RU2804803C1 - Culture inactivated emulsion vaccine against fmd of o/sea/mya-98 genotype from o n2383/primorsky/2019 strain - Google Patents
Culture inactivated emulsion vaccine against fmd of o/sea/mya-98 genotype from o n2383/primorsky/2019 strain Download PDFInfo
- Publication number
- RU2804803C1 RU2804803C1 RU2023112433A RU2023112433A RU2804803C1 RU 2804803 C1 RU2804803 C1 RU 2804803C1 RU 2023112433 A RU2023112433 A RU 2023112433A RU 2023112433 A RU2023112433 A RU 2023112433A RU 2804803 C1 RU2804803 C1 RU 2804803C1
- Authority
- RU
- Russia
- Prior art keywords
- foot
- mouth disease
- strain
- primorsky
- genotype
- Prior art date
Links
Abstract
Description
Изобретение относится к области ветеринарной вирусологии и биотехнологии, а именно к разработке вакцины против ящура генотипа O/SEA/Mya-98 из штамма «О №2383 /Приморский/ 2019» культуральной инактивированной эмульсионной.The invention relates to the field of veterinary virology and biotechnology, namely to the development of a cultural inactivated emulsion vaccine against foot and mouth disease genotype O/SEA/Mya-98 from the strain “O No. 2383 /Primorsky/ 2019”.
Ящур остается серьезным препятствием на пути развития и сокращения бедности во всем развивающемся мире по многим причинам, включая стоимость мер борьбы, закрытие доступа к ценным глобальным рынкам животноводческой продукции, свободной от ящура, потери производства из-за снижения надоев молока, снижения прироста живой массы и неспособности зараженного скота выполнять тяга. Вирус ящура поражает множество парнокопытных животных, включая крупный рогатый скот, овец, коз, свиней, всех диких жвачных животных, с высокой заболеваемостью у взрослых животных. Высокая смертность может наблюдаться у молодых животных из-за миокардита.Foot-and-mouth disease remains a major barrier to development and poverty reduction throughout the developing world for many reasons, including the cost of control measures, the denial of access to valuable global markets for FMD-free livestock products, loss of production due to decreased milk yields, decreased live weight gain and inability of infected livestock to perform traction. Foot-and-mouth disease virus affects a variety of artiodactyl animals, including cattle, sheep, goats, pigs, and all wild ruminants, with high incidence in adult animals. High mortality may occur in young animals due to myocarditis.
Выделяют семь следующих серотипов вируса ящура: О, А, С, SAT-1, SAT-2, SAT-3 и Азия-1, при этом представители серотипа О является очень распространенными, что определяет актуальность изготовления вакцин для защиты от ящура данного серотипа.There are seven following serotypes of foot-and-mouth disease virus: O, A, C, SAT-1, SAT-2, SAT-3 and Asia-1, while representatives of serotype O are very common, which determines the relevance of producing vaccines to protect against foot-and-mouth disease of this serotype.
Каждый серотип генетически разделен на различные топотипы, а иногда на отдельные генетические линии и даже сублинии. Различия между ними определяют при анализе нуклеотидной последовательности высоковариабельного гена 1D, который кодирует аминокислотную последовательность поверхностного белка VP1 [1]. Учитывая, что возбудительEach serotype is genetically divided into different topotypes, and sometimes into separate genetic lineages and even sublineages. The differences between them are determined by analyzing the nucleotide sequence of the highly variable 1D gene, which encodes the amino acid sequence of the surface protein VP 1 [1]. Considering that the pathogen
ящура является РНК-содержащим вирусом, для него характерно образование большого количества мутаций во время репликации вирусного генома (преимущество в 5'-участке) и явление рекомбинации (преимущественно в 3'-участке). Именно по этой причине в пределах серотипов выделяют более 60 генетических линий и сублиний [2]. Восстановление после переболевания животным каким-либо одним серотипом не обеспечивает иммунную защиту против другого серотипа и даже некоторых других генетических линий [3].foot and mouth disease is an RNA-containing virus, it is characterized by the formation of a large number of mutations during replication of the viral genome (predominantly in the 5' region) and the phenomenon of recombination (mainly in the 3' region). It is for this reason that more than 60 genetic lines and sublines are distinguished within the serotypes [2]. Recovery from an animal being infected with any one serotype does not provide immune protection against another serotype or even some other genetic lines [3].
