RU2810132C1 - Culture inactivated adsorbed vaccine against fmd of sat-1/x genotype from sat-1/nigeria/2015 strain - Google Patents

Culture inactivated adsorbed vaccine against fmd of sat-1/x genotype from sat-1/nigeria/2015 strain Download PDF

Info

Publication number
RU2810132C1
RU2810132C1 RU2023108654A RU2023108654A RU2810132C1 RU 2810132 C1 RU2810132 C1 RU 2810132C1 RU 2023108654 A RU2023108654 A RU 2023108654A RU 2023108654 A RU2023108654 A RU 2023108654A RU 2810132 C1 RU2810132 C1 RU 2810132C1
Authority
RU
Russia
Prior art keywords
sat
foot
mouth disease
strain
nigeria
Prior art date
Application number
RU2023108654A
Other languages
Russian (ru)
Inventor
Максим Игоревич Доронин
Дмитрий Валерьевич Михалишин
Алексей Валерьевич Борисов
Наталья Станиславовна Мудрак
Евгения Александровна Разгуляева
Надежда Николаевна Негазина
Виктор Викторович Никифоров
Original Assignee
Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ")
Filing date
Publication date
Application filed by Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") filed Critical Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ")
Application granted granted Critical
Publication of RU2810132C1 publication Critical patent/RU2810132C1/en

Links

Images

Abstract

FIELD: veterinary virology and biotechnology.
SUBSTANCE: culturally inactivated sorbed vaccine against foot and mouth disease has been proposed. The vaccine contains an avirulent and purified concentrated antigen of SAT-1/Nigeria/2015 of SAT-1/Х genotype obtained in a suspension continuous cell line from the kidney of a newborn Syrian hamster (BHK-21/SUSP/ARRIAH), representing a suspension containing predominantly 146S immunogenic component of FMDV, adjuvant aluminum hydroxide and saponin in effective ratios.
EFFECT: vaccine is highly immunogenic and can provide effective protection against a homologous infectious agent circulating in African and Middle East countries.
3 cl, 1 dwg, 8 tbl, 14 ex

Description

Изобретение относится к области ветеринарной вирусологии и биотехнологии, а именно к разработке вакцины против ящура генотипа SAT-1/X из штамма «SAT-1/Нигерия/2015» культуральной инактивированной сорбированной.The invention relates to the field of veterinary virology and biotechnology, namely to the development of a culture inactivated sorbed vaccine against foot and mouth disease genotype SAT-1/X from the strain “SAT-1/Nigeria/2015”.

Самым контагиозным заболеванием млекопитающих животных является ящур. Данная болезнь вызывает серьезные экономические потери, которые связаны с затратами на ликвидацию болезни. Существует семь следующих серотипов вируса ящура: О, А, С, SAT-1, SAT-2, SAT-3 и Азия-1, при этом вирус серотипа SAT-1 является распространенным в странах всего Африканского континента и Ближнего Востока, что определяет актуальность изготовления вакцин против ящура данного серотипа.The most contagious disease of mammals is foot and mouth disease. This disease causes serious economic losses, which are associated with the costs of eradicating the disease. There are seven following serotypes of foot and mouth disease virus: O, A, C, SAT-1, SAT-2, SAT-3 and Asia-1, while the virus serotype SAT-1 is common in countries throughout the African continent and the Middle East, which determines the relevance production of vaccines against foot-and-mouth disease of this serotype.

Каждый серотип генетически разделен на различные топотипы, а иногда на отдельные генетические линии и даже сублинии. Различия между ними определяют при анализе нуклеотидной последовательности высоковариабельного гена 1D, который кодирует аминокислотную последовательность белка VP1 [1]. Учитывая, что возбудитель ящура является РНК-содержащим вирусом, для него характерно образование большого количества мутаций во время репликации вирусного генома (преимущество в 5'-участке) и явление рекомбинации (преимущественно в 3'-участке).Each serotype is genetically divided into different topotypes, and sometimes into separate genetic lineages and even sublineages. The differences between them are determined by analyzing the nucleotide sequence of the highly variable 1D gene, which encodes the amino acid sequence of the VP 1 protein [1]. Considering that the causative agent of foot-and-mouth disease is an RNA-containing virus, it is characterized by the formation of a large number of mutations during replication of the viral genome (predominantly in the 5' region) and the phenomenon of recombination (mainly in the 3' region).

Важность знания генетического разнообразия вируса ящура заключается в возможности тщательного анализа эпизоотической ситуации в конкретном регионе и детальном подборе подходящей вакцины, которая должна быть адаптирована именно к интересующему генотипу. Животные после переболевания каким-либо одним серотипом не имеют иммунную защиту против другого серотипа и даже некоторых других генетических линий [3]. Однако, вирусы ящура могут демонстрировать частичную перекрестную защиту в пределах одного серотипа [2].The importance of knowing the genetic diversity of the foot-and-mouth disease virus lies in the possibility of a thorough analysis of the epizootic situation in a particular region and a detailed selection of a suitable vaccine, which should be adapted specifically to the genotype of interest. Animals after being infected with any one serotype do not have immune protection against another serotype and even some other genetic lines [3]. However, foot-and-mouth disease viruses can show partial cross-protection within the same serotype [2].

Установление генетических связей между различными изолятами и штаммами проводят с помощью нуклеотидного секвенирования, что дает возможность в условиях вспышки определить происхождение вируса. Антигенные характеристики вируса, связанные с появлением новых штаммов, важны для характеристики вспышек и поиска оптимальных вакцинных препаратов [4, 6].Establishing genetic relationships between different isolates and strains is carried out using nucleotide sequencing, which makes it possible to determine the origin of the virus in outbreak conditions. Antigenic characteristics of the virus associated with the emergence of new strains are important for characterizing outbreaks and searching for optimal vaccine preparations [4, 6].

Для вируса ящура серотипа SAT-1 характерна высокая генетическая изменчивость, а именно он включает в себя следующие 13 топотипов: I (NORTHWEST ZIMBABWE, NWZ), II (SOUTHEAST ZIMBABWE, SEZ), III (WESTERN ZIMBABWE, WZ), IV (EAST AFRICA 1, EA-1), V, VI, VII (EAST AFRICA 2, EA-2), VIII (EAST AFRICA 3, EA-3), IX, X, XI, XII, XIII [5].Foot and mouth disease virus serotype SAT-1 is characterized by high genetic variability, namely it includes the following 13 topotypes: I (NORTHWEST ZIMBABWE, NWZ), II (SOUTHEAST ZIMBABWE, SEZ), III (WESTERN ZIMBABWE, WZ), IV (EAST AFRICA 1, EA-1), V, VI, VII (EAST AFRICA 2, EA-2), VIII (EAST AFRICA 3, EA-3), IX, X, XI, XII, XIII [5].

Такое высокое генетическое и антигенное разнообразие приводит к проблемам в специфической профилактике ящура при применении культуральных инактивированных противоящурных вакцин. В результате возникает необходимость создания средства специфической профилактики в отношении ящура серотипа SAT-1, а именно SAT-1/X.This high genetic and antigenic diversity leads to problems in the specific prevention of FMD when using culture-inactivated FMD vaccines. As a result, there is a need to create a means of specific prevention against foot and mouth disease of the SAT-1 serotype, namely SAT-1/X.

По причине легкого и быстрого распространения возбудителя ящура данное заболевание может приобретать размах эпизоотий [12]. С целью недопущения возникновения болезни в хозяйствах Российской Федерации применяется система мероприятий по борьбе и профилактике ящура, которая направлена на предупреждение заноса вируса в страну, систематическую иммунизацию крупного и мелкого рогатого скота в буферной зоне, а также проведение мониторинга иммунного статуса привитых животных.Due to the easy and rapid spread of the foot-and-mouth disease pathogen, this disease can acquire the scope of an epizootic [12]. In order to prevent the occurrence of the disease, farms in the Russian Federation apply a system of measures to combat and prevent foot-and-mouth disease, which is aimed at preventing the introduction of the virus into the country, systematic immunization of large and small livestock in the buffer zone, as well as monitoring the immune status of vaccinated animals.

Для иммунизации животных должна применяться вакцина, изготовленная из вируса, гомологичного полевым изолятам [6, 7, 8, 9, 10, 11].To immunize animals, a vaccine made from a virus homologous to field isolates should be used [6, 7, 8, 9, 10, 11].

Возникающие в мире вспышки ящура демонстрируют, что данная инфекция продолжает оставаться значимой экономической проблемой во всем мире. Как представлено в литературных источниках наиболее эффективным способом реагирования на вспышки ящура в странах, свободных от болезней, по-прежнему остается использование вакцин [8, 9, 12, 13]. Для проведения эффективной кампании по вакцинации нужно наличие эффективной, безопасной вакцины, содержащей в качестве иммуногенной части антиген вируса, соответствующей эпизоотическому распространяющемуся изоляту определенного генотипа. Создание подобной вакцины является актуальной задачей. Достижение данной цели позволит эффективно применять вакцину в неблагополучном пункте и угрожаемой зоне для формирования иммунитета против конкретного генотипа вируса ящура.The worldwide outbreaks of foot and mouth disease demonstrate that this infection continues to be a significant economic problem throughout the world. As presented in the literature, the most effective way to respond to FMD outbreaks in disease-free countries remains the use of vaccines [8, 9, 12, 13]. Conducting an effective vaccination campaign requires the availability of an effective, safe vaccine containing as an immunogenic part a viral antigen corresponding to the epizootic spreading isolate of a specific genotype. The creation of such a vaccine is an urgent task. Achieving this goal will make it possible to effectively use the vaccine in disadvantaged areas and threatened areas to build immunity against a specific genotype of the foot-and-mouth disease virus.

Одной из нескольких мер, которые могут быть применены для борьбы со вспышками ящура, является экстренная вакцинация. Критерии, которой включают в себя доступ следующие характеристики: 1) содержит штамм вируса ящура с достаточным антигенным родством по отношению к изолятам, циркулирующим в очаге; 2) относится к требуемому виду среди разработанных вакцин; 3) характеризуется приемлемой безвредностью и эффективностью; 4) имеет соответствующий доступ, в том числе объем партий и своевременность их поставок.One of several measures that can be used to control foot-and-mouth disease outbreaks is emergency vaccination. The access criteria include the following characteristics: 1) contains a strain of foot-and-mouth disease virus with sufficient antigenic affinity in relation to isolates circulating in the outbreak; 2) belongs to the required type among the developed vaccines; 3) characterized by acceptable safety and effectiveness; 4) has appropriate access, including the volume of shipments and the timeliness of their deliveries.

На территории многих стран Северной, Западной, Восточной, Центральной и Южной Африки, Ближнего Востока вспышки ящура генотипа SAT-1/X имеют спорадический характер. Так, торгово-экономические связи со странами Африканского континента, влекут за собой риски заноса изолятов данного генотипа на территорию Российской Федерации и соседние государства [14].In many countries of Northern, Western, Eastern, Central and Southern Africa, and the Middle East, outbreaks of foot-and-mouth disease of the SAT-1/X genotype are sporadic. Thus, trade and economic relations with the countries of the African continent entail the risk of introducing isolates of this genotype into the territory of the Russian Federation and neighboring states [14].

Анализируя вспышки, которые регистрировались на территории Африки, обнаружено, что были выявлены изоляты разных топотипов серотипа SAT-1, в частности, II (SAT-1 RV 11 37), III (SAT-1 ВОТ 1 68), IV (SAT-1 UGA BUFF 21 70), V (SAT-1 NIG 11 75), VI (SAT-1 SUD 3 76), VII (SAT-1 UGA 13 74), VIII (SAT-1 UGA 1 97), IX (SAT-1 ETH 3 2007), X (SAT-1/X), XI (SAT-1 TCH 1/72), XII (SAT-1/ANG/9/74), XIII (SAT 1 MOZP132010 В16). В последние годы, начиная с 2015 г. стали широко распространяться изоляты вируса ящура серотипа SAT-1 топотипа X. В частности, официально вспышки ящура генотипа SAT-1/X фиксировались в Нигерии, Камеруне. При этом есть высока вероятность нерегистрируемых случаев в отношении вируса ящура данного генотипа [15].Analyzing the outbreaks that were registered in Africa, it was found that isolates of different topotypes of the SAT-1 serotype were identified, in particular, II (SAT-1 RV 11 37), III (SAT-1 BOT 1 68), IV (SAT-1 UGA BUFF 21 70), V (SAT-1 NIG 11 75), VI (SAT-1 SUD 3 76), VII (SAT-1 UGA 13 74), VIII (SAT-1 UGA 1 97), IX (SAT- 1 ETH 3 2007), X (SAT-1/X), XI (SAT-1 TCH 1/72), XII (SAT-1/ANG/9/74), XIII (SAT 1 MOZP132010 B16). In recent years, starting from 2015, isolates of the foot-and-mouth disease virus of the serotype SAT-1 topotype X have become widespread. In particular, officially outbreaks of foot-and-mouth disease of the SAT-1/X genotype have been recorded in Nigeria and Cameroon. At the same time, there is a high probability of unreported cases of foot-and-mouth disease virus of this genotype [15].

Известны производственные штаммы вируса ящура типа SAT-1, которые применяются или применялись в мире для производства средств специфической профилактики ящура:There are known industrial strains of the foot-and-mouth disease virus type SAT-1, which are used or have been used in the world for the production of means for the specific prevention of foot-and-mouth disease:

- штамм «SAT-1 Т 155 71» (генотип SAT-1/I),- strain “SAT-1 T 155 71” (genotype SAT-1/I),

- штамм «SAT-1 RV 11 37» (генотип SAT-1/II),- strain “SAT-1 RV 11 37” (genotype SAT-1/II),

- штамм «SAT-1 ВОТ 1 68» (генотип SAT-1/III),- strain “SAT-1 BOT 1 68” (genotype SAT-1/III),

- штамм «SAT-1 UGA BUFF 21 70» (генотип SAT-1/IV),- strain “SAT-1 UGA BUFF 21 70” (genotype SAT-1/IV),

- штамм «SAT-1 NIG 11 75» (генотип SAT-1/V),- strain “SAT-1 NIG 11 75” (genotype SAT-1/V),

- штамм «SAT-1 SUD 3 76» (генотип SAT-1/VI),- strain “SAT-1 SUD 3 76” (genotype SAT-1/VI),

- штамм «SAT-1 UGA 13 74» (генотип VII),- strain “SAT-1 UGA 13 74” (genotype VII),

- штамм «SAT-1 UGA 1 97» (генотип VIII),- strain “SAT-1 UGA 1 97” (genotype VIII),

- штамм «SAT-1 ETH 3 2007» (генотип IX),- strain “SAT-1 ETH 3 2007” (genotype IX),

- штамм «SAT-1/Х» (генотип X),- strain “SAT-1/X” (genotype X),

- штамм «SAT-1 TCH 1/72» (генотип XI),- strain “SAT-1 TCH 1/72” (genotype XI),

- штамм «SAT-1/ANG/9/74» (генотип XII),- strain “SAT-1/ANG/9/74” (genotype XII),

- штамм «SAT 1 MOZP132010 В16» (генотип XIII).- strain “SAT 1 MOZP132010 B16” (genotype XIII).

