbed.
2. Активное вещество в виде авирулентного и очищенного антигенного материала из гомологичного возбудителю заболевания штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA вируса ящура в эффективном количестве.2. The active substance in the form of avirulent and purified antigenic material from the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA homologous to the causative agent of the disease in an effective amount.
3. Целевые добавки.3. Targeted supplements.
Существенные отличительные признаки предлагаемой вакцины заключаются в том, что в качестве активного вещества она содержит авирулентный очищенный антиген штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA вируса ящура в эффективном количестве.The significant distinctive features of the proposed vaccine are that as an active substance it contains an avirulent purified antigen of the strain “A/Egypt/EURO-SA/2022” of the genotype A/EURO-SA of the foot-and-mouth disease virus in an effective amount.
Предлагаемое изобретение характеризуется также другими отличительными признаками, выражающими конкретные формы выполнения или особые условия его использования:The present invention is also characterized by other distinctive features that express specific forms of implementation or special conditions for its use:
1. Авирулентный и очищенный антиген штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA вируса ящура, полученный в высокочувствительной суспензионной перевиваемой клеточной линии BHK-21/SUSP/ARRIAH и представляющий собой суспензию, содержащую преимущественно 146S иммуногенный компонент вируса ящура в эффективном количестве.1. Avirulent and purified antigen of the strain “A/Egypt/EURO-SA/2022” of genotype A/EURO-SA of foot-and-mouth disease virus, obtained in a highly sensitive suspension continuous cell line BHK-21/SUSP/ARRIAH and representing a suspension containing predominantly 146S immunogenic component of the foot and mouth disease virus in an effective amount.
2. Авирулентный и очищенный антиген штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA вируса ящура, полученный в высокочувствительной суспензионной перевиваемой культуре клеток BHK-21/SUSP/ARRIAH и представляющий собой суспензию, содержащую преимущественно 146S иммуногенный компонент вируса ящура в количестве не менее 5,0 мкг в 1,0 см3 готового вакцинного препарата.2. Avirulent and purified antigen of the strain “A/Egypt/EURO-SA/2022” of the genotype A/EURO-SA of the foot-and-mouth disease virus, obtained in a highly sensitive suspension continuous cell culture BHK-21/SUSP/ARRIAH and representing a suspension containing predominantly 146S immunogenic component of the foot and mouth disease virus in an amount of at least 5.0 μg per 1.0 cm 3 of the finished vaccine preparation.
3. Из целевых добавок вакцина содержит адъювант.3. Among the targeted additives, the vaccine contains an adjuvant.
4. Из целевых добавок вакцина содержит адъювант - гидроксид алюминия в комплексе с сапонином.4. Of the targeted additives, the vaccine contains an adjuvant - aluminum hydroxide in combination with saponin.
5. Вакцина содержит адъювант - гидроокись алюминия 4,5% в пересчете на сухой остаток в комплексе с сапонином в концентрации 1,2 мг в 1,0 см3 готового препарата.5. The vaccine contains an adjuvant - aluminum hydroxide 4.5% in terms of dry residue in combination with saponin at a concentration of 1.2 mg per 1.0 cm 3 of the finished product.
6. Авирулентный и очищенный антиген штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA вируса ящура, полученного в перевиваемой суспензионной клеточной линии BHK-21/SUSP/ARRIAH, адъювант - гидроксид алюминия и сапонин, добавка в готовом препарате в виде поддерживающей среды в следующих количествах:6. Avirulent and purified antigen of the strain “A/Egypt/EURO-SA/2022” of the genotype A/EURO-SA of foot-and-mouth disease virus, obtained in the continuous suspension cell line BHK-21/SUSP/ARRIAH, adjuvant - aluminum hydroxide and saponin, additive in the finished product in the form of a supporting medium in the following quantities:
Предлагаемая вакцина против ящура из штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA культуральная инактивированная сорбированная обладает высокой иммуногенной активностью и обеспечивает надежную защиту против вируса ящура генотипа A/EURO-SA, циркулирующего в странах Южной Америки и Северной Африки.The proposed vaccine against foot-and-mouth disease from the strain "A/Egypt/EURO-SA/2022" genotype A/EURO-SA, cultural inactivated sorbed, has high immunogenic activity and provides reliable protection against the foot-and-mouth disease virus genotype A/EURO-SA circulating in the countries of South America and North Africa.
Достижение технического результата от использования изобретения обеспечивается тем, что в состав предлагаемой противоящурной вакцины в качестве активного вещества введен антиген штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA вируса ящура, обладающий высокой иммуногенной активностью, создающий эффективную защиту восприимчивых животных против вируса ящура представленного генотипа, которые в последние годы вызывают вспышки заболевания в странах Африки и Южной Америки.Achieving a technical result from the use of the invention is ensured by the fact that the antigen of the strain “A/Egypt/EURO-SA/2022” of the genotype A/EURO-SA of the foot-and-mouth disease virus, which has high immunogenic activity and creates effective protection, is introduced into the composition of the proposed foot-and-mouth disease vaccine as an active substance. susceptible animals against the foot-and-mouth disease virus of the presented genotype, which in recent years has caused outbreaks of the disease in Africa and South America.
Сущность изобретения отражена на графическом изображении:The essence of the invention is reflected in the graphic image:
Фиг. 1 - Дендрограмма, отражающая филогенетическое взаимоотношение штамма «A/Египет/EURO-SA/2022» вируса ящура с эпизоотическими штаммами серологического типа А. Дендрограмма основана на сравнении полных нуклеотидных последовательностей 1D-гена.Fig. 1 - Dendrogram reflecting the phylogenetic relationship of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” with epizootic strains of serological type A. The dendrogram is based on a comparison of the complete nucleotide sequences of the 1D gene.
Фиг. 2 - График кинетики инактивации вакцинного штамма «A/Египет/EURO-SA/2022» вируса ящура.Fig. 2 - Graph of the inactivation kinetics of the vaccine strain “A/Egypt/EURO-SA/2022” of the foot-and-mouth disease virus.
Сущность изобретения пояснена следующими перечнями последовательностей:The essence of the invention is illustrated by the following sequence lists:
SEQ ID NO:1 представляет последовательность нуклеотидов ID-гена белка VP1 штамма «A/Египет/EURO-SA/2022» вируса ящура генотипа A/EURO-SA;SEQ ID NO:1 represents the nucleotide sequence of the ID gene of the VP 1 protein of the strain “A/Egypt/EURO-SA/2022” of the foot-and-mouth disease virus genotype A/EURO-SA;
SEQ ID NO:2 представляет последовательность аминокислот ID-гена белка VP1 штамма «A/Египет/EURO-SA/2022» вируса ящура генотипа A/EURO-SA.SEQ ID NO:2 represents the amino acid sequence of the ID gene of the VP 1 protein of the “A/Egypt/EURO-SA/2022” strain of foot and mouth disease virus genotype A/EURO-SA.
Штамм «A/Египет/EURO-SA/2022» вируса ящура характеризуется следующими признаками и свойствами.The foot and mouth disease virus strain “A/Egypt/EURO-SA/2022” is characterized by the following characteristics and properties.
Морфологические признакиMorphological characteristics
Штамм «A/Египет/EURO-SA/2022» вируса ящура серотипа А относится к отряду Picornavirales, семейству Picornaviridae, роду Aphthovirus, виду Foot-and-Mouth Disease Virus и обладает морфологическими признаками, характерными для возбудителя ящура: форма вириона иксаэдрическая, размер 22 нм. Вирион состоит из молекулы одноцепочечной молекулы РНК с позитивным смыслом, заключенной в белковую оболочку, которая состоит из 32 капсомеров.Strain “A/Egypt/EURO-SA/2022” of foot-and-mouth disease virus serotype A belongs to the order Picornavirales, family Picornaviridae, genus Aphthovirus, species Foot-and-Mouth Disease Virus and has morphological characteristics characteristic of the causative agent of foot-and-mouth disease: virion shape is ixahedral, size 22 nm. The virion consists of a single-stranded positive-sense RNA molecule enclosed in a protein shell that consists of 32 capsomers.
Антигенные свойстваAntigenic properties
По антигенным свойствам штамм «А/Египет/EURO-SA/2022» вируса ящура относится к серотипу А. Вирус стабильно нейтрализуется гомологичной антисывороткой. Вирус не проявляет гемагглютинирующей активности. У переболевших животных в сыворотке крови образуются типоспецифические антитела, выявляемые в иммуноферментном анализе и реакции микронейтрализации (РМН).According to its antigenic properties, the strain “A/Egypt/EURO-SA/2022” of the foot-and-mouth disease virus belongs to serotype A. The virus is stably neutralized by a homologous antiserum. The virus does not exhibit hemagglutinating activity. In recovered animals, type-specific antibodies are formed in the blood serum, which are detected in an enzyme-linked immunosorbent assay and microneutralization reaction (RMN).
Методом нуклеотидного секвенирования определена первичная структура ID-гена, который кодирует аминокислотную последовательность белка VP1 штамма «A/Египет/EURO-SA/2022» вируса ящура. Сравнительный анализ нуклеотидных последовательностей показал, что штамм «A/Египет/EURO-SA/2022» вируса ящура принадлежит к генотипу A/EURO-SA (Фиг. 1).Using the nucleotide sequencing method, the primary structure of the ID gene, which encodes the amino acid sequence of the VP 1 protein of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022,” was determined. Comparative analysis of nucleotide sequences showed that the “A/Egypt/EURO-SA/2022” strain of foot-and-mouth disease virus belongs to the A/EURO-SA genotype (Fig. 1).
Антигенное родство (r1) штамма «A/Египет/EURO-SA/2022» вируса ящура изучено в перекрестном исследовании штамма со специфическими сыворотками, полученными на производственные штаммы вируса ящура в РМН.The antigenic affinity (r 1 ) of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” was studied in a cross-study of the strain with specific sera obtained for industrial strains of the foot-and-mouth disease virus in the Russian Medical Academy.