Выявление генетических связей между различными изолятами и штаммами проводят с помощью нуклеотидного секвенирования, что дает возможность в условиях вспышки определить происхождение вируса. Антигенные характеристики вируса, связанные с появлением новых штаммов, важны для анализа вспышек и создания оптимальных вакцин [4, 6].Identification of genetic relationships between different isolates and strains is carried out using nucleotide sequencing, which makes it possible to determine the origin of the virus in outbreak conditions. Antigenic characteristics of the virus associated with the emergence of new strains are important for analyzing outbreaks and creating optimal vaccines [4, 6].
Серотип О вируса ящура разделен на 11 следующих топотипов: EAST AFRICA 1-4 (Восточная Африка) (ЕА-1-4), SOUTHEAST ASIA (Юго-Восточная Азия) (SEA), EUROPE-SOUTH AMERICA (Европа -Южная Америка) (EURO-SA), INDONESIA-1 и 2 (Индонезия-1 и 2) (ISA-1 и -2), CATHAY (Китай), MIDDLE EAST-SOUTH ASIA (ME-SA) (Ближний Восток -Южная Азия) и WEST AFRICA (Западная Африка) (WA). Такое высокое генетическое и антигенное разнообразие приводит к проблемам при специфической профилактики ящура при применении культуральных инактивированных противоящурных вакцин. В результате возникает необходимость создания новых средств специфической иммунопрофилактики в отношении вируса ящура серотипа О [5-12]. Представленное многообразие представителей серотипа О обусловлено высокой степенью изменчивости РНК-содержащих вирусов и активным перемещением данного возбудителя на территориях стран Азии, преимущественно Юго-Восточной, Центральной и Средней.Foot and mouth disease virus serotype O is divided into the following 11 topotypes: EAST AFRICA 1-4 (EA-1-4), SOUTHEAST ASIA (SEA), EUROPE-SOUTH AMERICA (Europe-South America) ( EURO-SA), INDONESIA-1 and 2 (ISA-1 and 2), CATHAY (China), MIDDLE EAST-SOUTH ASIA (ME-SA) and WEST AFRICA (West Africa) (WA). This high genetic and antigenic diversity leads to problems in the specific prevention of FMD when using culture-inactivated FMD vaccines. As a result, there is a need to create new means of specific immunoprophylaxis against foot-and-mouth disease virus serotype O [5-12]. The presented diversity of representatives of serotype O is due to the high degree of variability of RNA-containing viruses and the active movement of this pathogen in the territories of Asian countries, mainly Southeast, Central and Middle Asia.
С целью недопущения возникновения ящура в хозяйствах Российской Федерации применяется комплекс мероприятий по борьбе и профилактике ящура, который направлен на предупреждение заноса вируса в страну, систематическую вакцинацию животных в буферной зоне, проведение мониторинга иммунного статуса крупного, мелкого рогатого скота и свиней.In order to prevent the occurrence of foot-and-mouth disease on farms in the Russian Federation, a set of measures is used to combat and prevent foot-and-mouth disease, which is aimed at preventing the introduction of the virus into the country, systematically vaccinating animals in the buffer zone, and monitoring the immune status of large and small cattle and pigs.
Для иммунизации животных должна применяться вакцина, изготовленная из вируса, гомологичного полевым изолятам, что подтверждено исследованиями многих ученых [6, 7, 8, 9, 10, 11].To immunize animals, a vaccine made from a virus homologous to field isolates should be used, which is confirmed by the studies of many scientists [6, 7, 8, 9, 10, 11].
Данная инфекция продолжает оставаться экономически значимой проблемой. Цельновирионные вакцины на сегодняшний день в отношении ящура по-прежнему признаются наиболее эффективными, что крайне важно для борьбы с самым контагиозным заболеванием в мире [8, 9, 12, 13].This infection continues to be an economically significant problem. Today, whole-virion vaccines against foot-and-mouth disease are still recognized as the most effective, which is extremely important for combating the most contagious disease in the world [8, 9, 12, 13].