Изолят «SAT-1/NIG/1/2015» вируса ящура был выделен от крупного рогатого скота на территории Федеративной Республики Нигерия в 2015 году и поступил в ФГБУ «ВНИИЗЖ» из Всемирной справочной лаборатории института Пирбрайта (the World Reference Laboratory for Foot-and-Mouth Disease, the Pirbright institute, Великобритания) для изучения и проведения научных исследований. Штамм «SAT-1/Нигерия/2015» был получен путем адаптации к репродукции в первично-трипсинизированной монослойной клеточной линии почки свиньи СП, в перевиваемых культурах клеток ВНК-21/SUSP/ARRIAH, IB-RS-2, ПСГК-30.The foot-and-mouth disease virus isolate “SAT-1/NIG/1/2015” was isolated from cattle in the Federal Republic of Nigeria in 2015 and was supplied to the Federal State Budgetary Institution “ARRIAH” from the World Reference Laboratory for Foot-and -Mouth Disease, the Pirbright Institute, UK) for study and research. The strain “SAT-1/Nigeria/2015” was obtained by adaptation to reproduction in the primary trypsinized monolayer pig kidney cell line SP, in continuous cell cultures BNK-21/SUSP/ARRIAH, IB-RS-2, PSGK-30.

По результатам сравнительного анализа нуклеотидных последовательностей выделенный штамм принадлежит к топотипу X, типа SAT-1 вируса ящура, который значительно отличается от производственных штаммов вируса ящура типа SAT-1 (фиг. 1) [16].According to the results of a comparative analysis of nucleotide sequences, the isolated strain belongs to topotype X, type SAT-1 of the foot-and-mouth disease virus, which differs significantly from the production strains of the foot-and-mouth disease virus type SAT-1 (Fig. 1) [16].

С увеличением торгово-экономических взаимоотношений между Россией и странами Африканского континента, в частности, Нигерии, Танзании, Кении и другими, возникает опасность распространения ящура данного генотипа в Российской Федерации и следовательно возникает проблема возможной экстренной профилактики данного заболевания для формирования иммунитета у восприимчивых животных. Таким образом, возникла необходимость разработать вакцину против ящура генотипа SAT-1/X из штамма «SAT-1/Нигерия/2015» культуральную инактивированную сорбированную для обеспечения биологической безопасности территории Российской Федерации и сопредельных государств.With the increase in trade and economic relations between Russia and the countries of the African continent, in particular Nigeria, Tanzania, Kenya and others, there is a danger of the spread of foot and mouth disease of this genotype in the Russian Federation and, therefore, the problem of possible emergency prevention of this disease arises to build immunity in susceptible animals. Thus, there was a need to develop a culture-inactivated, sorbed vaccine against foot-and-mouth disease genotype SAT-1/X from the strain “SAT-1/Nigeria/2015” to ensure the biological safety of the territory of the Russian Federation and neighboring countries.

Наиболее близкой предлагаемому изобретению по совокупности существенных признаков является вакцина инактивированная сорбированная против ящура серотипа SAT-1 (штамм «SAT-1 RV 11 37»), содержащая активное вещество в виде авирулентного и очищенного культурального антигенного материала из гомологичного возбудителю ящура штамма «SAT-1 RV 11 37», полученного в чувствительной биологической системе, и целевые добавки в виде гидроксида алюминия и сапонина (адъювант): концентрация антигена (инактивированные 146S+75S компоненты вируса ящура) не менее 3,0 мкг/см3, содержание 10% раствора гидроокиси алюминия - 40% по объему, добавка в виде поддерживающей среды - до 1,0 см3 (прототип).The closest to the proposed invention in terms of the totality of essential features is an inactivated vaccine sorbed against foot-and-mouth disease serotype SAT-1 (strain “SAT-1 RV 11 37”), containing the active substance in the form of avirulent and purified cultural antigenic material from the strain “SAT-1” homologous to the foot-and-mouth disease pathogen RV 11 37", obtained in a sensitive biological system, and targeted additives in the form of aluminum hydroxide and saponin (adjuvant): antigen concentration (inactivated 146S+75S components of the foot and mouth disease virus) not less than 3.0 μg/cm 3 , content of 10% hydroxide solution aluminum - 40% by volume, additive in the form of a supporting medium - up to 1.0 cm 3 (prototype).

В качестве чувствительной биологической системы для репродукции вируса ящура используют перевиваемую суспензионную клеточную линию почки новорожденного сирийского хомячка ВНК-21/2-17, в качестве поддерживающей среды применяют среду Игла MEM без внесения сыворотки, с добавлением ферментативного гидролизата мышц сухого, гидролизата белков крови сухого при рН среды 7,40-7,60.As a sensitive biological system for the reproduction of the foot-and-mouth disease virus, a continuous suspension cell line of the kidney of a newborn Syrian hamster VNK-21/2-17 is used; as a supporting medium, Eagle MEM medium is used without adding serum, with the addition of enzymatic hydrolyzate of dry muscle, hydrolyzate of dried blood proteins at pH of the medium is 7.40-7.60.

Для инактивации вируса используют аминоэтилэтиленимин (АЭЭИ). При изготовлении сорбированной вакцины в качестве адъюванта служит гидрооксид алюминия (Al(ОН)3). Очистку вируссодержащей суспензии от балластных примесей осуществляют с применением полигексаметиленгуанидин гидрохлорида (ПГМГ).Aminoethylethylenimine (AEEI) is used to inactivate the virus. When producing a sorbed vaccine, aluminum hydroxide (Al(OH) 3 ) is used as an adjuvant. Purification of the virus-containing suspension from ballast impurities is carried out using polyhexamethylene guanidine hydrochloride (PHMG).

Авирулентный и очищенный инактивированный антигенный материал из штамма вируса ящура серотипа SAT-1 представляет собой суспензию, состоящую из 146S+75S компонентов вируса ящура, то есть не только полных иммуногенных частиц, но и «пустых» капсидов.Avirulent and purified inactivated antigenic material from the foot-and-mouth disease virus strain serotype SAT-1 is a suspension consisting of 146S+75S components of the foot-and-mouth disease virus, that is, not only complete immunogenic particles, but also “empty” capsids.

Существенный недостаток вакцины-прототипа заключается в составе антигена, а именно, наличие кроме 146S частиц еще и 75S компонента. По данным некоторых исследователей, в частности, Verlinden Y. (2005), «пустые» капсиды являются результатом неуспешной сборки вириона, либо временным вместилищем пентамеров и не является основным иммуногенным компонентом вакцинных препаратов.A significant drawback of the prototype vaccine lies in the composition of the antigen, namely, the presence of, in addition to 146S particles, also a 75S component. According to some researchers, in particular, Verlinden Y. (2005), “empty” capsids are the result of unsuccessful virion assembly, or a temporary container for pentamers and are not the main immunogenic component of vaccine preparations.

Существенный недостаток вакцины-прототипа состоит в его очень низкой иммуногенной активности относительно штаммов/полевых изолятов вируса ящура генотипа SAT-1/X, циркулирующих в странах Африки по причине принадлежности штамма «SAT-1 RV 11 37» к генотипу SAT-1/II. Кроме того, данный штамм был получен более 40 лет назад.A significant drawback of the prototype vaccine is its very low immunogenic activity against strains/field isolates of the foot-and-mouth disease virus genotype SAT-1/X circulating in African countries due to the strain “SAT-1 RV 11 37” belonging to the genotype SAT-1/II. In addition, this strain was obtained more than 40 years ago.

Для решения этой проблемы было создано настоящее изобретение, в которое входила разработка вакцины против ящура генотипа SAT-1/Х из штамма «SAT-1/Нигерия/2015» культуральной инактивированной сорбированной. Данная вакцина предполагает высокое содержание преимущественно 146S иммуногенного компонента в дозе.To solve this problem, the present invention was created, which included the development of a culturally inactivated sorbed vaccine against foot and mouth disease genotype SAT-1/X from the strain “SAT-1/Nigeria/2015”. This vaccine assumes a high content of predominantly 146S immunogenic component in the dose.

Технический результат от использования предлагаемого изобретения заключается в расширении арсенала инактивированных культуральных сорбированных вакцин для экстренной защиты животных против изолятов и штаммов вируса ящура серотипа SAT-1 и, в частности, генотипа SAT-1/Х.The technical result from the use of the proposed invention is to expand the arsenal of inactivated culture-sorbed vaccines for emergency protection of animals against isolates and strains of foot-and-mouth disease virus serotype SAT-1 and, in particular, genotype SAT-1/X.

Указанный технический результат достигнут созданием вакцины против ящура генотипа SAT-1/Х из штамма «SAT-1/Нигерия/2015» культуральной инактивированной сорбированной, охарактеризованной следующей совокупностью признаков, отраженных ниже.The specified technical result was achieved by creating a vaccine against foot-and-mouth disease genotype SAT-1/X from the strain “SAT-1/Nigeria/2015”, a culture-inactivated sorbed vaccine, characterized by the following set of characteristics reflected below.

Разработанная вакцина в 1,0 см3 препарата содержит следующие основные компоненты: 1) активное вещество в виде авирулентного и очищенного антигенного материала из гомологичного возбудителю инфекции штамма «SAT-1/Нигерия/2015» (генотип SAT-1/Х) вируса ящура, репродуцированного предпочтительно в перевиваемой суспензионной клеточной линии ВНК-21/SUSP/ARRIAH, в количестве не менее 4,0 мкг; 2) гидроксид алюминия 10%-ный коллоидный раствор с содержанием 45% по объему (4,5% в пересчете на сухое вещество), 3) сапонин в количестве 1,5 мг, 4) поддерживающая среда - до 1,0 см3.The developed vaccine in 1.0 cm 3 of the drug contains the following main components: 1) the active substance in the form of avirulent and purified antigenic material from the strain “SAT-1/Nigeria/2015” (genotype SAT-1/X) of the foot-and-mouth disease virus, homologous to the causative agent of the infection, reproduced preferably in the continuous suspension cell line BNK-21/SUSP/ARRIAH, in an amount of at least 4.0 μg; 2) aluminum hydroxide 10% colloidal solution containing 45% by volume (4.5% in terms of dry matter), 3) saponin in the amount of 1.5 mg, 4) supporting medium - up to 1.0 cm 3 .

Штамм «SAT-1/Нигерия/2015», который получен путем адаптации изолята «SAT-1/NIG/1/2015», депонирован во Всероссийской государственной коллекции экзотических типов вируса ящура и других патогенов животных (ГКШМ) Федерального государственного бюджетного учреждения «Федеральный центр охраны здоровья животных» (ФГБУ «ВНИИЗЖ»), под регистрационным номером: №414 - деп / 22-48 - ГКШМ ФГБУ «ВНИИЗЖ».The strain “SAT-1/Nigeria/2015”, which was obtained by adapting the isolate “SAT-1/NIG/1/2015”, was deposited in the All-Russian State Collection of Exotic Types of Foot-and-Mouth Disease Virus and Other Animal Pathogens (GKSHM) of the Federal State Budgetary Institution “Federal Center for Animal Health" (FGBU "ARRIAH"), under registration number: No. 414 - dep / 22-48 - GKShM FGBU "ARRIAH".

Штамм адаптирован к первично-трипсинизированным монослойным клеткам линии свиной почки (СП) и перевиваемым клеточным линиям из почки новорожденного сирийского хомячка (ВНК-21/SUSP/ARRIAH), почки свиньи (IB-RS-2) и почки сибирского горного козерога (ПСГК-30).The strain is adapted to primary trypsinized monolayer cells of the porcine kidney line (SP) and continuous cell lines from the kidney of a newborn Syrian hamster (BNK-21/SUSP/ARRIAH), pig kidney (IB-RS-2) and Siberian mountain ibex kidney (PSGK- thirty).

Для изготовления вакцины в качестве чувствительной биологической системы предпочтительно используют перевиваемую суспензионную культуру клеток ВНК-21/SUSP/ARRIAH, а в качестве поддерживающей среды применяют среду Игла DMEM без внесения сыворотки, но с добавлением гидролизата белков крови в количестве 5% от общего объема при рН среды 7,45-7,65. Инактивацию вируса проводят с использованием аминоэтилэтиленимина (АЭЭИ) с концентрацией 0,025% от объема вируссодержащей суспензии. Инактивированный вирус очищают от балластных примесей с помощью полигексаметиленгуанидина (ПГМГ), который вносят в суспензию до концентрации 0,012% от общего объема.To produce a vaccine, a continuous suspension culture of BHK-21/SUSP/ARRIAH cells is preferably used as a sensitive biological system, and Eagle's DMEM medium is used as a supporting medium without adding serum, but with the addition of blood protein hydrolysate in an amount of 5% of the total volume at pH Wednesdays 7.45-7.65. Virus inactivation is carried out using aminoethylethylenimine (AEEI) with a concentration of 0.025% of the volume of the virus-containing suspension. The inactivated virus is purified from ballast impurities using polyhexamethylene guanidine (PHMG), which is added to the suspension to a concentration of 0.012% of the total volume.

Авирулентный и очищенный антиген штамма «SAT-1/Нигерия/2015» вируса ящура представляет собой суспензию, содержащую преимущественно инактивированный 146S иммуногенный компонент вируса ящура. Концентрацию компонента в продукте оценивают с помощью количественного варианта реакции связывания комплемента (РСК) [18]. Для приготовления вакцины используют вирусный материал, содержащий в 1,0 см3 не менее 4,0 мкг инактивированных иммуногенных 146S частиц вируса ящура. Необходимую концентрацию иммуногенного компонента в вакцинном препарате обеспечивают благодаря концентрированию антигена с помощью сорбирования на поверхности коллоидных частиц гидроксида алюминия (Al(ОН)3).The avirulent and purified antigen of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” is a suspension containing predominantly the inactivated 146S immunogenic component of the foot-and-mouth disease virus. The concentration of the component in the product is assessed using a quantitative version of the complement fixation reaction (CRR) [18]. To prepare the vaccine, use viral material containing at least 4.0 μg of inactivated immunogenic 146S particles of foot-and-mouth disease virus per 1.0 cm 3 . The required concentration of the immunogenic component in the vaccine preparation is ensured by concentrating the antigen through sorption on the surface of colloidal particles of aluminum hydroxide (Al(OH) 3 ).

Вакцину против ящура из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х культуральную инактивированную сорбированную получают путем смешивания очищенного антигена и 10%-ной суспензии гидроксида алюминия в соотношении 55% на 45% по объему, соответственно. Для усиления иммунного ответа используют сапонин в концентрации 1,5 мг/см3. Полученная вакцина представляет собой суспензию, содержащую частицы не растворимого в воде гидроокиси алюминия, несущие на своей поверхности инактивированные вирионы вируса ящура, которые обеспечивают формирование иммунитета.The vaccine against foot and mouth disease from the strain “SAT-1/Nigeria/2015” of the genotype SAT-1/X, culture-inactivated, sorbed, is prepared by mixing the purified antigen and a 10% suspension of aluminum hydroxide in a ratio of 55% to 45% by volume, respectively. To enhance the immune response, saponin is used at a concentration of 1.5 mg/cm 3 . The resulting vaccine is a suspension containing particles of water-insoluble aluminum hydroxide, carrying on their surface inactivated virions of the foot-and-mouth disease virus, which ensure the formation of immunity.

Предлагаемое изобретение включает следующую совокупность существенных признаков, обеспечивающих получение технического результата во всех случаях, на которые спрашивается правовая охрана:The proposed invention includes the following set of essential features that ensure obtaining a technical result in all cases for which legal protection is sought:

1. Вакцина против ящура генотипа SAT-1/Х из штамма «SAT-1/Нигерия/2015» культуральная инактивированная сорбированная.1. Vaccine against foot and mouth disease genotype SAT-1/X from the strain “SAT-1/Nigeria/2015”, culture-inactivated, sorbed.