Титр референтных сывороток крови КРС, полученных путем иммунизации животных моновалентными вакцинами из производственных штаммов вируса ящура серотипа А, против 100 ТЦД50 гомологичного и гетерологичного вируса определяли в РМН при перекрестном титровании, рассчитывая значения с использованием уравнения линейной регрессии, и выражали в 1g. Значение r1 определяли, как антилогарифм разности 1g титров сыворотки против гетерологичного и гомологичного вируса [1, 17, 18].The titer of reference cattle blood sera obtained by immunizing animals with monovalent vaccines from production strains of foot-and-mouth disease virus serotype A against 100 TCD 50 of homologous and heterologous virus was determined in RMN with cross-titration, calculating values using a linear regression equation, and expressed in 1g. The r 1 value was determined as the antilogarithm of the difference between 1g serum titers against heterologous and homologous viruses [1, 17, 18].
Значение r1 в РМН интерпретировали следующим образом:The value of r 1 in the RMN was interpreted as follows:
при ≥0,3 - исследуемый и производственный штаммы вируса ящура являются близкородственными;at ≥0.3 - the studied and production strains of foot-and-mouth disease virus are closely related;
при <0,3 - исследуемый образец штамма вируса ящура отличается от производственного штамма.at <0.3 - the studied sample of the foot-and-mouth disease virus strain differs from the production strain.
Показатели антигенного родства при изучении штамма «A/Египет/EURO-SA/2022» составили r1 от 0,02 до 0,22, что свидетельствует об отсутствии антигенного родства с производственными штаммами вируса ящура серотипа А (табл. 1).Indicators of antigenic relatedness when studying the strain “A/Egypt/EURO-SA/2022” amounted to r 1 from 0.02 to 0.22, which indicates the absence of antigenic relatedness with production strains of foot-and-mouth disease virus serotype A (Table 1).
Гено- и хемотаксономическая характеристикиGeno- and chemotaxonomic characteristics
Штамм «A/Египет/EURO-SA/2022» вируса ящура является РНК (+) - содержащим вирусом с молекулярной массой 6,99×106 Д. Нуклеиновая кислота представлена одноцепочной линейной молекулой молекулярной массой 2,80×106 Д. Вирион имеет белковую оболочку, состоящую только из четырех белков VP1, VP2, VP3 и VP4. Выделяют следующие основные неструктурные функциональные белки вируса ящура: 2А, 2В, 2С, 3А, 3B1, 3В2, 3В3, 3С, 3D.Strain “A/Egypt/EURO-SA/2022” of foot-and-mouth disease virus is an RNA (+)-containing virus with a molecular weight of 6.99×10 6 D. Nucleic acid is represented by a single-chain linear molecule with a molecular weight of 2.80×10 6 D. Virion has a protein shell consisting of only four proteins VP 1 , VP 2 , VP 3 and VP 4 . The following main non-structural functional proteins of the foot-and-mouth disease virus are distinguished: 2A, 2B, 2C, 3A, 3B 1 , 3B 2 , 3B 3 , 3C, 3D.
Основным антигенным белком является VP1. В вирионе содержится приблизительно 31,5% РНК и 68,5% белка. Вирусная положительно заряженная РНК является инфекционной и участвует в образовании белков-предшественников в инфицированных клетках.The main antigenic protein is VP 1 . The virion contains approximately 31.5% RNA and 68.5% protein. Viral positively charged RNA is infectious and is involved in the formation of precursor proteins in infected cells.
Физические свойстваPhysical properties
Масса вириона составляет 8,41×10-18 г. Плавучая плотность 1,42 г/см3.The mass of the virion is 8.41×10 -18 g. The buoyant density is 1.42 g/cm 3 .
Устойчивость к внешним факторамResistance to external factors
Штамм «A/Египет/EURO-SA/2022» вируса ящура устойчив к эфиру, хлороформу, и ацетону. Наиболее стабилен при рН 7,43-7,70. Сдвиги рН в кислую и сильно щелочную сторону ведут к инактивации вируса. Чувствителен к формальдегиду, УФ-облучению, γ-облучению, высоким температурам (выше 37,6°С).Strain “A/Egypt/EURO-SA/2022” of foot and mouth disease virus is resistant to ether, chloroform, and acetone. Most stable at pH 7.43-7.70. Shifts in pH to the acidic and strongly alkaline side lead to inactivation of the virus. Sensitive to formaldehyde, UV irradiation, γ-irradiation, high temperatures (above 37.6°C).
Дополнительные признаки и свойства авирулентного штамма, примененного в вакцинеAdditional characteristics and properties of the avirulent strain used in the vaccine
Реактогенность - реактогенными свойствами не обладает.Reactogenicity - does not have reactogenic properties.
Патогенность - антигена не патогенен для парнокопытных животных.Pathogenicity - the antigen is not pathogenic for artiodactyl animals.
Вирулентность - антиген не вирулентен для естественно-восприимчивых животных при контактном, аэрозольном и парентеральном заражении.Virulence - the antigen is not virulent for naturally susceptible animals during contact, aerosol and parenteral infection.
Стабильность - не инактивированный вирус ящура сохраняет исходные биологические свойства при пассировании в чувствительных биологических системах в течение 5 пассажей (срок наблюдения) на перевиваемых культурах.Stability - non-inactivated foot-and-mouth disease virus retains its original biological properties when passivated in sensitive biological systems for 5 passages (observation period) on continuous crops.
Биотехнологические характеристикиBiotechnological characteristics
Штамм «A/Египет/EURO-SA/2022» вируса ящура репродуцируется в перевиваемых культурах клеток: почки сибирского горного козерога (ПСГК-30), почки свиньи (IB-RS-2), почки сирийского хомячка (ВНК-21).The foot and mouth disease virus strain “A/Egypt/EURO-SA/2022” is reproduced in continuous cell cultures: Siberian mountain ibex kidneys (PSGK-30), pig kidneys (IB-RS-2), Syrian hamster kidneys (VNK-21).
Для снижения эпизоотической опасности возникновения ящура, вызванного генотипом A/EURO-SA, и предотвращения возникновения новых очагов болезни важна своевременная вакцинопрофилактика, что требует разработки высокоиммуногенной и эффективной вакцины против ящура из штамма «A/Египет/EURO-SA/2022».To reduce the epizootic risk of foot and mouth disease caused by the A/EURO-SA genotype and prevent the emergence of new foci of the disease, timely vaccine prevention is important, which requires the development of a highly immunogenic and effective vaccine against foot and mouth disease from the “A/Egypt/EURO-SA/2022” strain.
В итоге получена высокоиммуногенная и эффективная вакцина против ящура генотипа A/EURO-SA из штамма «A/Египет/EURO-SA/2022» культуральная инактивированная сорбированная.As a result, a highly immunogenic and effective vaccine against foot and mouth disease genotype A/EURO-SA from the strain “A/Egypt/EURO-SA/2022”, culture inactivated, sorbed, was obtained.
Сущность предлагаемого изобретения пояснена примерами его использования, которые не ограничивают объем изобретения.The essence of the proposed invention is illustrated by examples of its use, which do not limit the scope of the invention.
Пример 1. Генетическая характеристика штамма «А/Египет/EURO-SA/2022» вируса ящура по данным ПЦР и нуклеотидного секвенирования.Example 1. Genetic characteristics of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” according to PCR and nucleotide sequencing data.
Проведенные исследования заключались в изучении первичной структуры 1D-гена (белок VP1) (663 н.о.) штамма «A/Египет/EURO-SA/2022» вируса ящура методом нуклеотидного секвенирования по Сенгеру и определении положения данного штамма на филогенетическом древе вируса ящура серотипа А. Метод основан на определении первичной структуры 1D-гена испытуемого изолята/штамма с последующим анализом филогенетического родства с другими изолятами вируса ящура серотипа А.The studies carried out consisted of studying the primary structure of the 1D gene (VP 1 protein) (663 nt) of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” using Sanger nucleotide sequencing and determining the position of this strain on the phylogenetic tree of the virus foot-and-mouth disease serotype A. The method is based on determining the primary structure of the 1D gene of the tested isolate/strain, followed by analysis of phylogenetic relationship with other isolates of foot-and-mouth disease virus serotype A.
Провели сравнительный анализ нуклеотидных последовательностей 1D-гена, кодирующего белок VP1 вируса ящура вакцинного штамма «A/Египет/EURO-SA/2022» с другими изолятами и штаммами. Филогенетическое дерево выведено с использованием программы MEGA 7 и алгоритма Neighbor-Joining. Процент повторяющихся ветвей, в которых связанные таксоны сгруппированы вместе в тесте начальной загрузки (1000 повторов), показан рядом с ветвями. Эволюционные расстояния были рассчитаны с использованием метода Maximum Composite Likelihood и выражены в единицах количества замен оснований на сайт. Этот анализ включал 34 нуклеотидных последовательностей, в том числе последовательность 1D-гена штамма «А/Египет/EURO-SA/2022» вируса ящура. Все позиции, содержащие пробелы и отсутствующие данные, были удалены (вариант полного удаления). В окончательном наборе данных было всего 663 позиций. Эволюционный анализ проводился в MEGA 7.A comparative analysis of the nucleotide sequences of the 1D gene encoding the VP 1 protein of the foot-and-mouth disease virus vaccine strain “A/Egypt/EURO-SA/2022” with other isolates and strains was carried out. The phylogenetic tree was inferred using the MEGA 7 program and the Neighbor-Joining algorithm. The percentage of replicate branches in which related taxa cluster together in the bootstrap test (1000 replicates) is shown next to the branches. Evolutionary distances were calculated using the Maximum Composite Likelihood method and expressed in units of the number of base substitutions per site. This analysis included 34 nucleotide sequences, including the sequence of the 1D gene of the A/Egypt/EURO-SA/2022 strain of foot and mouth disease virus. All items containing spaces and missing data were removed (complete deletion option). There were a total of 663 items in the final data set. Evolutionary analysis was carried out in MEGA 7.
В результате проведенной работы по сравнению полных нуклеотидных последовательностей 1D-гена (белок VP1) штамма «A/Египет/EURO-SA/2022» и других изолятов/штаммов вируса ящура серотипа A/EURO-SA определено положение представленного штамма на филогенетическом древе (фиг. 1).As a result of the work carried out by comparing the complete nucleotide sequences of the 1D gene (VP 1 protein) of the strain “A/Egypt/EURO-SA/2022” and other isolates/strains of foot-and-mouth disease virus serotype A/EURO-SA, the position of the presented strain on the phylogenetic tree was determined ( Fig. 1).