2. Активное вещество в виде авирулентного и очищенного антигенного материала из гомологичного возбудителю заболевания штамма «SAT-1/Нигерия/2015» генотипа SAT-1/X вируса ящура в эффективном количестве.2. The active substance in the form of avirulent and purified antigenic material from the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” genotype SAT-1/X homologous to the causative agent of the disease in an effective amount.

3. Целевые добавки.3. Targeted supplements.

Существенные отличительные признаки предлагаемой вакцины заключаются в том, что в качестве активного вещества она содержит авирулентный очищенный антиген штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х вируса ящура в эффективном количестве.The significant distinctive features of the proposed vaccine are that as an active substance it contains an avirulent purified antigen of the strain “SAT-1/Nigeria/2015” of the genotype SAT-1/X of the foot-and-mouth disease virus in an effective amount.

Предлагаемое изобретение характеризуется также другими отличительными признаками, выражающими конкретные формы выполнения или особые условия его использования:The present invention is also characterized by other distinctive features that express specific forms of implementation or special conditions for its use:

1. Авирулентный и очищенный антиген штамма «SAT-1/Нигерия/2015» генотипа SAT-1/X вируса ящура, полученный предпочтительно в суспензионной перевиваемой клеточной линии BHK-21/SUSP/ARRIAH и представляющий собой суспензию, содержащую 146S иммуногенный компонент вируса ящура в эффективном количестве.1. Avirulent and purified antigen of the strain “SAT-1/Nigeria/2015” of the genotype SAT-1/X of the foot-and-mouth disease virus, obtained preferably in the suspension continuous cell line BHK-21/SUSP/ARRIAH and representing a suspension containing the 146S immunogenic component of the foot-and-mouth disease virus in an effective amount.

2. Авирулентный и очищенный антиген штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х вируса ящура, полученный предпочтительно в суспензионной перевиваемой культуре клеток BHK-21/SUSP/ARRIAH и представляющий собой суспензию, содержащую преимущественно 146S иммуногенный компонент вируса ящура в количестве не менее 4,0 мкг в 1,0 см3 готового вакцинного препарата.2. Avirulent and purified antigen of the strain “SAT-1/Nigeria/2015” of the genotype SAT-1/X of the foot-and-mouth disease virus, obtained preferably in a suspension continuous culture of BHK-21/SUSP/ARRIAH cells and representing a suspension containing predominantly the 146S immunogenic component of the virus foot and mouth disease in an amount of at least 4.0 mcg per 1.0 cm 3 of the finished vaccine preparation.

3. Из целевых добавок вакцина содержит адъювант.3. Among the targeted additives, the vaccine contains an adjuvant.

4. Из целевых добавок вакцина содержит адъювант - гидроксид алюминия в комплексе с сапонином.4. Of the targeted additives, the vaccine contains an adjuvant - aluminum hydroxide in combination with saponin.

5. Вакцина содержит адъювант - гидроокись алюминия 4,5% в пересчете на сухой остаток в комплексе с сапонином в концентрации 1,5 мг в 1,0 см3 готового препарата.5. The vaccine contains an adjuvant - aluminum hydroxide 4.5% in terms of dry residue in combination with saponin at a concentration of 1.5 mg per 1.0 cm 3 of the finished product.

6. Авирулентный и очищенный антиген штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х вируса ящура, полученного предпочтительно в перевиваемой суспензионной клеточной линии BHK-21/SUSP/ARRIAH, адъювант - гидроксид алюминия и сапонин, добавка в готовом препарате в виде поддерживающей среды в следующих количествах:6. Avirulent and purified antigen of the strain “SAT-1/Nigeria/2015” of the genotype SAT-1/X of the foot-and-mouth disease virus, obtained preferably in the continuous suspension cell line BHK-21/SUSP/ARRIAH, adjuvant - aluminum hydroxide and saponin, additive in the finished product the drug in the form of a maintenance medium in the following quantities:

Авирулентный и очищенный антигенAvirulent and purified antigen штамма «SAT-1/Нигерия/2015» генотипаstrain “SAT-1/Nigeria/2015” genotype SAT-1/Х вируса ящураFoot and mouth disease virus SAT-1/X не менее 4,0 мкг/см3 not less than 4.0 μg/cm 3 Гидроокись алюминияAluminum hydroxide 4,5% (в пересчете на сухое вещество)4.5% (based on dry matter) СапонинSaponin 1,5 мг/см3 1.5 mg/cm 3 Поддерживающая средаSupportive environment до 1,0 см3 up to 1.0 cm 3

Предлагаемая вакцина против ящура из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х культуральная инактивированная сорбированная обладает высокой иммуногенной активностью и обеспечивает надежную защиту против изолятов вируса ящура генотипа SAT-1/Х, циркулирующего в странах Восточной Африки и соседних государствах.The proposed vaccine against foot-and-mouth disease from the strain “SAT-1/Nigeria/2015” of the genotype SAT-1/X, culturally inactivated, sorbed, has high immunogenic activity and provides reliable protection against isolates of the foot-and-mouth disease virus of the genotype SAT-1/X circulating in East Africa and neighboring countries states.

Достижение технического результата от использования изобретения обеспечивается тем, что в состав предлагаемой противоящурной вакцины в качестве активного вещества введен антиген штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х вируса ящура, обладающий высокой иммуногенной активностью, создающий эффективную защиту восприимчивых животных против изолятов вируса ящура представленного генотипа, которые в последние годы вызывают вспышки заболевания в странах Африки.Achieving a technical result from the use of the invention is ensured by the fact that the antigen of the strain “SAT-1/Nigeria/2015” of the genotype SAT-1/X of the foot-and-mouth disease virus, which has high immunogenic activity and creates effective protection for susceptible animals, is introduced into the composition of the proposed foot-and-mouth disease vaccine as an active substance. against foot-and-mouth disease virus isolates of the presented genotype, which in recent years have caused outbreaks of the disease in African countries.

Сущность изобретения отражена на графическом изображении:The essence of the invention is reflected in the graphic image:

Фиг. 1. Дендрограмма, отражающая филогенетическое взаимоотношение штамма «SAT-1/Нигерия/2015» вируса ящура с эпизоотическими штаммами серологического типа SAT-1. Дендрограмма основана на сравнении полных нуклеотидных последовательностей гена VP1.Fig. 1. Dendrogram reflecting the phylogenetic relationship of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” with epizootic strains of the serological type SAT-1. The dendrogram is based on a comparison of the complete nucleotide sequences of the VP 1 gene.

Сущность изобретения пояснена следующими перечнями последовательностей:The essence of the invention is illustrated by the following sequence lists:

SEQ ID NO:1 представляет последовательность нуклеотидов гена белка VP1 штамма «SAT-1/Нигерия/2015» вируса ящура генотипа SAT-1/X;SEQ ID NO:1 represents the nucleotide sequence of the VP 1 protein gene of the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus genotype SAT-1/X;

SEQ ID NO:2 представляет последовательность аминокислот гена белка VP1 штамма «SAT-1/Нигерия/2015» вируса ящура генотипа SAT-1/X.SEQ ID NO:2 represents the amino acid sequence of the VP 1 protein gene of the strain “SAT-1/Nigeria/2015” of the foot and mouth disease virus genotype SAT-1/X.

Штамм «SAT-1/Нигерия/2015» вируса ящура характеризуется следующими признаками и свойствами.The foot and mouth disease virus strain “SAT-1/Nigeria/2015” is characterized by the following characteristics and properties.

Морфологические признакиMorphological characteristics

Штамм «SAT-1/Нигерия/2015» вируса ящура серотипа SAT-1 относится к отряду Picornavirales, семейству Picornaviridae, роду Aphthovirus, виду Foot-and-Mouth Disease virus и обладает морфологическими признаками, характерными для возбудителя ящура: форма вириона иксаэдрическая, размер 24-25 нм. Вирион состоит из молекулы одноцепочечной положительно заряженной молекулы РНК, заключенной в белковую оболочку. 146S компонент состоит из молекулы РНК, заключенной в полипептидный комплекс, состоящий из 60 копий структурных белков VP4, VP2, VP3, VP1.Strain “SAT-1/Nigeria/2015” of foot-and-mouth disease virus serotype SAT-1 belongs to the order Picornavirales, family Picornaviridae, genus Aphthovirus, species Foot-and-Mouth Disease virus and has morphological characteristics characteristic of the causative agent of foot-and-mouth disease: the shape of the virion is ixahedral, the size 24-25 nm. A virion consists of a single-stranded, positively charged RNA molecule enclosed in a protein shell. The 146S component consists of an RNA molecule enclosed in a polypeptide complex consisting of 60 copies of the structural proteins VP 4 , VP 2 , VP 3 , VP 1 .

Антигенные свойстваAntigenic properties

По антигенным свойствам штамм «SAT-1/Нигерия/2015» вируса ящура относится к серотипу SAT-1/Х. Вирус стабильно нейтрализуется гомологичной антисывороткой, не проявляет гемагглютинирующей активности. У переболевших животных в сыворотке крови образуются типоспецифические антитела, выявляемые в иммуноферментном анализе (ИФА) и реакции микронейтрализации (РМН).According to antigenic properties, the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus belongs to the SAT-1/X serotype. The virus is stably neutralized by homologous antiserum and does not exhibit hemagglutinating activity. In recovered animals, type-specific antibodies are formed in the blood serum, which are detected in enzyme-linked immunosorbent assay (ELISA) and microneutralization reaction (RMN).

Методом нуклеотидного секвенирования была определена первичная структура 1D-гена белка VP1 штамма «SAT-1/Нигерия/2015» вируса ящура. Сравнительный анализ нуклеотидных последовательностей показал, что штамм «SAT-1/Нигерия/2015» вируса ящура принадлежит к генотипу SAT-1/Х (Фиг. 1).Using the nucleotide sequencing method, the primary structure of the 1D gene of the VP 1 protein of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” was determined. Comparative analysis of nucleotide sequences showed that the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus belongs to the SAT-1/X genotype (Fig. 1).

Антигенное родство (r1) штамма «SAT-1/Нигерия/2015» вируса ящура изучено в перекрестном исследовании штамма со специфическими сыворотками, полученными на следующие производственные штаммы вируса ящура:The antigenic affinity (r 1 ) of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” was studied in a cross-study of the strain with specific sera obtained for the following production strains of the foot-and-mouth disease virus:

- штамм «SAT-1 Т 155 71» (генотип SAT-1/I),- strain “SAT-1 T 155 71” (genotype SAT-1/I),

- штамм «SAT-1 RV 11 37» (генотип SAT-1/II),- strain “SAT-1 RV 11 37” (genotype SAT-1/II),

- штамм «SAT-1 ВОТ 1 68» (генотип SAT-1/III),- strain “SAT-1 BOT 1 68” (genotype SAT-1/III),

- штамм «SAT-1 UGA BUFF 21 70» (генотип SAT-1/IV),- strain “SAT-1 UGA BUFF 21 70” (genotype SAT-1/IV),

- штамм «SAT-1 NIG 11 75» (генотип SAT-1/V),- strain “SAT-1 NIG 11 75” (genotype SAT-1/V),

- штамм «SAT-1 SUD 3 76» (генотип SAT-1/VI),- strain “SAT-1 SUD 3 76” (genotype SAT-1/VI),

- штамм «SAT-1 UGA 13 74» (генотип VII),- strain “SAT-1 UGA 13 74” (genotype VII),

- штамм «SAT-1 UGA 1 97» (генотип VIII),- strain “SAT-1 UGA 1 97” (genotype VIII),

- штамм «SAT-1 ETH 3 2007» (генотип IX),- strain “SAT-1 ETH 3 2007” (genotype IX),

- штамм «SAT-1/Х» (генотип X),- strain “SAT-1/X” (genotype X),

- штамм «SAT-1 TCH 1/72» (генотип XI),- strain “SAT-1 TCH 1/72” (genotype XI),

- штамм «SAT-1/ANG/9/74» (генотип XII),- strain “SAT-1/ANG/9/74” (genotype XII),

- штамм «SAT 1 MOZP132010 В16» (генотип XIII) в РМН.- strain “SAT 1 MOZP132010 B16” (genotype XIII) in RMN.

Титр референтных сывороток крови КРС, полученных путем иммунизации животных моновалентными вакцинами из производственных штаммов вируса ящура серотипа SAT-1, против 102 ТЦД50 гомологичного и гетерологичного вируса определяли в РМН при перекрестном титровании, рассчитывая значения с использованием уравнения линейной регрессии, и выражали в lg. Значение r1 определяли, как антилогарифм разности lg титров сыворотки против гетерологичного и гомологичного вируса [17, 18, 19].The titer of reference cattle blood sera obtained by immunizing animals with monovalent vaccines from production strains of foot-and-mouth disease virus serotype SAT-1 against 10 2 TCD 50 of homologous and heterologous virus was determined in RMN with cross-titration, calculating values using a linear regression equation, and expressed in lg . The r 1 value was determined as the antilogarithm of the difference in serum lg titers against heterologous and homologous viruses [17, 18, 19].

Значение r1 в РМН интерпретировали следующим образом:The value of r 1 in the RMN was interpreted as follows:

при ≥ 0,3 - исследуемый и производственный штаммы вируса ящура являются близкородственными;at ≥ 0.3 - the studied and production strains of foot-and-mouth disease virus are closely related;

при < 0,3 - исследуемый образец штамма вируса ящура отличается от производственного штамма.at <0.3 - the studied sample of the foot-and-mouth disease virus strain differs from the production strain.

Показатели антигенного родства при изучении штамма «SAT-1/Нигерия/2015» составили r1 0,01 - 0,32, что свидетельствует об отсутствии антигенного родства с производственными штаммами вируса ящура серотипа SAT-1 (таблица 1). Следует заметить, что родство между штаммами «SAT-1/Х» и «SAT-1/Нигерия/2015», относящихся к генотипу SAT-1/Х, составляет всего 0,32, исходя из этого, они имеют родство, но оно незначительное, отличия существенные. Штамм «SAT-1/Х» был выделен в 1980 году и не соответствует эпизоотическим изолятам, выделенным при вспышках ящура на Африканском континенте в более поздний период. Это является основанием для создания вакцины на основе штамма «SAT-1/Нигерия/2015».Indicators of antigenic relatedness when studying the strain “SAT-1/Nigeria/2015” amounted to r 1 0.01 - 0.32, which indicates the absence of antigenic relatedness with production strains of foot-and-mouth disease virus serotype SAT-1 (Table 1). It should be noted that the relationship between the strains “SAT-1/X” and “SAT-1/Nigeria/2015”, belonging to the SAT-1/X genotype, is only 0.32, based on this, they have a relationship, but it insignificant, the differences are significant. The “SAT-1/X” strain was isolated in 1980 and does not correspond to epizootic isolates isolated from foot-and-mouth disease outbreaks on the African continent in a more recent period. This is the basis for creating a vaccine based on the SAT-1/Nigeria/2015 strain.