Таким образом, по результатам генетического исследования вакцинный штамм «A/Египет/EURO-SA/2022» относится к генотипу A/EURO-SA, что подтверждают данные нуклеотидного и аминокислотного анализа.Thus, according to the results of a genetic study, the vaccine strain “A/Egypt/EURO-SA/2022” belongs to the A/EURO-SA genotype, which is confirmed by nucleotide and amino acid analysis data.
Пример 2. Адаптация штамма «A/Египет/EURO-SA/2022» к перевиваемой монослойной культуре клеток почки сибирского горного козерога ПСГК-30.Example 2. Adaptation of the strain “A/Egypt/EURO-SA/2022” to a continuous monolayer culture of kidney cells of the Siberian mountain ibex PSGK-30.
Для заражения перевиваемой монослойной культуры клеток почки сибирского горного козерога ПСГК-30 использовали 33%-ную афтозную суспензию вируса ящура, полученную из афт КРС (2 пассаж). Посевная концентрация клеток составляла 0,35-0,40 млн кл./см3, доза заражения вирусом - 0,001 ТЦД50/кл. По результатам исследования репродукция вируса ящура штамма «A/Египет/EURO-SA/2022» проходила при специфическом разрушении монослоя на 95-100% за 15-16 ч. В течение 6 последовательных пассажей отмечали рост значений титра инфекционной активности вируса от 5,75±0,10 до 7,25±0,10 1g ТЦД50/см3.To infect a continuous monolayer cell culture of Siberian mountain ibex kidney cells PSGK-30, a 33% aphthous suspension of foot-and-mouth disease virus obtained from bovine aphthae (passage 2) was used. The inoculating cell concentration was 0.35-0.40 million cells/cm 3 , the virus infection dose was 0.001 TCD 50 /cell. According to the results of the study, the reproduction of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” took place with a specific destruction of the monolayer by 95-100% in 15-16 hours. Over the course of 6 consecutive passages, an increase in the titer of infectious activity of the virus from 5.75 was noted ±0.10 to 7.25±0.10 1g TCD 50 /cm 3 .
Максимальное значение титра инфекционной активности вируса было достигнуто на этапе 6 пассажа (7,25±0,10 1g ТЦД50/см3). Концентрация 146S частиц с 1 по 6 пассажи изменялась с 0,30±0,03 до 0,92±0,03 мкг/см3. При этом наибольшее количество 146S компонента отмечали на этапе 6 пассажа (0,92±0,03 мкг/см3). Степень достоверности (R2) результатов исследования в количественном варианте ОТ-ПЦР-РВ колебалась от 98,33 до 100,00%. Таким образом, на протяжении 6-ти последовательных пассажей успешно проведена адаптация штамма «A/Египет/EURO-SA/2022» вируса ящура к перевиваемой монослойной клеточной линии ПСГК-30.The maximum titer of infectious activity of the virus was achieved at stage 6 of passage (7.25±0.10 1g TCD 50 /cm 3 ). The concentration of 146S particles from passages 1 to 6 changed from 0.30±0.03 to 0.92±0.03 μg/ cm3 . In this case, the largest amount of the 146S component was noted at stage 6 of passage (0.92±0.03 μg/cm 3 ). The degree of reliability (R 2 ) of the study results in the quantitative version of RT-PCR-RT ranged from 98.33 to 100.00%. Thus, over the course of 6 consecutive passages, the adaptation of the foot and mouth disease virus strain “A/Egypt/EURO-SA/2022” to the continuous monolayer cell line PSGK-30 was successfully carried out.
Пример 3. Изучение условий монослойного культивирования вируса ящура штамма «A/Египет/EURO-SA/2022» в промышленных масштабах.Example 3. Study of conditions for monolayer cultivation of foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” on an industrial scale.
В процессе промышленного культивирования штамма «A/Египет/EURO-SA/2022» вируса ящура в перевиваемой монослойной культуре клеток ПСГК-30 осуществляли подбор оптимальных условий культивирования вируса, анализируя разный состав поддерживающей среды, температурный фактор и дозу заражения клеток.In the process of industrial cultivation of the strain “A/Egypt/EURO-SA/2022” of the foot-and-mouth disease virus in a continuous monolayer cell culture PSGK-30, the optimal conditions for cultivating the virus were selected, analyzing the different composition of the supporting medium, the temperature factor and the dose of infection of the cells.
На первом этапе исследования оценивали влияние состава поддерживающей среды на репродукцию штамма «A/Египет/EURO-SA/2022» вируса ящура в монослойной культуре клеток ПСГК-30 в масштабах производства (на этапе с 5-ого на 6-ой пассажи). Для сравнения применяли три среды с добавлением 2% фетальной сыворотки крови телят: 1) среда Игла DMEM; 2) среда RPMI-1640; 3) раствор Хэнкса с 5,0% гидролизата белков крови. Посевная концентрация клеток составляла 0,35-0,40 млн кл./см3, доза заражения вирусом - 0,1000-0,0001 ТЦД50/кл. Культивирование вируса осуществляли при температурах (35±0,02) - (38±0,02)°С до разрушения клеточного монослоя на 95-100% в течение 10-27 ч. Результаты репродукции штамма «А/Египет/EURO-SA/2022» вируса ящура с поддерживающими средами разного состава отражены в таблице 2.At the first stage of the study, the effect of the composition of the supporting medium on the reproduction of the “A/Egypt/EURO-SA/2022” strain of foot-and-mouth disease virus in a monolayer cell culture PSGK-30 was assessed on a production scale (at the stage from the 5th to the 6th passages). For comparison, three media were used with the addition of 2% fetal calf serum: 1) Eagle's medium DMEM; 2) RPMI-1640 environment; 3) Hanks solution with 5.0% blood protein hydrolyzate. The inoculating cell concentration was 0.35-0.40 million cells/cm 3 , the dose of virus infection was 0.1000-0.0001 TCD 50 /cell. Cultivation of the virus was carried out at temperatures (35±0.02) - (38±0.02)°C until the cell monolayer was destroyed by 95-100% within 10-27 hours. Results of reproduction of the strain “A/Egypt/EURO-SA/ 2022" foot-and-mouth disease virus with supporting media of different compositions are shown in Table 2.
Из данных таблицы 2 видно, что при репродукции штамма «A/Египет/EURO-SA/2022» вируса ящура в монослойной культуре клеток ПСГК-30 с применением поддерживающих сред разного состава, оптимальной является среда Игла DMEM, позволяющая за 10 ч достичь специфического разрушения клеточного монослоя на 95-100% с накоплением в полученной суспензии 146S компонента в количестве 0,92±0,03 мкг/см3 и титром инфекционной активности 7,25±0,10 1g ТЦД50/см3. При использовании среды RPMI-1640 и раствора Хэнкса показатели репродукции вируса были ниже.From the data in Table 2 it is clear that when reproducing the strain “A/Egypt/EURO-SA/2022” of the foot-and-mouth disease virus in a monolayer cell culture PSGK-30 using supporting media of different compositions, the optimal medium is Eagle DMEM, which allows achieving specific destruction in 10 hours cell monolayer by 95-100% with accumulation of the 146S component in the resulting suspension in an amount of 0.92±0.03 μg/cm 3 and an infectious activity titer of 7.25±0.10 1g TCD 50 /cm 3 . Viral reproduction rates were lower when using RPMI-1640 medium and Hanks' solution.
На следующем этапе изучения условий монослойного культивирования штамма «A/Египет/EURO-SA/2022» вируса ящура в культуре клеток ПСГК-30 в условиях производства оценивали влияние на процесс репродукции вируса температурного фактора. Для этого культивирование вируса проводили в среде Игла DMEM с 2% сыворотки КРС при следующих температурах: 35,0±0,02; 36,0±0,02; 37,0±0,02; 38,0±0,02°С. Доза заражения культуры клеток вирусом ящура составляла 0,010-0,001 ТЦД50/кл. Культивирование вируса осуществляли до разрушения клеточного монослоя на 80-100% в течение 10-27 ч (табл. 2). По итогам исследования выявили, что для полной репродукции штамма «A/Египет/EURO-SA/2022» вируса ящура в монослойной культуре клеток ПСГК-30 оптимальной является температура среды 37,0±0,02°С, при которой за 10 ч развитие ЦПД достигало 95-100% с накоплением 146S частиц, равным 0,92±0,03 мкг/см3 и титром инфекционной активности вируса 7,25±0,10 1g ТЦД50/см3.At the next stage of studying the conditions for monolayer cultivation of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” in the PSGK-30 cell culture under production conditions, the influence of the temperature factor on the virus reproduction process was assessed. To do this, the virus was cultivated in Eagle's medium DMEM with 2% cattle serum at the following temperatures: 35.0±0.02; 36.0±0.02; 37.0±0.02; 38.0±0.02°C. The dose of infection of the cell culture with the foot-and-mouth disease virus was 0.010-0.001 TCD 50 /cell. The virus was cultivated until the cell monolayer was destroyed by 80-100% within 10-27 hours (Table 2). Based on the results of the study, it was revealed that for complete reproduction of the strain “A/Egypt/EURO-SA/2022” of the foot-and-mouth disease virus in a monolayer culture of PSGK-30 cells, the optimal temperature is 37.0±0.02°C, at which in 10 hours the development The CPE reached 95-100% with the accumulation of 146S particles equal to 0.92±0.03 μg/cm 3 and the titer of infectious activity of the virus 7.25±0.10 1g TCD 50 /cm 3 .
Оценивали влияние дозы заражения монослоя клеток линии ПСГК-30 штаммом «А/Египет/EURO-SA/2022» при культивировании в масштабах производства. Для этого использовали разные дозы вируса: 0,10-0,01; 0,010-0,001; 0,0010-0,0001 ТЦД50/кл. В качестве поддерживающей среды применяли среду Игла MEM с 2% сыворотки крови КРС. Репродукцию вируса проводили при температуре 37,0±0,02°С в течение 10-23 ч до специфического разрушения клеток на 90-100%. По итогам культивирования определяли концентрацию 146S компонента и титр инфекционной активности вируса ящура. Как следует из данных таблицы 2, наибольшее накопление «полных» частиц вируса достигалось при дозе заражения 0,01-0,001 ТЦД50/кл. и составило 0,92±0,03 мкг/см3 с титром инфекционной активности вируса 7,25±0,10 1g ТЦД50/см3.We assessed the effect of the dose of infection of a monolayer of PSGK-30 cells with the strain “A/Egypt/EURO-SA/2022” during cultivation on a production scale. For this, different doses of the virus were used: 0.10-0.01; 0.010-0.001; 0.0010-0.0001 TCD 50 /cl. Eagle's MEM medium with 2% cattle blood serum was used as a supporting medium. Virus reproduction was carried out at a temperature of 37.0±0.02°C for 10-23 hours until specific cell destruction was 90-100%. Based on the results of cultivation, the concentration of the 146S component and the titer of infectious activity of the foot-and-mouth disease virus were determined. As follows from the data in Table 2, the greatest accumulation of “full” virus particles was achieved at an infection dose of 0.01-0.001 TCD 50 /cell. and amounted to 0.92±0.03 μg/cm 3 with a titer of infectious activity of the virus of 7.25±0.10 1g TCD 50 /cm 3 .
Таким образом, проведено изучение условий монослойного культивирования штамма «А/Египет/EURO-SA/2022» вируса ящура в культуре клеток ПСГК-30 в промышленных масштабах. В результате исследования определены следующие оптимальные параметры репродукции штамма «А/Египет/EURO-SA/2022» вируса ящура в монослойной клеточной линии ПСГК-30: 1) поддерживающая среда - среда Игла DMEM; 2) температурный режим культивирования - 37,0±0,02°С; 3) доза заражения вирусом - 0,01-0,001 ТЦД50/кл.Thus, the conditions for monolayer cultivation of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” in PSGK-30 cell culture on an industrial scale were studied. As a result of the study, the following optimal parameters for the reproduction of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” in the monolayer cell line PSGK-30 were determined: 1) maintenance medium - Eagle medium DMEM; 2) cultivation temperature - 37.0±0.02°C; 3) dose of virus infection - 0.01-0.001 TCD 50 / cell.
Пример 4. Изучение условий суспензионного культивирования штамма «A/Египет/EURO-SA/2022» вируса ящура в промышленных масштабах.Example 4. Study of conditions for suspension cultivation of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” on an industrial scale.
При промышленном культивирования штамма «А/Египет/EURO-SA/2022» вируса ящура в перевиваемой высокочувствительной суспензионной культуре клеток ВНК-21/SUSP/ARRIAH проводили поиск оптимальных параметров для успешной репродукции возбудителя ящура, используя разные концентрации клеток, температуру и дозу заражения.During the industrial cultivation of the strain “A/Egypt/EURO-SA/2022” of the foot-and-mouth disease virus in a continuous highly sensitive suspension cell culture BHK-21/SUSP/ARRIAH, a search was made for optimal parameters for the successful reproduction of the foot-and-mouth disease pathogen, using different cell concentrations, temperatures and infection doses.
На первом этапе работы определяли влияние посевной концентрации клеток линии ВНК-21/SUSP/ARRIAH в суспензии на репродукцию штамма «А/Египет/EURO-SA/2022» вируса ящура в промышленных масштабах. Для анализа подготовили суспензии со следующими концентрации клеток: 2,5; 3,0; 3,5; 4,0 млн кл./см3. Водородный показатель рН поддерживали в диапазоне 7,45-7,65. Температура культивирования вируса составляла 37,0±0,02°С, доза заражения вирусом - 0,010-0,001 ТЦД50/кл. Репродукцию вируса проводили до специфической гибели клеток на 95-100%, которая осуществлялась в течение 8-9 ч.At the first stage of the work, the effect of the seeding concentration of cells of the BHK-21/SUSP/ARRIAH line in suspension on the reproduction of the “A/Egypt/EURO-SA/2022” strain of foot-and-mouth disease virus on an industrial scale was determined. Suspensions with the following cell concentrations were prepared for analysis: 2.5; 3.0; 3.5; 4.0 million cells/ cm3 . The pH value was maintained in the range of 7.45-7.65. The virus cultivation temperature was 37.0±0.02°C, the dose of virus infection was 0.010-0.001 TCD 50 /cell. Virus reproduction was carried out until specific cell death was 95-100%, which occurred within 8-9 hours.
Результаты суспензионного культивирования штаммаResults of suspension cultivation of the strain
«A/Египет/EURO-SA/2022» вируса ящура в суспензии с разными концентрациями клеток представлены в таблице 3, из которой следует, что при культивировании вируса ящура указанного штамма в суспензионной клеточной линии ВНК-21/SUSP/ARRIAH с разными концентрациями клеток, определили, что накопление 146S компонента в суспензии с концентрацией клеток 2,5 млн кл./см3 составило 0,49±0,03 мкг/см3, с концентрацией 3,0 млн кл./см3 - 0,95±0,03 мкг/см3, с концентрацией 3,5 млн кл./см3 - 1,26±0,03 мкг/см3, и с концентрацией 4,0 млн кл./см3 - 1,31±0,03 мкг/см3. Как следует из полученных данных для репродукции штамма «A/Египет/EURO-SA/2022» вируса ящура оптимальной является концентрация клеток ВНК-21/SUSP/ARRIAH в суспензии, равная 3,5 млн кл./см3. Значение титра инфекционной активности вируса при этом составило 9,25±0,10 1g ТЦД50/см3. Большая концентрация клеток позволяла получить такой же выход продукта с небольшим увеличением. С экономической точки зрения, таким образом, для репродукции штамма «А/Египет/EURO-SA/2022» вируса ящура оптимально использовать суспензию клеток линии ВНК-21/SUSP/ARRIAH с концентрацией 3,5 млн кл./см3.“A/Egypt/EURO-SA/2022” foot-and-mouth disease virus in suspension with different cell concentrations are presented in Table 3, from which it follows that when cultivating the foot-and-mouth disease virus of the specified strain in the suspension cell line BHK-21/SUSP/ARRIAH with different cell concentrations , determined that the accumulation of the 146S component in a suspension with a cell concentration of 2.5 million cells/cm 3 was 0.49 ± 0.03 μg/cm 3 , with a concentration of 3.0 million cells/cm 3 - 0.95 ± 0.03 µg/cm 3 , with a concentration of 3.5 million cells/cm 3 - 1.26±0.03 µg/cm 3 , and with a concentration of 4.0 million cells/cm 3 - 1.31±0 .03 µg/ cm3 . As follows from the data obtained, for the reproduction of the strain “A/Egypt/EURO-SA/2022” of the foot-and-mouth disease virus, the optimal concentration of BHK-21/SUSP/ARRIAH cells in the suspension is equal to 3.5 million cells/cm 3 . The titer of infectious activity of the virus was 9.25±0.10 1g TCD 50 /cm 3 . A higher concentration of cells made it possible to obtain the same product yield with a slight increase. From an economic point of view, therefore, for the reproduction of the “A/Egypt/EURO-SA/2022” strain of foot-and-mouth disease virus, it is optimal to use a cell suspension of the BHK-21/SUSP/ARRIAH line with a concentration of 3.5 million cells/cm 3 .
На следующем этапе работы исследовали влияние фактора температуры на суспензионное культивирование штамма «А/Египет/EURO-SA/2022» вируса ящура в культуре клеток линии ВНК-21/SUSP/ARRIAH в промышленных масштабах. Для этого репродукцию вируса проводили при следующих температурных условиях: 35,0±0,02; 36,0±0,02; 37,0±0,02; 38,0±0,02°С. Доза заражения культуры клеток вирусом составляла 0,010-0,001 ТЦД50/кл. Водородный показатель рН вирусной суспензии поддерживали в диапазоне 7,45-7,65. Культивирование вируса проводили до ЦПД, равного 90-100%, в течение 8-23 ч. По результатам анализа определили, что для полной репродукции штамма «А/Египет/EURO-SA/2022» вируса ящура в суспензионной культуре клеток ВНК-21/SUSP/ARRIAH оптимальной является температура среды 37,0±0,02°С, при которой в течение 8-9 ч наблюдается специфическая гибель клеток на 95-100% с высоким накоплением 146S компонента 1,26±0,03 мкг/см3 и титром инфекционной активности вируса 9,25±0,10 1g ТЦД50/см3.At the next stage of the work, we studied the effect of temperature on the suspension cultivation of the “A/Egypt/EURO-SA/2022” strain of foot-and-mouth disease virus in a cell culture of the BHK-21/SUSP/ARRIAH line on an industrial scale. For this purpose, virus reproduction was carried out under the following temperature conditions: 35.0±0.02; 36.0±0.02; 37.0±0.02; 38.0±0.02°C. The dose of infection of the cell culture with the virus was 0.010-0.001 TCD 50 /cell. The pH value of the viral suspension was maintained in the range of 7.45-7.65. Cultivation of the virus was carried out to a CPE of 90-100% for 8-23 hours. Based on the results of the analysis, it was determined that for complete reproduction of the strain “A/Egypt/EURO-SA/2022” of the foot-and-mouth disease virus in a suspension culture of BHK-21/ SUSP/ARRIAH the optimal temperature is 37.0±0.02°C, at which 95-100% specific cell death is observed within 8-9 hours with a high accumulation of the 146S component of 1.26±0.03 μg/ cm3 and the titer of infectious activity of the virus is 9.25±0.10 1g TCD 50 /cm 3 .