Гено- и хемотаксономическая характеристикиGeno- and chemotaxonomic characteristics

Штамм «SAT-1/Нигерия/2015» вируса ящура является РНК-содержащим вирусом с молекулярной массой 7×106 Д. Нуклеиновая кислота представлена одноцепочной линейной молекулой молекулярной массой 2,8×106 Д. Вирион имеет белковую оболочку, состоящую только из четырех основных белков VP1, VP2, VP3 и VP4.Strain “SAT-1/Nigeria/2015” of foot-and-mouth disease virus is an RNA-containing virus with a molecular weight of 7 × 10 6 D. Nucleic acid is represented by a single-chain linear molecule with a molecular weight of 2.8 × 10 6 D. The virion has a protein shell consisting only of four main proteins VP 1 , VP 2 , VP 3 and VP 4 .

Основным антигенным белком является VP1. В вирионе содержится 31,5% РНК и 68,5% белка. Вирусная РНК является положительно заряженной инфекционной и участвует в образовании белков-предшественников в инфицированных клетках. Предшественники, в свою очередь, расщепляются с образованием более стабильных структурных и неструктурных полипептидов вируса. Из 8 неструктурных полипептидов, накапливающихся в инфицированных клетках, особое значение имеет белок - РНК-зависимая РНК-полимераза (кодируется 3D-геном), необходимая для репликации вирусной РНК.The main antigenic protein is VP 1 . The virion contains 31.5% RNA and 68.5% protein. Viral RNA is positively charged and infectious and is involved in the formation of precursor proteins in infected cells. The precursors, in turn, are cleaved to form more stable structural and nonstructural polypeptides of the virus. Of the 8 non-structural polypeptides that accumulate in infected cells, the protein - RNA-dependent RNA polymerase (encoded by the 3D gene), necessary for viral RNA replication, is of particular importance.

Физические свойстваPhysical properties

Масса вириона составляет 8,4×10-18 г. Плавучая плотность 1,45 г/см3.The mass of the virion is 8.4×10 -18 g. The buoyant density is 1.45 g/cm 3 .

Устойчивость к внешним факторамResistance to external factors

Штамм «SAT-1/Нигерия/2015» вируса ящура устойчив к эфиру, хлороформу, фреону, ацетону. Наиболее стабилен при рН 7,35-7,70. Сдвиги рН как в кислую, так и в щелочную сторону ведут к инактивации вируса. Чувствителен к формальдегиду, УФ-облучению, γ-облучению, высоким температурам (выше 38,2°С).Strain “SAT-1/Nigeria/2015” of foot-and-mouth disease virus is resistant to ether, chloroform, freon, and acetone. Most stable at pH 7.35-7.70. Shifts in pH both to the acidic and alkaline sides lead to inactivation of the virus. Sensitive to formaldehyde, UV irradiation, γ-irradiation, high temperatures (above 38.2°C).

Дополнительные признаки и свойстваAdditional characteristics and properties

Реактогенность - реактогенными свойствами не обладает.Reactogenicity - does not have reactogenic properties.

Патогенность - патогенен для парнокопытных животных.Pathogenicity - pathogenic for artiodactyl animals.

Вирулентность - вирулентен для естественно-восприимчивых животных при контактном, аэрозольном и парентеральном заражении.Virulence - virulent for naturally susceptible animals during contact, aerosol and parenteral infection.

Стабильность - сохраняет исходные биологические свойства при пассировании в чувствительных биологических системах в течение 5 пассажей (срок наблюдения) на перевиваемых культурах.Stability - retains the original biological properties when passaging in sensitive biological systems for 5 passages (observation period) on continuous crops.

Биотехнологические характеристикиBiotechnological characteristics

Штамм «SAT-1/Нигерия/2015» вируса ящура репродуцируется в перевиваемых культурах клеток: почки сибирского горного козерога (ПСГК-30), почки свиньи (IB-RS-2), почки сирийского хомячка (ВНК-21).The foot and mouth disease virus strain “SAT-1/Nigeria/2015” is reproduced in continuous cell cultures: Siberian mountain ibex kidneys (PSGK-30), pig kidneys (IB-RS-2), Syrian hamster kidneys (VNK-21).

При испытании было проведено 5 последовательных пассажей штамма «SAT-1/Нигерия/2015» вируса ящура в перевиваемых культурах клеток ПСГК-30, ВНК-21, IB-RS-2. Биологические свойства характеризовали путем определения инфекционной активности вируса каждого пассажа в перевиваемой клеточной линии IB-RS-2 и на естественно восприимчивых животных - крупном рогатом скоте (КРС) и свиньях.During the test, 5 consecutive passages of the “SAT-1/Nigeria/2015” strain of foot-and-mouth disease virus were carried out in continuous cell cultures PSGK-30, BNK-21, IB-RS-2. Biological properties were characterized by determining the infectious activity of the virus of each passage in the continuous cell line IB-RS-2 and in naturally susceptible animals - cattle (cattle) and pigs.

Исходя из полученных данных, можно утверждать, что штамм «SAT-1/Нигерия/2015» вируса ящура по антигенному и иммунологическому спектрам является оригинальным вариантом вируса ящура генотипа SAT-1/Х.Based on the data obtained, it can be argued that the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus in its antigenic and immunological spectra is the original variant of the foot-and-mouth disease virus of the SAT-1/X genotype.

Для снижения эпизоотической опасности возникновения ящура, вызванного генотипом SAT-1/Х, и предотвращения возникновения новых очагов болезни важна своевременная вакцинопрофилактика, что требует разработки высокоиммуногенной и эффективной вакцины.To reduce the epizootic risk of foot and mouth disease caused by the SAT-1/X genotype and prevent the emergence of new foci of the disease, timely vaccine prevention is important, which requires the development of a highly immunogenic and effective vaccine.

Получена высокоиммуногенная и эффективная вакцина против ящура генотипа SAT-1/Х из штамма «SAT-1/Нигерия/2015» культуральная инактивированная сорбированная.A highly immunogenic and effective vaccine against foot and mouth disease of the SAT-1/X genotype was obtained from the strain “SAT-1/Nigeria/2015”, culture inactivated sorbed.

Сущность предлагаемого изобретения пояснена примерами его использования, которые не ограничивают объем изобретения.The essence of the proposed invention is illustrated by examples of its use, which do not limit the scope of the invention.

Пример 1. Генетическая характеристика штамма «SAT-1/Нигерия/2015» вируса ящура по данным ПЦР и нуклеотидного секвенирования.Example 1. Genetic characteristics of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” according to PCR and nucleotide sequencing data.

Проведенные исследования заключались в изучении первичной структуры гена 1D (белок VP1) (663 н.о.) штамма «SAT-1/Нигерия/2015» вируса ящура методом нуклеотидного секвенирования методом Сенгера и определении положения данного штамма на филогенетическом древе вируса ящура серотипа О. Метод основан на определении первичной структуры гена 1D (белок VP1) испытуемого изолята/штамма с последующим анализом филогенетического родства с другими изолятами вируса ящура серотипа SAT-1.The studies carried out consisted of studying the primary structure of the 1D gene (VP 1 protein) (663 nt) of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” using the Sanger nucleotide sequencing method and determining the position of this strain on the phylogenetic tree of foot-and-mouth disease virus serotype O The method is based on determining the primary structure of the 1D gene (VP 1 protein) of the tested isolate/strain, followed by analysis of phylogenetic relationship with other isolates of foot-and-mouth disease virus serotype SAT-1.

Провели сравнительный анализ нуклеотидных последовательностей гена 1D, кодирующего белок VP1 вируса ящура вакцинного штамма «SAT-1/Нигерия/2015» с другими изолятами и штаммами. Последовательность нуклеотидов гена белка VP штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х вируса ящура представлена SEQ ID NO:1. Последовательность аминокислот 1D-гена, кодирующего белок VP1 штамма «SAT-1/Нигерия/2015» генотипа SAT-1/X вируса ящура отражена на SEQ ID NO:2.A comparative analysis of the nucleotide sequences of the 1D gene encoding the VP 1 protein of the foot-and-mouth disease virus vaccine strain “SAT-1/Nigeria/2015” with other isolates and strains was carried out. The nucleotide sequence of the VP protein gene of the strain “SAT-1/Nigeria/2015” of the genotype SAT-1/X of the foot-and-mouth disease virus is presented by SEQ ID NO:1. The amino acid sequence of the 1D gene encoding the VP 1 protein of the strain “SAT-1/Nigeria/2015” of the genotype SAT-1/X of the foot-and-mouth disease virus is reflected in SEQ ID NO:2.

Проведен филогенетический анализ штамма «SAT-1/Нигерия/2015». Филогенетическое дерево выведено с использованием программы MEGA6 и алгоритма Neighbor-Joining [20]. Процент повторяющихся ветвей, в которых связанные таксоны сгруппированы вместе в тесте начальной загрузки (200 повторов), показан рядом с ветвями [21, 22]. Эволюционные расстояния были рассчитаны с использованием метода Maximum Composite Likelihood [23] и выражены в единицах количества замен оснований на сайт. Этот анализ включал 14 нуклеотидных последовательностей, в том числе последовательность 1D-гена штамма «SAT-1/Нигерия/2015» вируса ящура. Все позиции, содержащие пробелы и отсутствующие данные, были удалены (вариант полного удаления). В окончательном наборе данных было всего 663 позиций. Эволюционный анализ проводился в MEGA 6 [24].A phylogenetic analysis of the strain “SAT-1/Nigeria/2015” was carried out. The phylogenetic tree was derived using the MEGA6 program and the Neighbor-Joining algorithm [20]. The percentage of replicate branches in which related taxa cluster together in a bootstrap test (200 replicates) is shown next to the branches [21, 22]. Evolutionary distances were calculated using the Maximum Composite Likelihood method [23] and expressed in units of the number of base substitutions per site. This analysis included 14 nucleotide sequences, including the sequence of the 1D gene of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015”. All items containing spaces and missing data were removed (complete deletion option). There were a total of 663 items in the final data set. Evolutionary analysis was carried out in MEGA 6 [24].

В результате проведенной работы по сравнению полных нуклеотидных последовательностей гена 1D (белок VP1) штамма «SAT-1/Нигерия/2015» и других изолятов/штаммов вируса ящура серотипа SAT-1/Х определено положение исследуемого штамма на филогенетическом древе (фиг. 1).As a result of the work carried out by comparing the complete nucleotide sequences of the 1D gene (VP1 protein) of the strain “SAT-1/Nigeria/2015” and other isolates/strains of foot-and-mouth disease virus serotype SAT-1/X, the position of the studied strain on the phylogenetic tree was determined (Fig. 1) .

По результатам всего анализа делаем вывод, что исследуемый штамм «SAT-1/Нигерия/2015» относится к генотипу SAT-1/X, что подтверждают данные нуклеотидного и аминокислотного анализа.Based on the results of the entire analysis, we conclude that the studied strain “SAT-1/Nigeria/2015” belongs to the SAT-1/X genotype, which is confirmed by the data of nucleotide and amino acid analysis.

Пример 2. Адаптация штамма «SAT-1/Нигерия/2015» к перевиваемой монослойной культуре клеток почки сибирского горного козерога ПСГК-30.Example 2. Adaptation of the strain “SAT-1/Nigeria/2015” to a continuous monolayer culture of kidney cells of the Siberian mountain ibex PSGK-30.

Для заражения перевиваемой монослойной культуры клеток почки сибирского горного козерога ПСГК-30 использовали 10%-ную афтозную суспензию вируса ящура, полученную из афт КРС (2 пассаж). Посевная концентрация клеток составляла 0,20-0,25 млн кл./см3, доза заражения вирусом - 0,001 ТЦД50/кл. По результатам исследования репродукция вируса ящура штамма «SAT-1/Нигерия/2015» проходила при специфическом разрушении монослоя на 90-100% за 18-20 ч. В течение 6 последовательных пассажей отмечали рост значений титра инфекционной активности вируса от 6,14±0,12 до 7,62±0,12 lg ТЦД50/см3.To infect a continuous monolayer culture of Siberian mountain ibex kidney cells PSGK-30, a 10% aphthous suspension of foot-and-mouth disease virus obtained from bovine aphthae (passage 2) was used. The inoculating cell concentration was 0.20-0.25 million cells/cm 3 , the virus infection dose was 0.001 TCD 50 /cell. According to the results of the study, the reproduction of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” took place with a specific destruction of the monolayer by 90-100% in 18-20 hours. Over the course of 6 consecutive passages, an increase in the titer of infectious activity of the virus was noted from 6.14 ± 0 .12 to 7.62±0.12 lg TCD 50 /cm 3 .

Максимальное значение титра инфекционной активности вируса было достигнуто на этапе 6 пассажа (7,62±0,12 lg ТЦД50/см3). Концентрация 146S частиц с 1 по 6 пассажи изменялась с 0,27±0,03 до 1,10±0,03 мкг/см3. При этом наибольшее количество 146S компонента отмечали на этапе 6 пассажа (1,10±0,03 мкг/см3). Степень достоверности (R2) результатов исследования в количественном варианте ОТ-ПЦР-РВ колебалась от 96,97 до 99,85%). Таким образом, на протяжении 6-ти последовательных пассажей была успешно проведена адаптация штамма «SAT-1/Нигерия/2015» вируса ящура к перевиваемой монослойной клеточной линии ПСГК-30.The maximum titer of infectious activity of the virus was achieved at stage 6 of passage (7.62±0.12 lg TCD 50 /cm 3 ). The concentration of 146S particles from passages 1 to 6 changed from 0.27±0.03 to 1.10±0.03 μg/cm3. In this case, the largest amount of the 146S component was noted at stage 6 of passage (1.10±0.03 μg/cm 3 ). The degree of reliability (R 2 ) of the study results in the quantitative version of RT-PCR-RT ranged from 96.97 to 99.85%). Thus, over the course of 6 consecutive passages, the adaptation of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” to the continuous monolayer cell line PSGK-30 was successfully carried out.

Пример 3. Изучение условий монослойного культивирования вируса ящура штамма «SAT-1/Нигерия/2015» в промышленных масштабах.Example 3. Study of conditions for monolayer cultivation of foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” on an industrial scale.

В процессе промышленного культивирования штамма «SAT-1/Нигерия/2015» вируса ящура в перевиваемой монослойной культуре клеток ПСГК-30 осуществляли подбор оптимальных условий культивирования вируса, анализируя разный состав поддерживающей среды, температурный фактор и дозу заражения клеток.In the process of industrial cultivation of the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus in a continuous monolayer cell culture PSGK-30, the optimal conditions for cultivating the virus were selected, analyzing the different composition of the supporting medium, the temperature factor and the dose of infection of the cells.

На первом этапе исследования оценивали влияние состава поддерживающей среды на репродукцию штамма «SAT-1/Нигерия/2015» вируса ящура в монослойной культуре клеток ПСГК-30 в масштабах производства (на этапе с 5-ого на 6-ой пассажи). Для сравнения применяли три среды с добавлением 2% фетальной сыворотки крови телят: 1) среда Игла DMEM; 2) среда RPMI-1640; 3) раствор Хэнкса с 3,0% гидролизата белков крови. Посевная концентрация клеток составляла 0,20-0,25 млн кл./см3, доза заражения вирусом - 0,1000-0,0001 ТЦД50/кл. Культивирование вируса осуществляли при температурах 35±0,2 - 38±0,2°С до разрушения клеточного монослоя на 95-100% в течение 15-30 ч. Результаты адаптации штамма «SAT-1/Нигерия/2015» вируса ящура с поддерживающими средами разного состава отражены в таблице 2.At the first stage of the study, the effect of the composition of the supporting medium on the reproduction of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” in a monolayer culture of PSGK-30 cells was assessed on a production scale (at the stage from the 5th to the 6th passages). For comparison, three media were used with the addition of 2% fetal calf serum: 1) Eagle's medium DMEM; 2) RPMI-1640 environment; 3) Hanks solution with 3.0% blood protein hydrolyzate. The inoculating cell concentration was 0.20-0.25 million cells/cm 3 , the dose of virus infection was 0.1000-0.0001 TCD 50 /cell. Cultivation of the virus was carried out at temperatures of 35±0.2 - 38±0.2°C until the cell monolayer was destroyed by 95-100% within 15-30 hours. Results of adaptation of the foot-and-mouth disease virus strain "SAT-1/Nigeria/2015" with supporting media of different compositions are shown in Table 2.