В ходе работы по изучению условий суспензионного культивирования штамма «A/Египет/EURO-SA/2022» вируса ящура в промышленных масштабах с применением культуры клеток ВНК-21/SUSP/ARRIAH оценивали влияние дозы заражения клеток. Для этого клеточные суспензии заражали вирусом в разных дозах: 0,10-0,01; 0,01-0,001; 0,001-0,0001 ТЦД50/кл. Репродукцию вируса осуществляли при температуре 37,0±0,02°С в течение 8-23 ч до цитопатического действия, равного 90-95%. По итогам культивирования определяли концентрацию 146S частиц и титр инфекционной активности вируса ящура. Как видно из данных таблицы 3, наибольшее накопление 146S компонента отмечали при дозе заражения 0,10-0,01 ТЦД50/кл. (1,26±0,03 мкг/см3) с титром инфекционной активности вируса, равным 9,25±0,10 1g ТЦД50/см3.In the course of work to study the conditions for suspension cultivation of the “A/Egypt/EURO-SA/2022” strain of foot-and-mouth disease virus on an industrial scale using cell culture BHK-21/SUSP/ARRIAH, the effect of the dose of cell infection was assessed. To do this, cell suspensions were infected with the virus in different doses: 0.10-0.01; 0.01-0.001; 0.001-0.0001 TCD 50 /cl. Virus reproduction was carried out at a temperature of 37.0±0.02°C for 8-23 hours until the cytopathic effect was 90-95%. Based on the results of cultivation, the concentration of 146S particles and the titer of infectious activity of the foot-and-mouth disease virus were determined. As can be seen from the data in Table 3, the greatest accumulation of the 146S component was observed at an infection dose of 0.10-0.01 TCD 50 /cell. (1.26±0.03 μg/cm 3 ) with a titer of infectious activity of the virus equal to 9.25±0.10 1g TCD 50 /cm 3 .
Таким образом, проведено изучение параметров суспензионного культивирования штамма «A/Египет/EURO-SA/2022» вируса ящура в суспензионной клеточной линии ВНК-21/SUSP/ARRIAH в промышленных масштабах. Выявлены оптимальные условия репродукции штамма «А/Египет/EURO-SA/2022» в суспензионной культуре клеток ВНК-21: 1) концентрация клеток перед заражением - 3,5 млн кл./см3; 2) температурный режим культивирования - 37,0±0,02°С; 3) доза заражения вирусом - 0,010-0,001 ТЦД50/кл.Thus, the parameters of suspension cultivation of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” in the suspension cell line BHK-21/SUSP/ARRIAH on an industrial scale were studied. The optimal conditions for the reproduction of the strain “A/Egypt/EURO-SA/2022” in the suspension culture of BNK-21 cells were identified: 1) cell concentration before infection - 3.5 million cells/cm 3 ; 2) cultivation temperature - 37.0±0.02°C; 3) dose of virus infection - 0.010-0.001 TCD 50 / cell.
Пример 5. Инактивация суспензии вируса ящура штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA.Example 5. Inactivation of a suspension of foot and mouth disease virus strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA.
По окончании цикла репродукции вируса ящура, не прекращая процесс термостатирования (37,0±0,02°С), в вируссодержащую суспензию добавляли подкисленный раствор аминоэтилэтиленимина (АЭЭИ) с рН, равным 8,2-8,3. Конечная концентрация АЭЭИ в вируссодержащей суспензии должна быть равной 0,035%. Инактивацию инфекционной активности вируса ящура штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA проводили в течение 12 часов при температуре 37,0±0,1°С и рН 7,45-7,65 с перемешиванием.At the end of the reproduction cycle of the foot-and-mouth disease virus, without stopping the thermostatting process (37.0±0.02°C), an acidified solution of aminoethylethylenimine (AEEI) with a pH of 8.2-8.3 was added to the virus-containing suspension. The final concentration of AEEI in the virus-containing suspension should be equal to 0.035%. Inactivation of the infectious activity of foot and mouth disease virus strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA was carried out for 12 hours at a temperature of 37.0±0.1°C and pH 7.45-7.65 with stirring .
Для определения времени полной инактивации после добавления АЭЭИ каждый час производили отбор проб. Полученные образцы проверяли на наличие инфекционной активности вируса ящура в первичной культуре клеток почки свиньи СП. Результаты представлены на фиг. 2, из данных которой видно, что полная инактивация вируса ящура штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA, репродуцированного в культиваторах, произошла через 3 часа после внесения АЭЭИ. При этом спустя 12 ч содержание вирусных частиц в суспензии антигена составило 10-21 ТЦД50/см3.To determine the time of complete inactivation after adding AEEI, samples were taken every hour. The obtained samples were tested for the presence of infectious activity of the foot-and-mouth disease virus in the primary culture of pig kidney cells SP. The results are presented in Fig. 2, from which it is clear that complete inactivation of the foot and mouth disease virus strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA, reproduced in cultivators, occurred 3 hours after the application of AEEI. Moreover, after 12 hours, the content of viral particles in the antigen suspension was 10 -21 TCD 50 /cm 3 .
Готовые вирусные инактивированные суспензии исследовали в РСК для оценки содержания в них компонентов вируса. Концентрация 146S компонента составила 1,24±0,03 мкг/см3 (80,3% от концентрации общего вирусного белка), a 146S+75S компонента - 1,52±0,03 мкг/см3 (98,2% от концентрации общего вирусного белка).The prepared inactivated viral suspensions were examined at the RSC to assess the content of virus components in them. The concentration of the 146S component was 1.24±0.03 μg/cm 3 (80.3% of the total viral protein concentration), and the 146S+75S component was 1.52±0.03 μg/cm 3 (98.2% of concentration of total viral protein).
Пример 6. Подбор условий очистки суспензии вируса ящура штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA.Example 6. Selection of conditions for purification of a suspension of foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA.
Суспензию вируса ящура штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA, полученную при репродукции в перевиваемой высокочувствительной суспензионной клеточной линии ВНК-21/SUSP/ARRIAH, подвергали инактивации (как описано в примере 5) и очистке. Для получения очищенного антигена вируса ящура использовали полигексаметиленгуанидин (ПГМГ) с концентрациями 0,020, 0,025 и 0,030%. До и после процесса очистки антигена вируса ящура штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA в количественном варианте РСК определяли концентрацию общего вирусного белка и иммуногенных компонентов. Результаты анализа отражены в таблице 4, из которой следует, что в результате очистки антигена вируса ящура штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA с помощью ПГМГ в концентрации 0,020% отмечали снижение концентрации балластного белка на 2%, иммуногенных компонентов - на 0,3%. При использовании ПГМГ в концентрации 0,025% наблюдали снижение количества балластного белка на 31%, 146S компонента - на 0,6%. Применяя ПГМГ в концентрации 0,030% содержание балластного белка уменьшалось на 38%, а иммуногенных компонентов - на 16,2%. Таким образом, исследуя условия очистки антигена штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA, пришли к выводу о том, что с экономической точки зрения для получения очищенного продукта оптимально использовать ПГМГ с концентрацией 0,020%.A suspension of foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA, obtained by reproduction in the continuous highly sensitive suspension cell line BNK-21/SUSP/ARRIAH, was subjected to inactivation (as described in example 5) and purification . To obtain purified foot-and-mouth disease virus antigen, polyhexamethylene guanidine (PHMG) was used with concentrations of 0.020, 0.025 and 0.030%. Before and after the process of purifying the antigen of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA in the quantitative version of the RSC, the concentration of the total viral protein and immunogenic components was determined. The results of the analysis are reflected in Table 4, from which it follows that as a result of purification of the antigen of the foot and mouth disease virus strain "A/Egypt/EURO-SA/2022" genotype A/EURO-SA using PHMG at a concentration of 0.020%, a decrease in the concentration of ballast protein was noted by 2 %, immunogenic components - by 0.3%. When using PHMG at a concentration of 0.025%, a decrease in the amount of ballast protein by 31%, and a decrease in the 146S component by 0.6% was observed. Using PHMG at a concentration of 0.030%, the content of ballast protein decreased by 38%, and immunogenic components by 16.2%. Thus, by studying the conditions for purifying the antigen of the A/Egypt/EURO-SA/2022 strain of the A/EURO-SA genotype, we came to the conclusion that from an economic point of view, it is optimal to use PHMG with a concentration of 0.020% to obtain a purified product.
Пример 7. Подбор условий концентрирования суспензии антигена штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA вируса ящура.Example 7. Selection of conditions for concentrating a suspension of antigen of the strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA of the foot-and-mouth disease virus.
Культуральную инактивированную суспензию штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA, полученную с применением перевиваемой высокочувствительной суспензионной клеточной линии ВНК-21/SUSP/ARRIAH, подвергали концентрированию в 7 раз по объему. Для увеличения концентрации иммуногенных компонентов антигена вируса ящура использовали следующие приемы: 1) добавление полиэтиленгликоля (ПЭГ-6000) с концентрацией 50% к антигену в соотношении 1:4, с экспозицией 4 ч; 2) добавление полиэтиленгликоля (ПЭГ-6000) с концентрацией 50% к антигену в соотношении 1:4, с экспозицией 12 ч; 3) концентрирование с помощью гидроокиси алюминия (10% коллоидный раствор в количестве 45%, антиген вируса - 55% от общего объема).A cultural inactivated suspension of the strain “A/Egypt/EURO-SA/2022” of genotype A/EURO-SA, obtained using the continuous highly sensitive suspension cell line BNK-21/SUSP/ARRIAH, was concentrated 7 times by volume. To increase the concentration of immunogenic components of the foot-and-mouth disease virus antigen, the following methods were used: 1) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 4 hours; 2) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 12 hours; 3) concentration with aluminum hydroxide (10% colloidal solution in an amount of 45%, virus antigen - 55% of the total volume).
До и после процесса концентрирования суспензии антигена вируса ящура штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA определяли концентрацию общего вирусного белка и иммуногенных компонентов в количественном варианте РСК. Результаты исследований представлены в таблице 5, из которой видно, что при концентрировании антигена штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA вируса ящура с помощью ПЭГ-6000 в течение 4 ч отмечали увеличение содержания компонентов по сравнению с исходными значениями (до концентрирования) в 5,1 раз. Используя тот же полимер, но повышая время воздействия до 12 ч, увеличили концентрацию компонентов вируса в 5,6 раз. Применяя метод сорбирования с помощью гидроксида алюминия, удалось увеличить количество иммуногенных компонентов антигена штамма «A/Египет/EURO-SA/2022» вируса ящура в суспензии в 6,85 раз. Таким образом, исследуя условия концентрирования антигена штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA, пришли к выводу о том, что оптимальным способом увеличения концентрации компонентов вируса ящура является метод сорбирования с применением коллоидного раствора гидроксида алюминия.Before and after the process of concentrating the suspension of the antigen of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA, the concentration of the total viral protein and immunogenic components was determined in the quantitative version of the RSC. The research results are presented in Table 5, from which it can be seen that when concentrating the antigen of the strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA of the foot-and-mouth disease virus using PEG-6000 for 4 hours, an increase in the content of components was noted compared with the initial values (before concentration) 5.1 times. Using the same polymer, but increasing the exposure time to 12 hours, we increased the concentration of virus components by 5.6 times. Using the sorption method using aluminum hydroxide, it was possible to increase the amount of immunogenic components of the antigen of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022” in suspension by 6.85 times. Thus, by studying the conditions for concentrating the antigen of the A/Egypt/EURO-SA/2022 strain of genotype A/EURO-SA, we came to the conclusion that the optimal way to increase the concentration of foot-and-mouth disease virus components is the sorption method using a colloidal solution of aluminum hydroxide.
Пример 8. Подбор адъюванта и соотношения антиген-адъювант.Example 8. Selection of adjuvant and antigen-adjuvant ratio.
Для изготовления противоящурной моновалентной сорбированной вакцины из антигена штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA в качестве адъюванта была выбран гидроксид алюминия в комплексе с сапонином. При изготовлении моновалентной сорбированной вакцины против вируса ящура использовали 4,5% гидроокиси алюминия в пересчете на сухое вещество и сапонин в количестве 1,2 мг/см3.To produce an anti-foot-and-mouth disease monovalent sorbed vaccine from the antigen of the A/Egypt/EURO-SA/2022 genotype A/EURO-SA strain, aluminum hydroxide in combination with saponin was chosen as an adjuvant. In the preparation of a monovalent sorbed vaccine against foot-and-mouth disease virus, 4.5% aluminum hydroxide was used in terms of dry matter and saponin in an amount of 1.2 mg/cm 3 .
Пример 9. Компоновка вакцины против ящура из штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA культуральной инактивированной сорбированной.Example 9. Composition of a vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA, culture inactivated sorbed.
Из полученного концентрата антигена вируса ящура штамма «A/Египет/EURO-SA/2022» изготовили вакцину против ящура генотипа A/EURO-SA культуральную инактивированную сорбированную с применением в качестве адъювантов гидроокиси алюминия и сапонина. Количество 146S иммуногенного компонента в 1,0 см3 готового антигена составило 8,43±0,03 мкг/см3 (табл. 5).From the resulting concentrate of the antigen of the foot-and-mouth disease virus strain “A/Egypt/EURO-SA/2022”, a culturally inactivated sorbed vaccine against foot-and-mouth disease genotype A/EURO-SA was prepared using aluminum hydroxide and saponin as adjuvants. The amount of 146S immunogenic component in 1.0 cm3 of the finished antigen was 8.43±0.03 μg/ cm3 (Table 5).
Пример 10. Иммунизация животных вакциной против ящура из штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA культуральной инактивированной сорбированной.Example 10. Immunization of animals with a vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA, cultured inactivated sorbed.
Из полученной вакцины против ящура из штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA культуральной инактивированной сорбированной был приготовлен ряд разведений для КРС с 4-х кратным шагом. 15 голов КРС разделили на 3 группы по 5 голов в каждой. Иммунизирующая доза составляла 2,0 см3. Первую группу КРС (№№1-5) иммунизировали вакциной без разведения, вторую группу КРС (№№6-10) привили вакциной, разведенной 1/4, третья группа КРС (№№11-15) -вакциной, разведенной 1/16. Препарат вводили внутримышечно в среднюю треть шеи. В качестве контроля вируса оставили 2 головы без вакцинации.From the obtained vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA, culture inactivated sorbed, a series of dilutions for cattle were prepared in 4-fold increments. 15 heads of cattle were divided into 3 groups of 5 heads each. The immunizing dose was 2.0 cm 3 . The first group of cattle (No. 1-5) was immunized with the vaccine without dilution, the second group of cattle (No. 6-10) was vaccinated with a vaccine diluted 1/4, the third group of cattle (No. 11-15) was vaccinated with a vaccine diluted 1/16 . The drug was administered intramuscularly into the middle third of the neck. As a control for the virus, 2 heads were left without vaccination.
Пример 11. Исследование сывороток крови вакцинированных животных на наличие антител к неструктурным белкам вируса ящура.Example 11. Study of blood sera of vaccinated animals for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus.
Сыворотки крови от КРС, полученные до иммунизации животных, через 14 суток после иммунизации, исследовали на наличие антител к неструктурным белкам (NSP) вируса ящура с помощью блокирующего варианта иммуноферментного анализа (ИФА) в соответствии с рекомендациями OIE (МЭБ) [1]. Тестирование полученных сывороток проводили с использованием тест-системы для ИФА «Prio CHECK®FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs» (Prionics Lelystad B.V., Нидерланды). Полученные результаты исследований отражены в таблице 6, из которой видно, что сыворотки крови животных не содержали антител к неструктурным белкам вируса ящура (значения PI для сывороток крови КРС<50%).Blood sera from cattle obtained before immunization of animals, 14 days after immunization, were examined for the presence of antibodies to non-structural proteins (NSP) of the foot-and-mouth disease virus using a blocking enzyme-linked immunosorbent assay (ELISA) in accordance with OIE recommendations [1]. The obtained sera were tested using the ELISA test system “Prio CHECK®FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs” (Prionics Lelystad B.V., the Netherlands). The research results obtained are reflected in Table 6, from which it can be seen that the animal blood sera did not contain antibodies to non-structural proteins of the foot-and-mouth disease virus (PI values for cattle blood sera <50%).
Пример 12. Оценка авирулентности и безвредности вакцины против ящура из штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA культуральной инактивированной сорбированной.Example 12. Assessment of the avirulence and safety of the culture inactivated sorbed vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA.
Для определения авирулентности вакцины на КРС отобранную пробу вакцинного препарата вводили внутрикожно по 0,1 см3. В исследовании использовали КРС массой 250-300 кг. В течение 10 суток наблюдения животные остались клинически здоровыми, и при патологоанатомическом исследовании не было обнаружено изменений, характерных для ящура. Это свидетельствовало об отсутствии вирулентных свойств разработанной вакцины.To determine the avirulence of the vaccine for cattle, a selected sample of the vaccine preparation was injected intradermally at 0.1 cm 3 . The study used cattle weighing 250-300 kg. During 10 days of observation, the animals remained clinically healthy, and the pathological examination did not reveal any changes characteristic of foot-and-mouth disease. This indicated the absence of virulent properties of the developed vaccine.
Контроль безвредности продукта на КРС проводили путем внутримышечного введения вакцины в дозе 6,0 см3 (тройная доза по 2,0 см3). Срок наблюдения также составлял 10 суток. Следует отметить, что после иммунизации температура тела животного может повышаться до 41,4°С и удерживаться на этом уровне в течение 1-2 суток, что не выходит за рамки нормы после введения вакцинного препарата.Control of the safety of the product on cattle was carried out by intramuscular injection of the vaccine at a dose of 6.0 cm 3 (triple dose of 2.0 cm 3 ). The observation period was also 10 days. It should be noted that after immunization, the animal’s body temperature can rise to 41.4°C and remain at this level for 1-2 days, which does not go beyond the normal range after administration of the vaccine preparation.
По результатам исследований вакцина против ящура из штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA культуральная инактивированная сорбированная была признана безвредной, все животные в период наблюдения оставались клинически здоровыми, при патологоанатомическом анализе некроза тканей на месте введения вакцины не обнаружено.According to the results of the study, the vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA, culturally inactivated sorbed, was found to be harmless, all animals during the observation period remained clinically healthy, with a pathological analysis of tissue necrosis at the site of vaccine administration not detected.
Пример 13. Изучение иммуногенных свойств вакцины против ящура из штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA культуральной инактивированной сорбированной по способности индуцирования вируснейтрализующих антител у естественно восприимчивых животных.Example 13. Study of the immunogenic properties of the vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA, culture-inactivated, sorbed by the ability to induce virus-neutralizing antibodies in naturally susceptible animals.
На 21 сутки после введения вакцины против ящура из штамма «A/Египет/EURO-SA/2022» генотипа A/EURO-SA культуральной инактивированной сорбированной у КРС отбирали кровь и проводили исследование полученных сывороток крови в реакции микронейтрализации (РМН) [3]. Выявлено, что у КРС, иммунизированных вакциной в цельной дозе (5 голов), средние значения титра антител составили 8,00±0,25 log2 SN50, с разведением 1/4 (5 голов) - 4,40±0,14 log2 SN50, с разведением 1/16 (5 голов) - 3,10±0,34 log2 SN50. (табл. 7). Полученные данные реакции микронейтрализации свидетельствуют о том, что после введения вакцины в цельном виде обеспечивается формирование гуморального иммунитета с защитными титрами штаммоспецифических антител (5,5 и более log2 SN50), что соответствует требованиям международных стандартов [1].On the 21st day after the administration of the vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022” genotype A/EURO-SA, culturally inactivated sorbed, blood was taken from cattle and the resulting blood sera were studied in a microneutralization reaction (RMN) [3]. It was revealed that in cattle immunized with the vaccine in a whole dose (5 heads), the average antibody titer values were 8.00±0.25 log 2 SN 50 , with a 1/4 dilution (5 heads) - 4.40±0.14 log 2 SN 50 , with breeding 1/16 (5 heads) - 3.10±0.34 log 2 SN 50 . (Table 7). The data obtained from the microneutralization reaction indicate that after administration of the vaccine in its entirety, the formation of humoral immunity with protective titers of strain-specific antibodies (5.5 or more log 2 SN 50 ) is ensured, which meets the requirements of international standards [1].
Пример 14. Контрольное заражение естественно восприимчивых животных.Example 14: Challenge of naturally susceptible animals.
Крупный рогатый скот, иммунизированный в количестве 15 голов, вакциной в цельном виде и в разведениях, заражали контрольным штаммом «A/Египет/EURO-SA/2022» генотипа A/EURO-SA вируса ящура, адаптированного к этим животным в слизистую оболочку языка в дозе 104,0 ИД50/0,20 см3 (в две точки по 0,10±0,05 см3). Спустя 7 суток после заражения всех животных подвергли эвтаназии и провели патологоанатомический осмотр. Защищенными от ящура считали животных, у которых на конечностях отсутствовали поражения. Первичные афты не учитывали.Cattle, immunized in the amount of 15 heads, with the vaccine in whole form and in dilutions, were infected with the control strain “A/Egypt/EURO-SA/2022” of the A/EURO-SA genotype of the foot-and-mouth disease virus, adapted to these animals in the mucous membrane of the tongue in dose 10 4.0 ID 50 /0.20 cm 3 (at two points of 0.10 ± 0.05 cm 3 ). 7 days after infection, all animals were euthanized and a postmortem examination was performed. Animals that had no lesions on their limbs were considered protected from foot and mouth disease. Primary aphthae were not taken into account.