Из данных таблицы 2 видно, что при репродукции штамма «SAT-1/Нигерия/2015» вируса ящура в монослойной культуре клеток ПСГК-30 с применением поддерживающих сред разного состава, оптимальной является среда Игла DMEM, позволяющая за 15-16 ч достичь специфического разрушения клеточного монослоя на 95-100% с накоплением в полученной суспензии 146S компонента в количестве 1,10±0,03 мкг/см3 и титром инфекционной активности 7,62±0,12 lg ТЦД50/см3. При использовании среды RPMI-1640 и раствора Хэнкса показатели репродукции вируса были ниже.From the data in Table 2 it can be seen that when reproducing the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus in a monolayer culture of PSGK-30 cells using supporting media of different compositions, the optimal medium is Eagle DMEM, which allows achieving specific destruction in 15-16 hours cell monolayer by 95-100% with accumulation of the 146S component in the resulting suspension in an amount of 1.10±0.03 μg/cm 3 and an infectious activity titer of 7.62±0.12 lg TCD 50 /cm 3 . Viral reproduction rates were lower when using RPMI-1640 medium and Hanks' solution.

На следующем этапе изучения условий монослойного культивирования штамма «SAT-1/Нигерия/2015» вируса ящура в культуре клеток ПСГК-30 в условиях производства оценивали влияние на процесс репродукции вируса температурного фактора. Для этого культивирование вируса проводили в среде Игла DMEM с 2% сыворотки КРС при следующих температурах: 35,0±0,2; 36,0±0,2; 37,0±0,2; 38,0±0,2°С. Доза заражения культуры клеток вирусом ящура составляла 0,010-0,001 ТЦД50/кл. Культивирование вируса осуществляли до разрушения клеточного монослоя на 80-100%) в течение 15-30 ч (таблица 2). По итогам исследования выявили, что для полной репродукции штамма «SAT-1/Нигерия/2015» вируса ящура в монослойной культуре клеток ПСГК-30 оптимальной является температура среды 37,0±0,02°С, при которой за 15-16 ч развитие ЦПД достигало 95-100%) с накоплением 146S частиц, равным 1,10±0,03 мкг/см3 и титром инфекционной активности вируса 7,62±0,12 lg ТЦД50/см3.At the next stage of studying the conditions for monolayer cultivation of the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus in the PSGK-30 cell culture under production conditions, the influence of the temperature factor on the virus reproduction process was assessed. To do this, the virus was cultivated in Eagle's medium DMEM with 2% bovine serum at the following temperatures: 35.0±0.2; 36.0±0.2; 37.0±0.2; 38.0±0.2°C. The dose of infection of the cell culture with the foot-and-mouth disease virus was 0.010-0.001 TCD 50 /cell. The virus was cultivated until the cell monolayer was destroyed by 80-100%) for 15-30 hours (Table 2). Based on the results of the study, it was revealed that for complete reproduction of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” in a monolayer cell culture PSGK-30, the optimal environmental temperature is 37.0±0.02°C, at which the development of The CPE reached 95-100%) with the accumulation of 146S particles equal to 1.10±0.03 μg/cm 3 and the titer of infectious activity of the virus 7.62±0.12 lg TCD 50 /cm 3 .

Оценивали влияние дозы заражения монослоя клеток линии ПСГК-30 штаммом «SAT-1/Нигерия/2015» при культивировании в масштабах производства. Для этого использовали разные дозы вируса: 0,10-0,01; 0,010-0,001; 0,0010-0,0001 ТЦД50/кл. В качестве поддерживающей среды применяли среду Игла MEM с 2% сыворотки крови КРС. Репродукцию вируса проводили при температуре 37,0±0,2°С в течение 15-24 ч до специфического разрушения клеток на 90-100%. По итогам культивирования определяли концентрацию 146S компонента и титр инфекционной активности вируса ящура. Как следует из данных таблицы 2, наибольшее накопление «полных» частиц вируса достигалось при дозе заражения 0,01-0,001 ТЦД50/кл. и составило 1,10±0,03 мкг/см3 с титром инфекционной активности вируса 7,62±0,12 lg ТЦД50/см3.We assessed the effect of the dose of infection of a monolayer of PSGK-30 cells with the strain “SAT-1/Nigeria/2015” during cultivation on a production scale. For this, different doses of the virus were used: 0.10-0.01; 0.010-0.001; 0.0010-0.0001 TCD 50 /cl. Eagle's MEM medium with 2% cattle blood serum was used as a supporting medium. Virus reproduction was carried out at a temperature of 37.0±0.2°C for 15-24 hours until specific cell destruction was 90-100%. Based on the results of cultivation, the concentration of the 146S component and the titer of infectious activity of the foot-and-mouth disease virus were determined. As follows from the data in Table 2, the greatest accumulation of “full” virus particles was achieved at an infection dose of 0.01-0.001 TCD 50 /cell. and amounted to 1.10±0.03 μg/cm 3 with a titer of infectious activity of the virus of 7.62±0.12 lg TCD 50 /cm 3 .

Таким образом, проведено изучение условий монослойного культивирования штамма «SAT-1/Нигерия/2015» вируса ящура в культуре клеток ПСГК-30 в промышленных масштабах. В результате исследования определены следующие оптимальные параметры репродукции штамма «SAT-1/Нигерия/2015» вируса ящура в монослойной клеточной линии ПСГК-30: 1) поддерживающая среда - среда Игла DMEM; 2) температурный режим культивирования - 37,0±0,02°С; 3) доза заражения вирусом - 0,01-0,001 ТЦД50/кл.Thus, we studied the conditions for monolayer cultivation of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” in PSGK-30 cell culture on an industrial scale. As a result of the study, the following optimal parameters for the reproduction of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” in the monolayer cell line PSGK-30 were determined: 1) maintenance medium - Eagle’s medium DMEM; 2) cultivation temperature - 37.0±0.02°C; 3) dose of virus infection - 0.01-0.001 TCD 50 / cell.

Пример 4. Изучение условий суспензионного культивирования штамма «SAT-1/Нигерия/2015» вируса ящура в промышленных масштабах.Example 4. Study of conditions for suspension cultivation of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” on an industrial scale.

При промышленном культивирования штамма «SAT-1/Нигерия/2015» вируса ящура в перевиваемой суспензионной культуре клеток ВНК-21/SUSP/ARRIAH проводили поиск оптимальных параметров для успешной репродукции возбудителя ящура, используя разные концентрации клеток, температуру и дозу заражения.When industrially cultivating the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus in a continuous suspension cell culture BHK-21/SUSP/ARRIAH, the optimal parameters for the successful reproduction of the foot-and-mouth disease pathogen were searched for, using different cell concentrations, temperatures and infection doses.

На первом этапе работы определяли влияние посевной концентрации клеток линии ВНК-21/SUSP/ARRIAH в суспензии на репродукцию штамма «SAT-1/Нигерия/2015» вируса ящура в промышленных масштабах. Для анализа подготовили суспензии со следующими концентрации клеток: 2,5; 3,0; 3,5; 4,0 млн кл./см3. Водородный показатель рН поддерживали в диапазоне 7,45-7,65. Температура культивирования вируса составляла 37,0±0,02°С, доза заражения вирусом - 0,10-0,01 ТЦД50/кл. Репродукцию вируса проводили до специфической гибели клеток на 95-100%, которая осуществлялась в течение 9-11 ч.At the first stage of the work, the effect of the seed concentration of cells of the BHK-21/SUSP/ARRIAH line in suspension on the reproduction of the “SAT-1/Nigeria/2015” strain of foot-and-mouth disease virus on an industrial scale was determined. Suspensions with the following cell concentrations were prepared for analysis: 2.5; 3.0; 3.5; 4.0 million cells/ cm3 . The pH value was maintained in the range of 7.45-7.65. The virus cultivation temperature was 37.0±0.02°C, the dose of virus infection was 0.10-0.01 TCD 50 /cell. Virus reproduction was carried out until specific cell death was 95-100%, which occurred within 9-11 hours.

Результаты суспензионного культивирования штамма «SAT-1/Нигерия/2015» вируса ящура в суспензии с разными концентрациями клеток представлены в таблице 3, из которой следует, что при культивировании вируса ящура штамма «SAT-1/Нигерия/2015» в суспензионной клеточной линии ВНК-21/SUSP/ARRIAH с разными концентрациями клеток, определили, что накопление 146S компонента в суспензии с концентрацией клеток 2,5 млн кл./см3 составило 0,49±0,03 мкг/см3, с концентрацией 3,0 млн кл./см3 - 0,74±0,03 мкг/см3, с концентрацией 3,5 млн кл./см3 - 1,21±0,03 мкг/см3, и с концентрацией 4,0 млн кл./см3 - 1,42±0,03 мкг/см3. Как следует из полученных данных для репродукции штамма «SAT-1/Нигерия/2015» вируса ящура оптимальной является концентрация клеток ВНК-21/SUSP/ARRIAH в суспензии, равная 4,0 млн кл./см3. Значение титра инфекционной активности вируса при этом составило 8,50±0,11 lg ТЦД50/см3. Большая концентрация клеток позволяла получить такой же выход продукта с небольшим увеличением. С экономической точки зрения, таким образом, для репродукции штамма «SAT-1/Нигерия/2015» вируса ящура оптимально использовать суспензию клеток линии ВНК-21/SUSP/ARRIAH с концентрацией 4,0 млн кл./см3.The results of suspension cultivation of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” in suspension with different cell concentrations are presented in Table 3, from which it follows that when cultivating the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” in the suspension cell line BHK -21/SUSP/ARRIAH with different cell concentrations, determined that the accumulation of the 146S component in a suspension with a cell concentration of 2.5 million cells/cm 3 was 0.49 ± 0.03 μg/cm 3 , with a concentration of 3.0 million cells/cm 3 - 0.74±0.03 μg/cm 3 , with a concentration of 3.5 million cells/cm 3 - 1.21±0.03 μg/cm 3 , and with a concentration of 4.0 million cells ./cm 3 - 1.42±0.03 μg/cm 3 . As follows from the data obtained, for the reproduction of the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus, the optimal concentration of BHK-21/SUSP/ARRIAH cells in the suspension is equal to 4.0 million cells/cm 3 . The titer of infectious activity of the virus was 8.50±0.11 lg TCD 50 /cm 3 . A higher concentration of cells made it possible to obtain the same product yield with a slight increase. From an economic point of view, therefore, for the reproduction of the “SAT-1/Nigeria/2015” strain of foot-and-mouth disease virus, it is optimal to use a cell suspension of the BHK-21/SUSP/ARRIAH line with a concentration of 4.0 million cells/cm 3 .

Исследовали влияние фактора температуры на суспензионное культивирование штамма «SAT-1/Нигерия/2015» вируса ящура в культуре клеток линии ВНК-21/SUSP/ARRIAH в промышленных масштабах. Для этого репродукцию вируса проводили при следующих температурных условиях: 35,0±0,2; 36,0±0,2; 37,0±0,2; 38,0±0,2°С. Доза заражения культуры клеток вирусом составляла 0,10-0,01 ТЦД50/кл. Водородный показатель рН вирусной суспензии поддерживали в диапазоне 7,45-7,65. Культивирование вируса проводили до ЦПД, равного 90-100%, в течение 14-26 ч. По результатам анализа определили, что для полной репродукции штамма «SAT-1/Нигерия/2015» вируса ящура в суспензионной культуре клеток ВНК-21/SUSP/ARRIAH оптимальной является температура среды 37,0±0,02°С, при которой в течение 14-15 ч наблюдается специфическая гибель клеток на 95-100%) с высоким накоплением 146S компонента (1,42±0,03 мкг/см3) и титром инфекционной активности вируса 8,50±0,11 lg ТЦД50/см3.We studied the influence of temperature on suspension cultivation of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” in cell culture of the BHK-21/SUSP/ARRIAH line on an industrial scale. For this purpose, virus reproduction was carried out under the following temperature conditions: 35.0±0.2; 36.0±0.2; 37.0±0.2; 38.0±0.2°C. The dose of infection of the cell culture with the virus was 0.10-0.01 TCD 50 /cell. The pH value of the viral suspension was maintained in the range of 7.45-7.65. Cultivation of the virus was carried out to a CPE of 90-100% for 14-26 hours. Based on the results of the analysis, it was determined that for complete reproduction of the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus in a suspension cell culture BHK-21/SUSP/ ARRIAH, the optimal temperature is 37.0±0.02°C, at which 95-100% specific cell death is observed within 14-15 hours with a high accumulation of the 146S component (1.42±0.03 μg/cm 3 ) and the titer of infectious activity of the virus is 8.50±0.11 lg TCD 50 /cm 3 .

Условия суспензионного культивирования штамма «SAT-1/Нигерия/2015» вируса ящура в промышленных масштабах изучали с применением культуры клеток ВНК-21/SUSP/ARRIAH оценивали влияние дозы заражения клеток. Для этого клеточные суспензии заражали вирусом в разных дозах: 0,10-0,01; 0,01-0,001; 0,001-0,0001 ТЦД50/кл. Репродукцию вируса осуществляли при температуре 37,0±0,2°С в течение 14-26 ч до цитопатического действия, равного 90-95%. По итогам культивирования определяли концентрацию 146S частиц и титр инфекционной активности вируса ящура. Как видно из данных таблицы 3, наибольшее накопление 146S компонента отмечали при дозе заражения 0,010-0,001 ТЦД50/кл. (1,42±0,03 мкг/см3) с титром инфекционной активности вируса, равным 8,50±0,11 lg ТЦД50/см3.The conditions for suspension cultivation of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” on an industrial scale were studied using cell culture BHK-21/SUSP/ARRIAH, and the effect of the dose of cell infection was assessed. To do this, cell suspensions were infected with the virus in different doses: 0.10-0.01; 0.01-0.001; 0.001-0.0001 TCD 50 /cl. Virus reproduction was carried out at a temperature of 37.0±0.2°C for 14-26 hours until the cytopathic effect was 90-95%. Based on the results of cultivation, the concentration of 146S particles and the titer of infectious activity of the foot-and-mouth disease virus were determined. As can be seen from the data in Table 3, the greatest accumulation of the 146S component was observed at an infection dose of 0.010-0.001 TCD 50 /cell. (1.42±0.03 μg/cm 3 ) with a titer of infectious activity of the virus equal to 8.50±0.11 lg TCD 50 /cm 3 .