Результаты контрольного заражения представлены в таблице 7, из которой следует, что вакцина против ящура из штамма «А/Египет/EURO-SA/2022» культуральная инактивированная сорбированная в цельном виде и в разведении 1/4, введенная в однократной дозе (2,0 см3) защищает КРС от заражения гомологичным штаммом все животных (5 из 5 голов).The results of the control infection are presented in Table 7, from which it follows that the vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022” is culturally inactivated, sorbed in whole form and in a 1/4 dilution, administered in a single dose (2.0 cm 3 ) protects cattle from infection with a homologous strain of all animals (5 out of 5 heads).
Препарат, инокулированный в разведении 1/16, защитил 4 из 5 животных. По результатам контрольного заражения было установлено, что в прививном объеме данной вакцины содержится 24,25 ПД50 и 0,08 ИмД50 для КРС.The drug inoculated at a 1/16 dilution protected 4 out of 5 animals. Based on the results of the control infection, it was found that the vaccination volume of this vaccine contains 24.25 PD 50 and 0.08 ImD 50 for cattle.
Таким образом, приведенная выше информация свидетельствует о том, что вакцина против ящура из штамма «A/Египет/EURO-SA/2022» культуральная инактивированная сорбированная, воплощающая предлагаемое изобретение, предназначена как экспериментальная резервная для использования в сельском хозяйстве, а именно в ветеринарной вирусологии и биотехнологии; подтверждена возможность осуществления представленного; вакцина, изготовленная из штамма «А/Египет/EURO-SA/2022» генотипа A/EURO-SA в соответствии с предлагаемым изобретением, обладает высокой иммуногенной активностью и способна обеспечить эффективную защиту восприимчивых животных против эпизоотического штамма вируса ящура серотипа А, генотипа A/EURO-SA, циркулирующего в странах Южной Америки и Африки.Thus, the above information indicates that the vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022”, a culture inactivated sorbed, embodying the proposed invention, is intended as an experimental reserve for use in agriculture, namely in veterinary virology and biotechnology; the possibility of implementing the presented has been confirmed; a vaccine made from the “A/Egypt/EURO-SA/2022” strain of genotype A/EURO-SA in accordance with the invention has high immunogenic activity and is capable of providing effective protection of susceptible animals against the epizootic strain of foot-and-mouth disease virus serotype A, genotype A/ EURO-SA, circulating in South America and Africa.
Источники информации, принятые во внимание при составлении описания изобретения к заявке на выдачу патента РФ на изобретение «Вакцина против ящура из штамма «A/Египет/EURO-SA/2022» культуральная инактивированная сорбированная»:Sources of information taken into account when drawing up the description of the invention for the application for a RF patent for the invention “Vaccine against foot and mouth disease from the strain “A/Egypt/EURO-SA/2022”, culture inactivated sorbed”:
1. OIE. Manual of diagnostic tests and vaccines for terrestrial animals - 24th Ed. - Paris, 2022 - Vol. 1, Chapter 2.1.5. - P. 166-169.1. OIE. Manual of diagnostic tests and vaccines for terrestrial animals - 24th Ed. - Paris, 2022 - Vol. 1, Chapter 2.1.5. - P. 166-169.
2. Ящур. Меры профилактики. URL: http://89.rospotrebnadzor.ru /directions/epid_nadzor/146902 (Дата обращения: 14.07.2023).2. Foot and mouth disease. Prevention measures. URL: http://89.rospotrebnadzor.ru /directions/epid_nadzor/146902 (Date of access: 07/14/2023).
3. Опасность болезни ящура. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Дата обращения: 18.06.2023).3. The danger of foot and mouth disease. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Access date: 06.18.2023).
4. Бурдов А.Н., Дудников А.И., Малярец П.В. и др. Ящур. -М.: Агропромиздат, 1990. - 320 с.4. Burdov A.N., Dudnikov A.I., Malyarets P.V. and others. Foot and mouth disease. -M.: Agropromizdat, 1990. - 320 p.
5. Пономарев А.П., Узюмов В.Л., Груздев К.Н. Вирус ящура: структура, биологические и физико-химические свойства. - Владимир: Фолиант, 2006. - 250 с.5. Ponomarev A.P., Uzyumov V.L., Gruzdev K.N. Foot and mouth disease virus: structure, biological and physicochemical properties. - Vladimir: Folio, 2006. - 250 p.
6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.
7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strateies: Proc. Jnt. Symp. 2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strategies: Proc. Jnt. Symp. 2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.
8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J. M. Pachecoa, T. Doel [et.al.] // Vaccine. - December 2005. - V. 23. - P. 5775-5782.8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J. M. Pachecoa, T. Doel [et.al.] // Vaccine. - December 2005. - V. 23. - P. 5775-5782.
9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.
10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.
11. Официальный сайт The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wrlfmd.org/ref_labs/fmd_ref_lab_ reports.htm (Дата обращения 14.06.2023).11. Official website of The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wrlfmd.org/ref_labs/fmd_ref_lab_ reports.htm (Date accessed 06/14/2023).
12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - P. 746-754.12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - P. 746-754.
13. Рахманов A.M. Современная эпизоотическая ситуация в мире по ящуру и меры ее контроля // Ветеринарная медицина мiжвiд. тем. наук. Харкiв, 2013. - С. 37-38.13. Rakhmanov A.M. Current epizootic situation in the world regarding foot and mouth disease and measures for its control // Veterinary medicine of the interspecies. topics Sci. Kharkiv, 2013. - pp. 37-38.
14. Longjam N., Тауо Т. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol. 4(10). - P. 475-479.14. Longjam N., Tauo T. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol. 4(10). - P. 475-479.
15. Мельник P.H., Хаустова H.B., Мельник H.B., Самуйленко А.Я., Гринь С.А., Святенко М.С., Литенкова И.Ю. Антигенная вариабельность вируса ящура серотипа А и обоснование необходимости получения новых актуальных производственных штаммов/ Ветеринария и кормление. - 2019. - №3. - С. 29-31.15. Melnik R.H., Khaustova H.B., Melnik H.B., Samuylenko A.Ya., Grin S.A., Svyatenko M.S., Litenkova I.Yu. Antigenic variability of foot and mouth disease virus serotype A and justification for the need to obtain new current production strains / Veterinary medicine and feeding. - 2019. - No. 3. - pp. 29-31.
16. Патент РФ №2294760 «Вакцина инактивированная сорбированная против ящура типа А» (заявка №2004137161/13 от 21.12.2004) /В.В. Михалишин, Т.Н. Лезова, А.В. Щербаков, Д.В. Михалишин, Н.С. Мамков.16. RF Patent No. 2294760 “Inactivated sorbed vaccine against foot and mouth disease type A” (application No. 2004137161/13 dated December 21, 2004) / V.V. Mikhalishin, T.N. Lezova, A.V. Shcherbakov, D.V. Mikhalishin, N.S. Mamkov.
17. Методические рекомендации по определению концентрации 146S, 75S, 12S компонентов вакцинных штаммов культурального вируса ящура в реакции связывания комплемента (РСК) / ФГБУ «ВНИИЗЖ». - Утв. 21.09.17.17. Methodological recommendations for determining the concentration of 146S, 75S, 12S components of vaccine strains of cultural foot-and-mouth disease virus in the complement fixation reaction (FRR) / Federal State Budgetary Institution "ARRIAH". - Approved 09.21.17.
18. Методические указания по определению антигенного соответствия между эпизоотическими изолятами и производственными штаммами вируса ящура в перекрестной реакции микронейтрализации: утв. Россельхознадзором 13.09.2017 / ФГБУ «ВНИИЗЖ». - Владимир: 2017. - 24 с.18. Guidelines for determining antigenic correspondence between epizootic isolates and production strains of foot-and-mouth disease virus in a cross-microneutralization reaction: approved. Rosselkhoznadzor 09/13/2017 / FSBI "ARRIAH". - Vladimir: 2017. - 24 p.