Таким образом, проведено изучение параметров суспензионного культивирования штамма «SAT-1/Нигерия/2015» вируса ящура в суспензионной клеточной линии ВНК-21/SUSP/ARRIAH в промышленных масштабах. Выявлены оптимальные условия репродукции штамма «SAT-1/Нигерия/2015» в суспензионной культуре клеток ВНК-21: 1) концентрация клеток перед заражением - 4,0 млн кл./см3; 2) температурный режим культивирования - 37,0±0,02°С; 3) доза заражения вирусом - 0,010-0,001 ТЦД50/кл.Thus, the parameters of suspension cultivation of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” in the suspension cell line BHK-21/SUSP/ARRIAH on an industrial scale were studied. The optimal conditions for the reproduction of the strain “SAT-1/Nigeria/2015” in the suspension culture of BNK-21 cells were identified: 1) cell concentration before infection - 4.0 million cells/cm 3 ; 2) cultivation temperature - 37.0±0.02°C; 3) dose of virus infection - 0.010-0.001 TCD 50 / cell.

Пример 5. Инактивация суспензии вируса ящура штамма «SAT-1/Нигерия/2015» генотипа SAT-1/X.Example 5. Inactivation of a suspension of foot and mouth disease virus strain “SAT-1/Nigeria/2015” genotype SAT-1/X.

По окончании цикла репродукции вируса ящура, не прекращая процесс термостатирования (37,0±0,02°С), в вируссодержащую суспензию добавляли подкисленный раствор аминоэтилэтиленимина (АЭЭИ) с рН, равным 8,2-8,3. Конечная концентрация АЭЭИ в вируссодержащей суспензии должна быть равной 0,025%. Инактивацию инфекционной активности вируса ящура штамма «SAT-1/Нигерия/2015» генотипа SAT-1/X проводили в течение 12 часов при температуре 37,0±0,1°С и рН 7,45-7,65 с перемешиванием.At the end of the reproduction cycle of the foot-and-mouth disease virus, without stopping the thermostatting process (37.0±0.02°C), an acidified solution of aminoethylethylenimine (AEEI) with a pH of 8.2-8.3 was added to the virus-containing suspension. The final concentration of AEEI in the virus-containing suspension should be equal to 0.025%. Inactivation of the infectious activity of the foot and mouth disease virus strain "SAT-1/Nigeria/2015" genotype SAT-1/X was carried out for 12 hours at a temperature of 37.0±0.1°C and pH 7.45-7.65 with stirring.

Для определения времени полной инактивации после добавления 1,2-АЭЭИ каждый час производили отбор проб. Полученные образцы проверяли на наличие инфекционной активности вируса ящура в первичной культуре клеток почки свиньи СП. Результаты представлены в таблице 4, из данных которой видно, что полная инактивация вируса ящура штамма «SAT-1/Нигерия/2015», репродуцированного в культиваторах, произошла через 8 часов после внесения 1,2-АЭЭИ.To determine the time of complete inactivation after the addition of 1,2-AEEI, samples were taken every hour. The obtained samples were tested for the presence of infectious activity of the foot-and-mouth disease virus in the primary culture of pig kidney cells SP. The results are presented in Table 4, from which it can be seen that complete inactivation of the foot and mouth disease virus strain “SAT-1/Nigeria/2015”, reproduced in cultivators, occurred 8 hours after the addition of 1,2-AEEI.

Готовые вирусные инактивированные суспензии исследовали в РСК для оценки содержания в них компонентов вируса. Концентрация 146S компонента составила 1,37±0,03 мкг/см3 (64% от концентрации общего вирусного белка), а 146S+75S компонента - 1,80±0,0 мкг/см3 (88% от концентрации общего вирусного белка).The prepared inactivated viral suspensions were examined in the RSC to assess the content of virus components in them. The concentration of the 146S component was 1.37±0.03 μg/cm 3 (64% of the total viral protein concentration), and the 146S+75S component was 1.80±0.0 μg/cm 3 (88% of the total viral protein concentration ).

Пример 6. Подбор условий очистки суспензии вируса ящура штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х.Example 6. Selection of conditions for purification of a suspension of foot and mouth disease virus strain “SAT-1/Nigeria/2015” genotype SAT-1/X.

Суспензию вируса ящура штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х, полученную при репродукции в суспензионной клеточной линии ВНК-21/SUSP/ARRIAH, подвергали инактивации и очистке. Для получения очищенного антигена вируса ящура использовали полигексаметиленгуанидин (ПГМГ) с концентрациями 0,010, 0,012 и 0,014%. До и после процесса очистки антигена вируса ящура штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х в количественном варианте РСК определяли концентрацию общего вирусного белка и иммуногенных компонентов. Результаты анализа отражены в таблице 5, из которой следует, что в результате очистки антигена вируса ящура штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х с помощью ПГМГ в концентрации 0,010% отмечали снижение концентрации балластного белка на 6%, иммуногенных компонентов - на 0,5%. При использовании ПГМГ в концентрации 0,012% наблюдали снижение количества балластного белка на 43%, 146S компонента - на 2%. Применяя ПГМГ в концентрации 0,014% содержание балластного белка уменьшалось на 52%, а иммуногенных компонентов - на 10%. Таким образом, исследуя условия очистки антигена штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х, пришли к выводу о том, что для получения очищенного продукта оптимально использовать ПГМГ с концентрацией 0,012%.A suspension of foot and mouth disease virus strain “SAT-1/Nigeria/2015” genotype SAT-1/X, obtained during reproduction in the suspension cell line BHK-21/SUSP/ARRIAH, was subjected to inactivation and purification. To obtain purified foot-and-mouth disease virus antigen, polyhexamethylene guanidine (PHMG) was used with concentrations of 0.010, 0.012 and 0.014%. Before and after the process of purifying the antigen of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” genotype SAT-1/X in the quantitative version of RSC, the concentration of the total viral protein and immunogenic components was determined. The results of the analysis are reflected in Table 5, from which it follows that as a result of purification of the antigen of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” genotype SAT-1/X using PHMG at a concentration of 0.010%, a decrease in the concentration of ballast protein was noted by 6%, immunogenic components - by 0.5%. When using PHMG at a concentration of 0.012%, a decrease in the amount of ballast protein by 43% and the 146S component by 2% was observed. Using PHMG at a concentration of 0.014%, the content of ballast protein decreased by 52%, and immunogenic components by 10%. Thus, by studying the conditions for purifying the antigen of the strain “SAT-1/Nigeria/2015” of the SAT-1/X genotype, we came to the conclusion that to obtain a purified product it is optimal to use PHMG with a concentration of 0.012%.

Пример 7. Подбор условий концентрирования суспензии антигена штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х вируса ящура.Example 7. Selection of conditions for concentrating an antigen suspension of the strain “SAT-1/Nigeria/2015” genotype SAT-1/X of the foot-and-mouth disease virus.

Культуральную инактивированную суспензию штаммаCultural inactivated suspension of the strain

«SAT-1/Нигерия/2015», полученную с применением суспензионной клеточной линии ВНК-21 /SUSP/ARRIAH, подвергали концентрированию в 8 раз по объему. Для увеличения концентрации иммуногенных компонентов антигена вируса ящура использовали следующие приемы: 1) добавление полиэтиленгликоля (ПЭГ-6000) с концентрацией 50% к антигену в соотношении 1:4, с экспозицией 4 ч; 2) добавление полиэтиленгликоля (ПЭГ-6000) с концентрацией 50% к антигену в соотношении 1:4, с экспозицией 12 ч; 3) концентрирование с помощью гидроокиси алюминия (10%) коллоидный раствор в количестве 45%, антиген вируса - 55% от общего объема).“SAT-1/Nigeria/2015”, obtained using the suspension cell line BHK-21 /SUSP/ARRIAH, was concentrated 8 times by volume. To increase the concentration of immunogenic components of the foot-and-mouth disease virus antigen, the following methods were used: 1) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 4 hours; 2) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 12 hours; 3) concentration with aluminum hydroxide (10%) colloidal solution in the amount of 45%, virus antigen - 55% of the total volume).

До и после процесса концентрирования суспензии антигена вируса ящура штамма «SAT-1/Нигерия/2015» определяли концентрацию общего вирусного белка и иммуногенных компонентов в количественном варианте РСК. Результаты исследований представлены в таблице 6, из которой видно, что при концентрировании антигена штамма «SAT-1/Нигерия/2015» вируса ящура с помощью ПЭГ-6000 в течение 4 ч отмечали увеличение содержания компонентов по сравнению с исходными значениями (до концентрирования) в 5,5 раз. Используя тот же полимер, но повышая время воздействия до 12 ч, увеличили концентрацию компонентов вируса в 6,3 раз. Применяя метод сорбирования с помощью гидроксида алюминия, удалось увеличить количество иммуногенных компонентов антигена штамма «SAT-1/Нигерия/2015» вируса ящура в суспензии в 7,9 раз. Таким образом, исследуя условия концентрирования антигена штамма «SAT-1/Нигерия/2015», пришли к выводу о том, что оптимальным способом увеличения концентрации компонентов вируса ящура является метод сорбирования с применением коллоидного раствора гидроксида алюминия.Before and after the process of concentrating the suspension of the antigen of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015”, the concentration of the total viral protein and immunogenic components in the quantitative version of the RSC was determined. The research results are presented in Table 6, from which it can be seen that when concentrating the antigen of the strain “SAT-1/Nigeria/2015” of the foot-and-mouth disease virus using PEG-6000 for 4 hours, an increase in the content of components was noted compared to the initial values (before concentration) in 5.5 times. Using the same polymer, but increasing the exposure time to 12 hours, we increased the concentration of virus components by 6.3 times. Using the sorption method using aluminum hydroxide, it was possible to increase the amount of immunogenic components of the antigen of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015” in suspension by 7.9 times. Thus, by studying the conditions for concentrating the antigen of the “SAT-1/Nigeria/2015” strain, we came to the conclusion that the optimal way to increase the concentration of foot-and-mouth disease virus components is the sorption method using a colloidal solution of aluminum hydroxide.

Пример 8. Подбор адъюванта и соотношения антиген-адъювант.Example 8. Selection of adjuvant and antigen-adjuvant ratio.

Для изготовления противоящурной моновалентной сорбированной вакцины из антигена штамма «SAT-1/Нигерия/2015» в качестве адъюванта был выбран гидроксид алюминия в комплексе с сапонином. При изготовлении моновалентной сорбированной вакцины против вируса ящура использовали 4,5% гидроокиси алюминия в пересчете на сухое вещество и сапонин в количестве 1,5 мг/см3.To produce an anti-foot-and-mouth disease monovalent sorbed vaccine from the antigen of the “SAT-1/Nigeria/2015” strain, aluminum hydroxide in combination with saponin was chosen as an adjuvant. In the preparation of a monovalent sorbed vaccine against foot-and-mouth disease virus, 4.5% aluminum hydroxide was used in terms of dry matter and saponin in an amount of 1.5 mg/cm 3 .

Пример 9. Компоновка вакцины против ящура из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х кулътуральной инактивированной сорбированной.Example 9. Composition of a vaccine against foot and mouth disease from the strain “SAT-1/Nigeria/2015” genotype SAT-1/X, culturally inactivated sorbed.

Из полученного концентрата антигена вируса ящура штамма «SAT-1/Нигерия/2015» изготовили вакцину против ящура генотипа SAT-1/X культуральную инактивированную сорбированную с применением в качестве адъювантов гидроокиси алюминия и сапонина. Количество 146S иммуногенного компонента в 1,0 см3 готового антигена составило 10,35±0,09 мкг/см3 (таблица 6).From the resulting concentrate of the antigen of the foot-and-mouth disease virus strain “SAT-1/Nigeria/2015”, a culturally inactivated sorbed vaccine against foot-and-mouth disease genotype SAT-1/X was prepared using aluminum hydroxide and saponin as adjuvants. The amount of 146S immunogenic component in 1.0 cm 3 of the finished antigen was 10.35 ± 0.09 μg/cm 3 (Table 6).

Пример 10. Иммунизация животных вакциной против ящура из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х кулътуральной инактивированной сорбированной (предлагаемое изобретение).Example 10. Immunization of animals with a vaccine against foot and mouth disease from the strain “SAT-1/Nigeria/2015” genotype SAT-1/X, culturally inactivated sorbed (the proposed invention).

Из полученной вакцины против ящура из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х культуральной инактивированной сорбированной (предлагаемое изобретение) был приготовлен ряд разведений для КРС с 4-х кратным шагом. 15 голов КРС разделили на 3 группы по 5 голов в каждой и 2 головы оставили без вакцинации для контроля вируса. Иммунизирующая доза составляла 2,0 см3. Первую группу КРС (№№ 1-5) иммунизировали вакциной без разведения, вторую группу КРС (№№ 6-10) привили вакциной, разведенной 1/4, третья группа КРС (№№ 11-15) - вакциной, разведенной 1/16. Препарат вводили внутримышечно в среднюю треть шеи.From the resulting vaccine against foot and mouth disease from the strain “SAT-1/Nigeria/2015” genotype SAT-1/X, culture inactivated sorbed (the proposed invention), a series of dilutions for cattle were prepared in 4-fold increments. 15 heads of cattle were divided into 3 groups of 5 heads each and 2 heads were left without vaccination to control the virus. The immunizing dose was 2.0 cm 3 . The first group of cattle (Nos. 1-5) were immunized with the vaccine without dilution, the second group of cattle (Nos. 6-10) were vaccinated with the vaccine diluted 1/4, the third group of cattle (Nos. 11-15) - with the vaccine diluted 1/16 . The drug was administered intramuscularly into the middle third of the neck.

Пример 11. Исследование сывороток крови вакцинированных животных на наличие антител к неструктурным белкам вируса ящура.Example 11. Study of blood sera of vaccinated animals for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus.

Сыворотки крови от КРС, полученные до иммунизации животных, через 14 суток после иммунизации, исследовали на наличие антител к неструктурным белкам вируса ящура с помощью блокирующего варианта иммуноферментного анализа (ИФА) в соответствии с рекомендациями OIE (МЭБ) [3]. Тестирование полученных сывороток проводили с использованием тест-системы для ИФА «Prio CHECK®FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs» (Prionics Lelystad B.V., Нидерланды). Полученные результаты исследований отражены в таблице 7, из которой видно, что сыворотки крови животных не содержали антител к неструктурным белкам вируса ящура (значения PI для сывороток крови КРС < 50%).Blood sera from cattle obtained before immunization of animals, 14 days after immunization, were examined for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus using a blocking enzyme-linked immunosorbent assay (ELISA) in accordance with OIE recommendations [3]. The obtained sera were tested using the ELISA test system “Prio CHECK ® FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs” (Prionics Lelystad BV, the Netherlands). The research results obtained are reflected in Table 7, from which it can be seen that the animal blood sera did not contain antibodies to non-structural proteins of the foot-and-mouth disease virus (PI values for cattle blood sera < 50%).

Пример 12. Оценка авирулентности и безвредности вакцины против ящура из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х кулътуральной инактивированной сорбированной.Example 12. Assessment of the avirulence and safety of the vaccine against foot and mouth disease from the strain “SAT-1/Nigeria/2015” genotype SAT-1/X, culturally inactivated sorbed.

Для определения авирулентности вакцины на КРС отобранную пробу вакцинного препарата (предлагаемое изобретение) вводили внутрикожно по 0,1 см3. В исследовании использовали КРС массой 270-300 кг. В течение 10 суток наблюдения животные остались клинически здоровыми, и при патологоанатомическом исследовании не было обнаружено изменений, характерных для ящура. Это свидетельствовало об отсутствии вирулентных свойств разработанной вакцины (предлагаемое изобретение).To determine the avirulence of the vaccine for cattle, a selected sample of the vaccine preparation (the proposed invention) was injected intradermally at 0.1 cm 3 . The study used cattle weighing 270-300 kg. During 10 days of observation, the animals remained clinically healthy, and the pathological examination did not reveal any changes characteristic of foot-and-mouth disease. This indicated the absence of virulent properties of the developed vaccine (the proposed invention).

Контроль безвредности продукта на КРС проводили путем внутримышечного введения вакцины (предлагаемое изобретение) в дозе 6,0 см3 (тройная доза по 2,0 см3). Срок наблюдения также составлял 10 суток. Следует отметить, что после иммунизации температура тела животного может повышаться до 41,4°С и удерживаться на этом уровне в течение 1-2 суток, что не выходит за рамки нормы после введения вакцинного препарата.Control of the safety of the product on cattle was carried out by intramuscular administration of the vaccine (the present invention) at a dose of 6.0 cm 3 (triple dose of 2.0 cm 3 ). The observation period was also 10 days. It should be noted that after immunization, the animal’s body temperature can rise to 41.4°C and remain at this level for 1-2 days, which does not go beyond the normal range after administration of the vaccine preparation.

По результатам исследований вакцина против ящура из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х культуральная инактивированная сорбированная (предлагаемое изобретение) была признана безвредной, все животные в период наблюдения оставались клинически здоровыми, при патологоанатомическом анализе некроза тканей на месте введения вакцины не обнаружено.According to the research results, the vaccine against foot and mouth disease from the strain “SAT-1/Nigeria/2015” genotype SAT-1/X, cultural inactivated sorbed (the proposed invention) was found to be harmless, all animals during the observation period remained clinically healthy, with pathological analysis of tissue necrosis in situ no vaccine administration was detected.

Пример 13. Изучение иммуногенных свойств вакцины (предлагаемое изобретение) по способности индуцирования вируснейтрализующих антител у естественно восприимчивых животных.Example 13. Study of the immunogenic properties of the vaccine (the proposed invention) based on the ability to induce virus-neutralizing antibodies in naturally susceptible animals.

На 21 сутки после введения вакцины против ящура из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х культуральной инактивированной сорбированной у КРС отбирали кровь и проводили исследование полученных сывороток крови в реакции микронейтрализации (РМН) [3]. Выявлено, что у КРС, иммунизированных вакциной в цельной дозе (5 голов), средние значения титра антител составили 7,45±0,11 log2 SN50, с разведением 1/4 (5 голов) -4,45±0,11 log2 SN50, с разведением 1/16 (5 голов) - 3,15±0,22 log2 SN50. (таблица 8). Полученные данные реакции микронейтрализации свидетельствуют о том, что после введения вакцины в цельном виде обеспечивается формирование гуморального иммунитета с защитными титрами штаммоспецифических антител (5,5 и более log2 SN50), что соответствует требованиям международных стандартов [3].On the 21st day after the administration of the vaccine against foot and mouth disease from the strain “SAT-1/Nigeria/2015” genotype SAT-1/X, culturally inactivated sorbed, blood was taken from cattle and the resulting blood sera were studied in a microneutralization reaction (RMN) [3]. It was revealed that in cattle immunized with the vaccine in a whole dose (5 heads), the average antibody titer values were 7.45±0.11 log 2 SN 50 , with a dilution of 1/4 (5 heads) -4.45±0.11 log 2 SN 50 , with breeding 1/16 (5 heads) - 3.15±0.22 log 2 SN 50 . (Table 8). The data obtained from the microneutralization reaction indicate that after administration of the vaccine in its entirety, the formation of humoral immunity with protective titers of strain-specific antibodies (5.5 or more log 2 SN 50 ) is ensured, which meets the requirements of international standards [3].

Пример 14. Изучение защитной способности вакцины против ящура из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/X культуральной инактивированной сорбированной на естественно восприимчивых видах животных методом контрольного заражения естественно восприимчивых животных.Example 14. Study of the protective ability of the vaccine against foot and mouth disease from the strain “SAT-1/Nigeria/2015” genotype SAT-1/X, culture inactivated, sorbed on naturally susceptible animal species by the method of control infection of naturally susceptible animals.

Крупный рогатый скот, иммунизированный в количестве 15 голов, вакциной (предлагаемое изобретение) в цельном виде и в разведениях, заражали контрольным штаммом «SAT-1/Нигерия/2015» генотипа SAT-1/X вируса ящура, адаптированного к этим животным в слизистую оболочку языка в дозе 104,0 ИД50/0,20 см3 (в две точки по 0,10±0,05 см3). Спустя 7 суток после заражения всех животных подвергли эвтаназии и провели патологоанатомический осмотр. Защищенными от ящура считали животных, у которых на конечностях отсутствовали поражения. Первичные афты не учитывали.Cattle, immunized in the amount of 15 heads, with the vaccine (the proposed invention) in whole form and in dilutions, were infected with the control strain “SAT-1/Nigeria/2015” of the genotype SAT-1/X of the foot-and-mouth disease virus, adapted to these animals in the mucous membrane tongue in a dose of 10 4.0 ID 50 /0.20 cm 3 (at two points of 0.10 ± 0.05 cm 3 ). 7 days after infection, all animals were euthanized and a postmortem examination was performed. Animals that had no lesions on their limbs were considered protected from foot and mouth disease. Primary aphthae were not taken into account.

Результаты контрольного заражения представлены в таблице 8, из которой следует, что вакцина против ящура из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/Х культуральная инактивированная сорбированная в цельном виде и в разведении 1/4, введенная в однократной дозе (2,0 см3) защищает КРС от заражения гомологичным штаммом всех животных (5 из 5 голов).The results of the control infection are presented in Table 8, from which it follows that the vaccine against foot and mouth disease from the strain “SAT-1/Nigeria/2015” genotype SAT-1/X is culturally inactivated, sorbed in whole form and in a 1/4 dilution, administered in a single dose (2.0 cm 3 ) protects cattle from infection with a homologous strain of all animals (5 out of 5 heads).

Препарат (предлагаемое изобретение), инокулированный в разведении 1/16, защитил 4 из 5 животных. По результатам контрольного заражения было установлено, что в прививном объеме данной вакцины содержится 24,25 ПД50 и 0,08 ИмД50 для КРС.The drug (the proposed invention), inoculated at a dilution of 1/16, protected 4 out of 5 animals. Based on the results of the control infection, it was found that the vaccination volume of this vaccine contains 24.25 PD 50 and 0.08 ImD 50 for cattle.

Таким образом, приведенная выше информация свидетельствует о том, что вакцина против ящура генотипа SAT-1/Х из штамма «SAT-1/Нигерия/2015» культуральная инактивированная сорбированная, воплощающая предлагаемое изобретение, предназначена как резервная для использования в сельском хозяйстве, а именно в ветеринарной вирусологии и биотехнологии; подтверждена возможность осуществления представленного; вакцина, изготовленная из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/X в соответствии с предлагаемым изобретением, обладает высокой иммуногенной активностью и способна обеспечить эффективную защиту восприимчивых животных против эпизоотического штамма вируса ящура серотипа SAT-1, генотипа SAT-1/Х, циркулирующего в странах Африки и Ближнего Востока.Thus, the above information indicates that the vaccine against foot and mouth disease genotype SAT-1/X from the strain “SAT-1/Nigeria/2015” is a cultural inactivated sorbed, embodying the proposed invention, intended as a reserve for use in agriculture, namely in veterinary virology and biotechnology; the possibility of implementing the presented has been confirmed; a vaccine made from the “SAT-1/Nigeria/2015” strain of the SAT-1/X genotype in accordance with the invention has high immunogenic activity and is capable of providing effective protection to susceptible animals against the epizootic strain of foot-and-mouth disease virus serotype SAT-1, genotype SAT- 1/X, circulating in Africa and the Middle East.

Источники информации, принятые во внимание при составлении описания изобретения к заявке на выдачу патента РФ на изобретение «Вакцина против ящура генотипа SAT-1/Х из штамма «SAT-1/Нигерия/2015» культуральная инактивированная сорбированная»:Sources of information taken into account when drawing up the description of the invention for the application for a RF patent for the invention “Vaccine against foot-and-mouth disease genotype SAT-1/X from the strain “SAT-1/Nigeria/2015”, culture inactivated sorbed”:

1. Ящур. Меры профилактики. URL: http://89.rospotrebnadzor.ru /directions/epid_nadzor/146902 (Дата обращения: 13.09.2022).1. Foot and mouth disease. Prevention measures. URL: http://89.rospotrebnadzor.ru /directions/epid_nadzor/146902 (Date of access: 09/13/2022).

2. Опасность болезни ящура. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Дата обращения: 24.09.2022).2. The danger of foot and mouth disease. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Access date: 09/24/2022).

3. OIE. Manual of diagnostic tests and vaccines for terrestrial animals - 24th Ed.-Paris, 2015 - Vol.1, Chapter 2.1.5. - P. 166-169.3. OIE. Manual of diagnostic tests and vaccines for terrestrial animals - 24th Ed.-Paris, 2015 - Vol.1, Chapter 2.1.5. - P. 166-169.

4. Бурдов A.H., Дудников А.И., Малярец П.В. и др. Ящур. - М.: Агропромиздат, 1990. - 320 с.4. Burdov A.N., Dudnikov A.I., Malyarets P.V. and others. Foot and mouth disease. - M.: Agropromizdat, 1990. - 320 p.

5. Пономарев А.П., Узюмов В.Л., Груздев К.Н. Вирус ящура: структура, биологические и физико-химические свойства. - Владимир: Фолиант, 2006. - 250 с.5. Ponomarev A.P., Uzyumov V.L., Gruzdev K.N. Foot and mouth disease virus: structure, biological and physicochemical properties. - Vladimir: Folio, 2006. - 250 p.

6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.

7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strateies: Proc. Jnt. Symp.2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strategies: Proc. Jnt. Symp.2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.

8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J. M. Pachecoa, T. Doel [et.al.] // Vaccine. - December 2005. - V. 23. - P. 5775-5782.8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J. M. Pachecoa, T. Doel [et.al.] // Vaccine. - December 2005. - V. 23. - P. 5775-5782.

9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.

10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.

11. Официальный сайт The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wr1fmd.org/ref_labs/fmd_ref_lab reports.htm (Дата обращения 16.09.2022).11. Official website of The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wr1fmd.org/ref_labs/fmd_ref_lab reports.htm (Date accessed 09/16/2022).

12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - P. 746-754.12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - P. 746-754.

13. Рахманов A.M. Современная эпизоотическая ситуация в мире по ящуру и меры ее контроля //Ветеринарная медицина мiжвiд. тем. наук. Харкiв, 2013. - С. 37-38.13. Rakhmanov A.M. Current epizootic situation in the world regarding foot and mouth disease and measures for its control // Veterinary medicine of the interspecies. topics Sci. Kharkiv, 2013. - pp. 37-38.

14. Longjam N., Тауо Т. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol. 4(10). - P. 475-479.14. Longjam N., Tauo T. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol. 4(10). - P. 475-479.

15. Мельник P.H., Хаустова H.B., Мельник H.B., Самуйленко А.Я., Гринь С.А., Святенко М.С., Литенкова И.Ю. Антигенная вариабельность вируса ящура серотипа А и обоснование необходимости получения новых актуальных производственных штаммов/ Ветеринария и кормление. - 2019. - №3. - С. 29-31.15. Melnik R.H., Khaustova H.B., Melnik H.B., Samuylenko A.Ya., Grin S.A., Svyatenko M.S., Litenkova I.Yu. Antigenic variability of foot and mouth disease virus serotype A and justification for the need to obtain new current production strains / Veterinary medicine and feeding. - 2019. - No. 3. - pp. 29-31.

16. Paton D.J., Sumption K.J., Charleston В. Options for control of foot-and-mouth disease: knowledge, capability and policy/ Phil. Trans. R. Soc. В (2009) 364. - P. 2657-2667.16. Paton D.J., Sumption K.J., Charleston B. Options for control of foot-and-mouth disease: knowledge, capability and policy/ Phil. Trans. R. Soc. In (2009) 364. - P. 2657-2667.

17. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.17. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.

18. Методические рекомендации по определению концентрации 146S, 75S, 12S компонентов вакцинных штаммов культурального вируса ящура в реакции связывания комплемента (РСК) / ФГБУ «ВНИИЗЖ». - Утв. 21.09.17.18. Methodological recommendations for determining the concentration of 146S, 75S, 12S components of vaccine strains of cultural foot-and-mouth disease virus in the complement fixation reaction (FRR) / Federal State Budgetary Institution "ARRIAH". - Approved 09.21.17.

19. Методические указания по определению антигенного соответствия между эпизоотическими изолятами и производственными штаммами вируса ящура в перекрестной реакции микронейтрализации: утв. Россельхознадзором 13.09.2017 / ФГБУ «ВНИИЗЖ». - Владимир: 2017. - 24 с.19. Guidelines for determining antigenic correspondence between epizootic isolates and industrial strains of foot-and-mouth disease virus in a cross-microneutralization reaction: approved. Rosselkhoznadzor 09/13/2017 / FSBI "ARRIAH". - Vladimir: 2017. - 24 p.

20. Saitou N. and Nei М. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4:406-42.20. Saitou N. and Nei M. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4:406–42.

21. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap.Evolution 39:783-791.21. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap. Evolution 39:783-791.

22. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101:11030-11035.22. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101:11030–11035.

23. Kumar S., Stecher G., Li M., Knyaz C, and Tamura K. (2018). MEGA 6: Molecular Evolutionary Genetics Analysis across computing platforms. Molecular Biology and Evolution 35:1547-1549.23. Kumar S., Stecher G., Li M., Knyaz C., and Tamura K. (2018). MEGA 6: Molecular Evolutionary Genetics Analysis across computing platforms. Molecular Biology and Evolution 35:1547–1549.

24. Barnett P. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - 2002. - V. 25. - P. 345-364.24. Barnett P. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - 2002. - V. 25. - P. 345-364.