--->--->
<?xml version="1.0" encoding="UTF-8"?><?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing <!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing
1.3//EN" "ST26SequenceListing_V1_3.dtd">1.3//EN" "ST26SequenceListing_V1_3.dtd">
<ST26SequenceListing dtdVersion="V1_3" fileName="EURO-SA <ST26SequenceListing dtdVersion="V1_3" fileName="EURO-SA
Vaccine.xml" softwareName="WIPO Sequence" softwareVersion="2.1.2" Vaccine.xml" softwareName="WIPO Sequence" softwareVersion="2.1.2"
productionDate="2023-08-16">productionDate="2023-08-16">
<ApplicationIdentification> <ApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-07-23</FilingDate> <FilingDate>2023-07-23</FilingDate>
</ApplicationIdentification> </ApplicationIdentification>
<ApplicantFileReference>527</ApplicantFileReference> <ApplicantFileReference>527</ApplicantFileReference>
<EarliestPriorityApplicationIdentification> <EarliestPriorityApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-07-23</FilingDate> <FilingDate>2023-07-23</FilingDate>
</EarliestPriorityApplicationIdentification> </EarliestPriorityApplicationIdentification>
<ApplicantName languageCode="ru">ФГБУ "Федеральный центр охраны <ApplicantName languageCode="ru">FSBI "Federal Security Center"
здоровья животных" (ФГБУ "ВНИИЗЖ")</ApplicantName>animal health" (FSBI "ARRIAH")</ApplicantName>
<ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin> <ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin>
<InventorName languageCode="ru">Михалишин Дмитрий <InventorName languageCode="ru">Mihalishin Dmitry
Валерьевич</InventorName>Valerievich</InventorName>
<InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin> <InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin>
<InventionTitle languageCode="ru">Вакцина против ящура из штамма <InventionTitle languageCode="en">Vaccine against foot and mouth disease from the strain
«А/Египет/EURO-SA/2022» культуральная инактивированная "A/Egypt/EURO-SA/2022" cultural inactivated
сорбированная</InventionTitle>sorbed</InventionTitle>
<SequenceTotalQuantity>2</SequenceTotalQuantity> <SequenceTotalQuantity>2</SequenceTotalQuantity>
<SequenceData sequenceIDNumber="1"> <SequenceData sequenceIDNumber="1">
<INSDSeq> <INSDSeq>
<INSDSeq_length>663</INSDSeq_length> <INSDSeq_length>663</INSDSeq_length>
<INSDSeq_moltype>DNA</INSDSeq_moltype> <INSDSeq_moltype>DNA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..663</INSDFeature_location> <INSDFeature_location>1..663</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>genomic DNA</INSDQualifier_value> <INSDQualifier_value>genomic DNA</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q1"> <INSDQualifier id="q1">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>cagcgccggcaaggactttgagttgcgcctcccgattgaccctcgctcg <INSDSeq_sequence>cagcgccggcaaggactttgagttgcgcctcccgattgaccctcgctcg
caaaccacagccaccggggaatcagcggacccggtcaccaccaccgtggagaactacggaggtgagacgccaaaccacagccaccggggaatcagcggacccggtcaccaccaccgtggagaactacggaggtgagacgc
aggtgcagaggcgtcaacacacagacattggcttcatcatggacaggtttgttaagatcaaaaaccccacaggtgcagaggcgtcaacacacagacattggcttcatcatggacaggtttgttaagatcaaaaaccccac
ctcaccacatgtcattgatctcatgcagacccatgaacatgggctggttggtgcaatgctgcgtgcagccctcaccacatgtcattgatctcatgcagacccatgaacatgggctggttggtgcaatgctgcgtgcagcc
acgtactacttttccgacttggaaattgtcgtacggcacgatggcagcctgacctgggtgcccaacggcgacgtactacttttccgacttggaaattgtcgtacggcacgatggcagcctgacctgggtgcccaacggcg
cccctgaagcagctctggacaacaccaccaaccccactgcttaccagaaaccaccactcacgagacttgccccctgaagcagctctggacaacaccaccaaccccactgcttaccagaaaccaccactcacgagacttgc
tttgccctacaccgcgccacaccgtgtgctggcgacagtgtacaacggggtgaacaaatacactgtgagctttgccctacaccgcgccacaccgtgtgctggcgacagtgtacaacggggtgaacaaatacactgtgagc
ggttcaagtaggcgtggtgacatgggggcgctcgcggcgcgagtcgcaaagcagctccctgcctcattcaggttcaagtaggcgtggtgacatgggggcgctcgcggcgcgagtcgcaaagcagctccctgcctcattca
actacggtgcaatcaaggccacgagcattgaggagattctcgtgcgcatgaagcgagctgaactctactgactacggtgcaatcaaggccacgagcattgaggagattctcgtgcgcatgaagcgagctgaactctactg
ccccagaccactcttggcggtggaggtgacatcgcaggacagacacaagcagaa</INSDSeq_sequenccccagaccactcttggcggtggaggtgacatcgcaggacagacacaagcagaa</INSDSeq_sequen
ce>ce>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
<SequenceData sequenceIDNumber="2"> <SequenceData sequenceIDNumber="2">
<INSDSeq> <INSDSeq>
<INSDSeq_length>221</INSDSeq_length> <INSDSeq_length>221</INSDSeq_length>
<INSDSeq_moltype>AA</INSDSeq_moltype> <INSDSeq_moltype>AA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..221</INSDFeature_location> <INSDFeature_location>1..221</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>protein</INSDQualifier_value> <INSDQualifier_value>protein</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q2"> <INSDQualifier id="q2">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>SAGKDFELRLPIDPRSQTTATGESADPVTTTVENYGGETQVQRRQHTDI <INSDSeq_sequence>SAGKDFELRLPIDPRSQTTATGESADPVTTTVENYGGETQVQRRQHTDI
GFIMDRFVKIKNPTSPHVIDLMQTHEHGLVGAMLRAATYYFSDLEIVVRHDGSLTWVPNGAPEAALDNTTGFIMDRFVKIKNPTSPHVIDLMQTHEHGLVGAMLRAATYYFSDLEIVVRHDGSLTWVPNGAPEAALDNTT
NPTAYQKPPLTRLALPYTAPHRVLATVYNGVNKYTVSGSSRRGDMGALAARVAKQLPASFNYGAIKATSINPTAYQKPPLTRLALPYTAPHRVLATVYNGVNKYTVSGSSRRGDMGALAARVAKQLPASFNYGAIKATSI
EEILVRMKRAELYCPRPLLAVEVTSQDRHKQK</INSDSeq_sequence>EEILVRMKRAELYCPRPLLAVEVTSQDRHKQK</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
</ST26SequenceListing></ST26SequenceListing>
<---<---
Claims (5)
Publications (1)
| Publication Number | Publication Date |
|---|---|
| RU2817381C1 true RU2817381C1 (en) | 2024-04-15 |
Family
ID=
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2698305C2 (en) * | 2015-01-16 | 2019-08-26 | ЗОИТИС СЕРВИСЕЗ ЭлЭлСи | Foot-and-mouth disease vaccine |
| RU2772713C1 (en) * | 2021-05-12 | 2022-05-24 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Vaccine for early protection against foot-and-mouth disease from strain a 2205/g iv cultural inactivated emulsion |
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2698305C2 (en) * | 2015-01-16 | 2019-08-26 | ЗОИТИС СЕРВИСЕЗ ЭлЭлСи | Foot-and-mouth disease vaccine |
| RU2772713C1 (en) * | 2021-05-12 | 2022-05-24 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Vaccine for early protection against foot-and-mouth disease from strain a 2205/g iv cultural inactivated emulsion |
Non-Patent Citations (1)
| Title |
|---|
| Hagag NM, Hassan AM, Zaher MR, Elnomrosy SM, Shemies OA, Hussein HA, Ahmed ES, Ali MH, Ateay M, Abdel-Hakim MA, Habashi AR, Eid S, El Zowalaty ME, Shahein MA. Molecular detection and phylogenetic analysis of newly emerging foot-and-mouth disease virus type A, Lineage EURO-SA in Egypt in 2022. Virus Res. 2023 Jan 2; 323:198960. doi: 10.1016/j.virusres.2022.198960. Epub 2022 Oct 6. PMID: 36209919; PMCID: PMC10194312. * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| RU2593718C1 (en) | Inactivated emulsion vaccine against foot-and-mouth disease types a, o, asia-1 | |
| RU2603003C1 (en) | Inactivated sorptive vaccine to fmd types a, o, asia-1 | |
| JP7346417B2 (en) | swine influenza A virus vaccine | |
| RU2451745C2 (en) | A 2045/KYRGYZSTAN/ 2007 STRAIN OF FOOT-AND-MOUTH DISEASE VIRUS Aphtae epizooticae TYPE A FOR ANTIGENIC AND IMMUNOGENIC PERFORMANCE CONTROL OF FOOT-AND-MOUTH DISEASE VACCINES AND FOR PRODUCTION OF BIOPREPARATIONS FOR DIAGNOSIS AND SPECIFIC PREVENTION OF FOOT-AND-MOUTH DISEASE TYPE A | |
| RU2699671C1 (en) | Vaccine for early protection against foot-and-mouth disease of type o inactivated emulsion | |
| RU2665849C1 (en) | Inactivated emulsion vaccine against foot-and-mouth disease type o | |
| RU2817381C1 (en) | Cultural inactivated sorbed vaccine against foot-and-mouth disease from the strain "a/egypt/euro-sa/2022" | |
| RU2810131C1 (en) | CULTURE INACTIVATED SORBED VACCINE AGAINST FOOT AND MOUTH DISEASE OF O/ME-SA/PanAsia2ANT-10 GENOTYPE FROM O N2356/PAKISTAN/2018 STRAIN | |
| RU2816264C1 (en) | Cultural inactivated emulsion vaccine against o/ea-3 genotype foot-and-mouth disease of o n2241/ethiopia/2011 strain | |
| RU2815536C1 (en) | Culture inactivated sorbed vaccine against foot and mouth disease from a/tanzania/2013 strain of a/africa/g-i genotype | |
| RU2804875C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-2/vii genotype from sat-2/eritrea/1998 strain | |
| RU2815534C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-1/i genotype from sat-1/tanzania/2012 strain | |
| RU2810132C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-1/x genotype from sat-1/nigeria/2015 strain | |
| RU2809219C1 (en) | Culturally inactivated sorbed vaccine against foot and mouth disease of sat-1/nwz genotype | |
| RU2815541C1 (en) | Culturally inactivated sorbed vaccine against foot and mouth disease of sat-2/iv genotype | |
| RU2802192C1 (en) | Inactivated sorbed vaccine against fmd of o/ea-2 genotype from o/kenya/2017 strain culture | |
| RU2804803C1 (en) | Culture inactivated emulsion vaccine against fmd of o/sea/mya-98 genotype from o n2383/primorsky/2019 strain | |
| RU2815537C1 (en) | Cultural inactivated emulsion vaccine against foot and mouth disease from o no. 2620/orenburgsky/2021 strain of o/me-sa/ind-2001e genotype | |
| RU2816944C1 (en) | Cultural inactivated emulsion vaccine against foot-and-mouth disease serotype o from strain "o/arriah/mya-98" | |
| RU2799605C1 (en) | FMD CULTURE INACTIVATED SORBED VACCINE FROM A/Iran/2018 STRAIN OF A/ASIA/Iran-05SIS-13 NEW GENOTYPE | |
| RU2798293C1 (en) | Fmd culture inactivated sorbed vaccine from a/afghanistan/2017 strain of a/asia/iran-05far-11 new genotype | |
| US9809802B2 (en) | IBV strains and uses thereof | |
| RU2772713C1 (en) | Vaccine for early protection against foot-and-mouth disease from strain a 2205/g iv cultural inactivated emulsion | |
| AU2016203333A1 (en) | Infectious bronchitis vaccines derived from IB-QX-like strains | |
| RU2682876C1 (en) | Inactivated emulsion vaccine for o-type aphthous fever |