--->--->

<?xml version="1.0" encoding="UTF-8"?><?xml version="1.0" encoding="UTF-8"?>

<!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing <!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing

1.3//EN" "ST26SequenceListing_V1_3.dtd">1.3//EN" "ST26SequenceListing_V1_3.dtd">

<ST26SequenceListing dtdVersion="V1_3" fileName="Vaccine FMDV <ST26SequenceListing dtdVersion="V1_3" fileName="Vaccine FMDV

strain SAT-1 Nigeria 2015.xml" softwareName="WIPO Sequence" strain SAT-1 Nigeria 2015.xml" softwareName="WIPO Sequence"

softwareVersion="2.1.2" productionDate="2022-12-03">softwareVersion="2.1.2" productionDate="2022-12-03">

<ApplicationIdentification> <ApplicationIdentification>

<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>

<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>

<FilingDate>2022-12-03</FilingDate> <FilingDate>2022-12-03</FilingDate>

</ApplicationIdentification> </ApplicationIdentification>

<ApplicantFileReference>476</ApplicantFileReference> <ApplicantFileReference>476</ApplicantFileReference>

<EarliestPriorityApplicationIdentification> <EarliestPriorityApplicationIdentification>

<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>

<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>

<FilingDate>2022-12-03</FilingDate> <FilingDate>2022-12-03</FilingDate>

</EarliestPriorityApplicationIdentification> </EarliestPriorityApplicationIdentification>

<ApplicantName languageCode="ru">ФГБУ &quot;Федеральный центр охраны <ApplicantName languageCode="ru">FSBI "Federal Security Center"

здоровья животных&quot; (ФГБУ &quot;ВНИИЗЖ&quot;)</ApplicantName>animal health" (FSBI "ARRIAH")</ApplicantName>

<ApplicantNameLatin>FGBI &quot;ARRIAH&quot;</ApplicantNameLatin> <ApplicantNameLatin>FGBI &quot;ARRIAH&quot;</ApplicantNameLatin>

<InventorName languageCode="ru">Доронин Максим <InventorName languageCode="ru">Doronin Maxim

Игоревич</InventorName>Igorevich</InventorName>

<InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin> <InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin>

<InventionTitle languageCode="ru">Вакцина против ящура генотипа <InventionTitle languageCode="en">Vaccine against foot and mouth disease genotype

SAT-1/X из штамма «SAT-1/Нигерия/2015» культуральная инактивированная SAT-1/X from strain “SAT-1/Nigeria/2015” culture inactivated

сорбированная</InventionTitle>sorbed</InventionTitle>

<SequenceTotalQuantity>2</SequenceTotalQuantity> <SequenceTotalQuantity>2</SequenceTotalQuantity>

<SequenceData sequenceIDNumber="1"> <SequenceData sequenceIDNumber="1">

<INSDSeq> <INSDSeq>

<INSDSeq_length>663</INSDSeq_length> <INSDSeq_length>663</INSDSeq_length>

<INSDSeq_moltype>DNA</INSDSeq_moltype> <INSDSeq_moltype>DNA</INSDSeq_moltype>

<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>

<INSDSeq_feature-table> <INSDSeq_feature-table>

<INSDFeature> <INSDFeature>

<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>

<INSDFeature_location>1..663</INSDFeature_location> <INSDFeature_location>1..663</INSDFeature_location>

<INSDFeature_quals> <INSDFeature_quals>

<INSDQualifier> <INSDQualifier>

<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>

<INSDQualifier_value>genomic DNA</INSDQualifier_value> <INSDQualifier_value>genomic DNA</INSDQualifier_value>

</INSDQualifier> </INSDQualifier>

<INSDQualifier id="q1"> <INSDQualifier id="q1">

<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>

<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>

</INSDQualifier> </INSDQualifier>

</INSDFeature_quals> </INSDFeature_quals>

</INSDFeature> </INSDFeature>

</INSDSeq_feature-table> </INSDSeq_feature-table>

<INSDSeq_sequence>acaacgtcagcgggcgaaggtgcagaagtggtcacggtcgatgtttcgg <INSDSeq_sequence>acaacgtcagcgggcgaaggtgcagaagtggtcacggtcgatgtttcgg

cccacggcggaaatgcccgcccgacacggcgtcagcacactgatgtcgcgttccttctggaccgtttcaccccacggcggaaatgcccgcccgacacggcgtcagcacactgatgtcgcgttccttctggaccgtttcac

aaaaattggtaagacgacagacaacaagctggtccttgaccttctcaagactaaagagaaggcactggtgaaaaattggtaagacgacagacaacaagctggtccttgaccttctcaagactaaagagaaggcactggtg

ggcgcactcctccgctcagctacctactacttctgcgacctcgaggttgcggcagtgggtacgaacaagtggcgcactcctccgctcagctacctactacttctgcgacctcgaggttgcggcagtgggtacgaacaagt

gggtcggatgggtgccaaacgggtccccggtcgtgaacgaagtggacgacaacccagtcgtcttctcacagggtcggatgggtgccaaacgggtccccggtcgtgaacgaagtggacgacaacccagtcgtcttctcaca

caacggggtcacccgctttgccttaccgtacaccgcaccacaccaagtgttggccacagtgtacaaagggcaacggggtcacccgctttgccttaccgtacaccgcaccacaccaagtgttggccacagtgtacaaaggg

agctgcaagtacaagcccaccacggaggcacaacccgccgccatccgcggcgatttcgccacgctggccgagctgcaagtacaagcccaccacggaggcacaacccgccgccatccgcggcgatttcgccacgctggccg

cccgcctgtcctctgagacgcacattcccacatccttcaatttcggtatgatacttaccgagagcgaagtcccgcctgtcctctgagacgcacattcccacatccttcaatttcggtatgatacttaccgagagcgaagt

tgacgtgtacgtgcgcatgaagcgggccgagttgtactgccctcggcccctactcacaacctacgcccactgacgtgtacgtgcgcatgaagcgggccgagttgtactgccctcggcccctactcacaacctacgcccac

accggcgataggtacaaggtgaaactggtggcgccagaaaaacagatggcaaac</INSDSeq_sequenaccggcgataggtacaaggtgaaactggtggcgccagaaaaacagatggcaaac</INSDSeq_sequen

ce>ce>

</INSDSeq> </INSDSeq>

</SequenceData> </SequenceData>

<SequenceData sequenceIDNumber="2"> <SequenceData sequenceIDNumber="2">

<INSDSeq> <INSDSeq>

<INSDSeq_length>221</INSDSeq_length> <INSDSeq_length>221</INSDSeq_length>

<INSDSeq_moltype>AA</INSDSeq_moltype> <INSDSeq_moltype>AA</INSDSeq_moltype>

<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>

<INSDSeq_feature-table> <INSDSeq_feature-table>

<INSDFeature> <INSDFeature>

<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>

<INSDFeature_location>1..221</INSDFeature_location> <INSDFeature_location>1..221</INSDFeature_location>

<INSDFeature_quals> <INSDFeature_quals>

<INSDQualifier> <INSDQualifier>

<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>

<INSDQualifier_value>protein</INSDQualifier_value> <INSDQualifier_value>protein</INSDQualifier_value>

</INSDQualifier> </INSDQualifier>

<INSDQualifier id="q4"> <INSDQualifier id="q4">

<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>

<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>

</INSDQualifier> </INSDQualifier>

</INSDFeature_quals> </INSDFeature_quals>

</INSDFeature> </INSDFeature>

</INSDSeq_feature-table> </INSDSeq_feature-table>

<INSDSeq_sequence>TTSAGEGAEVVTVDVSAHGGNARPTRRQHTDVAFLLDRFTKIGKTTDNK <INSDSeq_sequence>TTSAGEGAEVVTVDVSAHGGNARPTRRQHTDVAFLLDRFTKIGKTTDNK

LVLDLLKTKEKALVGALLRSATYYFCDLEVAAVGTNKWVGWVPNGSPVVNEVDDNPVVFSHNGVTRFALPLVLDLLKTKEKALVGALLRSATYYFCDLEVAAVGTNKWVGWVPNGSPVVNEVDDNPVVFSHNGVTRFALP

YTAPHQVLATVYKGSCKYKPTTEAQPAAIRGDFATLAARLSSETHIPTSFNFGMILTESEVDVYVRMKRAYTAPHQVLATVYKGSCKYKPTTEAQPAAIRGDFATLAARLSSETHIPTSFNFGMILTESEVDVYVRMKRA

ELYCPRPLLTTYAHTGDRYKVKLVAPEKQMAN</INSDSeq_sequence>ELYCPRPLLTTYAHTGDRYKVKLVAPEKQMAN</INSDSeq_sequence>

</INSDSeq> </INSDSeq>

</SequenceData> </SequenceData>

</ST26SequenceListing></ST26SequenceListing>

<---<---

Claims (3)

1. Вакцина против ящура культуральная инактивированная сорбированная, содержащая активное вещество и адъювант, отличающаяся тем, что в качестве активного вещества она содержит авирулентный и очищенный антигенный материал из гомологичного возбудителю инфекции штамма «SАТ-1/Нигерия/2015» генотипа SAT-1/X, депонированного во Всероссийской государственной коллекции экзотических типов вируса ящура и других патогенов животных Федерального государственного бюджетного учреждения «Федеральный центр охраны здоровья животных», под регистрационным номером: №414 - деп / 22-48 - ГКШМ ФГБУ «ВНИИЗЖ», репродуцированного в перевиваемой суспензионной клеточной линии почки новорожденного сирийского хомячка BHK-21/SUSP/ARRIAH, в количестве не менее 4,0 мкг; в качестве адъюванта гидроксид алюминия 10%-ный коллоидный раствор с содержанием 45% по объему 4,0% в пересчете на сухое вещество в комплексе с сапонином в количестве 1,5 мг и поддерживающую среду до 1,0 см3.1. Cultural inactivated sorbed vaccine against foot-and-mouth disease, containing an active substance and an adjuvant, characterized in that as an active substance it contains avirulent and purified antigenic material from the strain “SAT-1/Nigeria/2015” of genotype SAT-1/X, homologous to the causative agent of the infection , deposited in the All-Russian State Collection of exotic types of foot-and-mouth disease virus and other animal pathogens of the Federal State Budgetary Institution "Federal Center for Animal Health", under registration number: No. 414 - dep / 22-48 - GKShM FSBI "ARRIAH", reproduced in a continuous suspension cell newborn Syrian hamster kidney line BHK-21/SUSP/ARRIAH, in an amount of at least 4.0 μg; as an adjuvant, aluminum hydroxide 10% colloidal solution containing 45% by volume, 4.0% in terms of dry matter in combination with saponin in an amount of 1.5 mg and a supporting medium up to 1.0 cm 3 . 2. Вакцина по п. 1, отличающаяся тем, что она содержит авирулентный и очищенный антигенный материал из штамма «SAT-1/Нигерия/2015» генотипа SAT-1/X, полученный в чувствительной биологической системе BHK-21/SUSP/ARRIAH и представляющий собой вирусную суспензию, содержащую преимущественно 146S иммуногенный компонент вируса ящура генотипа SAT-1/X.2. The vaccine according to claim 1, characterized in that it contains avirulent and purified antigenic material from the strain “SAT-1/Nigeria/2015” genotype SAT-1/X, obtained in the sensitive biological system BHK-21/SUSP/ARRIAH and which is a viral suspension containing predominantly the 146S immunogenic component of the foot-and-mouth disease virus genotype SAT-1/X. 3. Вакцина по п. 1, отличающаяся тем, что она содержит авирулентный и очищенный антигенный материал из гомологичного возбудителю инфекции штамма «SAT-1/Нигерия/2015» генотипа SAT-1/X и адъювант - гидроксид алюминия в комплексе с сапонином в эффективном соотношении: 55% и 45% соответственно.3. The vaccine according to claim 1, characterized in that it contains avirulent and purified antigenic material from the SAT-1/Nigeria/2015 strain homologous to the infectious agent, genotype SAT-1/X, and an adjuvant - aluminum hydroxide in combination with saponin in an effective ratio: 55% and 45% respectively.
RU2023108654A 2023-04-04 Culture inactivated adsorbed vaccine against fmd of sat-1/x genotype from sat-1/nigeria/2015 strain RU2810132C1 (en)

Publications (1)

Publication Number Publication Date
RU2810132C1 true RU2810132C1 (en) 2023-12-22

Family

ID=

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
RU2563345C1 (en) * 2014-04-16 2015-09-20 Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") Inactivated sorbed vaccine against fmd of type a
EP3443097A4 (en) * 2016-04-11 2020-04-22 Biogénesis Bagó Uruguay S.A. Universal vaccine for viral diseases

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
RU2563345C1 (en) * 2014-04-16 2015-09-20 Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") Inactivated sorbed vaccine against fmd of type a
EP3443097A4 (en) * 2016-04-11 2020-04-22 Biogénesis Bagó Uruguay S.A. Universal vaccine for viral diseases
US10940196B2 (en) * 2016-04-11 2021-03-09 Biogenesis Bagó Hong-Kong Limited Universal vaccine for viral diseases

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
David Ehizibolo et al., Foot-and-mouth disease virus serotype SAT1 in cattle, Nigeria, Transboundary and Emerging Diseases, 64(9), February 2017, Abstract. Hye-Eun Jo et al., Evaluation of novel inactivated vaccines for the SAT 1, SAT 2 and SAT 3 serotypes of foot-and-mouth disease in pigs, Virology Journal, volume 16, Article number: 156 (2019), Abstract. *

Similar Documents

Publication Publication Date Title
CN108456663B (en) Type 1 bovine viral diarrhea virus-like particle and preparation and application thereof
RU2593718C1 (en) Inactivated emulsion vaccine against foot-and-mouth disease types a, o, asia-1
RU2603003C1 (en) Inactivated sorptive vaccine to fmd types a, o, asia-1
ES2209052T3 (en) BIRNAVIRUS RECOMBINANT VACCINE.
RU2699671C1 (en) Vaccine for early protection against foot-and-mouth disease of type o inactivated emulsion
RU2810132C1 (en) Culture inactivated adsorbed vaccine against fmd of sat-1/x genotype from sat-1/nigeria/2015 strain
RU2665849C1 (en) Inactivated emulsion vaccine against foot-and-mouth disease type o
RU2815536C1 (en) Culture inactivated sorbed vaccine against foot and mouth disease from a/tanzania/2013 strain of a/africa/g-i genotype
RU2815534C1 (en) Culture inactivated adsorbed vaccine against fmd of sat-1/i genotype from sat-1/tanzania/2012 strain
RU2810131C1 (en) CULTURE INACTIVATED SORBED VACCINE AGAINST FOOT AND MOUTH DISEASE OF O/ME-SA/PanAsia2ANT-10 GENOTYPE FROM O N2356/PAKISTAN/2018 STRAIN
RU2802192C1 (en) Inactivated sorbed vaccine against fmd of o/ea-2 genotype from o/kenya/2017 strain culture
RU2817381C1 (en) Cultural inactivated sorbed vaccine against foot-and-mouth disease from the strain &#34;a/egypt/euro-sa/2022&#34;
RU2809219C1 (en) Culturally inactivated sorbed vaccine against foot and mouth disease of sat-1/nwz genotype
RU2340672C2 (en) Mutant of virus infectious of bursal disease (ibdv), expressing virus-neutralised epitopes specific to classical and alternative ibdv strains
RU2816264C1 (en) Cultural inactivated emulsion vaccine against o/ea-3 genotype foot-and-mouth disease of o n2241/ethiopia/2011 strain
RU2804803C1 (en) Culture inactivated emulsion vaccine against fmd of o/sea/mya-98 genotype from o n2383/primorsky/2019 strain
RU2815541C1 (en) Culturally inactivated sorbed vaccine against foot and mouth disease of sat-2/iv genotype
RU2799605C1 (en) FMD CULTURE INACTIVATED SORBED VACCINE FROM A/Iran/2018 STRAIN OF A/ASIA/Iran-05SIS-13 NEW GENOTYPE
RU2804875C1 (en) Culture inactivated adsorbed vaccine against fmd of sat-2/vii genotype from sat-2/eritrea/1998 strain
RU2815537C1 (en) Cultural inactivated emulsion vaccine against foot and mouth disease from o no. 2620/orenburgsky/2021 strain of o/me-sa/ind-2001e genotype
RU2798293C1 (en) Fmd culture inactivated sorbed vaccine from a/afghanistan/2017 strain of a/asia/iran-05far-11 new genotype
CN117897170A (en) FMDV virus-like particles with stabilizing mutations
RU2816944C1 (en) Cultural inactivated emulsion vaccine against foot-and-mouth disease serotype o from strain &#34;o/arriah/mya-98&#34;
RU2772713C1 (en) Vaccine for early protection against foot-and-mouth disease from strain a 2205/g iv cultural inactivated emulsion
AU2016203333A1 (en) Infectious bronchitis vaccines derived from IB-QX-like strains