Для проведения эффективной кампании по вакцинации нужно наличие эффективной и безопасной вакцины, содержащей в качестве иммуногенной составляющей антиген вируса, соответствующей эпизоотическому распространяющемуся изоляту определенного генотипа. Создание подобных вакцин по-прежнему является крайне актуальной задачей. Достижение данной цели позволит эффективно применять вакцину в неблагополучных регионах и угрожаемой зоне для формирования иммунитета против конкретного генотипа вируса ящура с целью обеспечения ветеринарного благополучия [14, 15, 16].To conduct an effective vaccination campaign, it is necessary to have an effective and safe vaccine containing as an immunogenic component a viral antigen corresponding to the epizootic spreading isolate of a certain genotype. The creation of such vaccines is still an extremely urgent task. Achieving this goal will make it possible to effectively use the vaccine in disadvantaged regions and threatened areas to build immunity against a specific genotype of the foot-and-mouth disease virus in order to ensure veterinary well-being [14, 15, 16].
На территории Российской Федерации вспышки ящура имеют спорадический характер и вызваны заносом возбудителя с территории сопредельных стран, так как отдельные регионы России граничат с эндемичными по ящуру странами Азии и подвержены очень высокой степени риска заноса инфекционного агента с территории данных государств. При торгово-экономических операциях имеются серьезные риски заноса изолятов вируса ящура на территорию Российской Федерации. Это может подорвать ветеринарное благополучие нашей страны по ящуру, исходя из этого, требуется заранее принимать меры по созданию безопасной и эффективной противоящурной вакцины.On the territory of the Russian Federation, outbreaks of foot-and-mouth disease are sporadic and are caused by the introduction of the pathogen from the territory of neighboring countries, since certain regions of Russia border on Asian countries that are endemic for foot-and-mouth disease and are subject to a very high risk of introducing the infectious agent from the territory of these states. During trade and economic transactions there are serious risks of introducing foot-and-mouth disease virus isolates into the territory of the Russian Federation. This could undermine the veterinary well-being of our country regarding foot-and-mouth disease; therefore, it is necessary to take measures in advance to create a safe and effective foot-and-mouth disease vaccine.
В Российской Федерации вспышки ящура типа О регистрировались начиная с 2000 по 2021 гг. на территории Приморского, Хабаровского, Забайкальского краев, Амурской, Оренбургской областей, Республики Башкортостан. Вспышки болезни были вызваны вирусом ящура типа О и генотипов: O/SEA/Mya-98, O/ME-SA/PanAsia, O/ME-SA/Ind-2001.In the Russian Federation, outbreaks of foot-and-mouth disease type O were recorded from 2000 to 2021. on the territory of Primorsky, Khabarovsk, Transbaikal territories, Amur, Orenburg regions, and the Republic of Bashkortostan. Outbreaks of the disease were caused by foot and mouth disease virus type O and genotypes: O/SEA/Mya-98, O/ME-SA/PanAsia, O/ME-SA/Ind-2001.
В Юго-Восточной, Южной, Восточной Азии вспышки ящура генотипа O/SEA/Mya-98 имеют спорадический характер. Обнаружено, что в Монголии были выявлены изоляты вируса ящура, которые принадлежат к данному генотипу в 2004, 2010, 2015, 2017, 2018, 2019 гг.В нашей стране регистрировали вспышки ящура данного генотипа в 2010 году (изоляты O/Russia/Jul/2010 и O/Russia/Aug/2010), в 2019 году (изолят O/Primorskiy/RUS/2/2019). В настоящее время представители данного генотипа также циркулируют в странах Ю-В Азии. Следует отметить, что начиная с 2019 г. появились заметные изменения в нуклеотидном и аминокислотном составе изолятов вируса ящура данного генотипа. Данная генетическая модификация значительно отличается от своего предшественника (вакцинный штамм «О №2212/Приморский/2014») и, соответственно, прототипная вакцина против ящура не обеспечивает полной защиты от генотипа O/SEA/Mya-98. Исходя из анализа, наиболее актуальным претендентом для создания эффективной вакцины, которая будет обеспечивать защиту от ящура генотипа O/SEA/Mya-97 с учетом появившихся мутаций в геноме вируса, является штамм «О №2383/Приморский/2019».In Southeast, South, and East Asia, outbreaks of foot and mouth disease of the O/SEA/Mya-98 genotype are sporadic. It was found that in Mongolia, foot and mouth disease virus isolates were identified that belong to this genotype in 2004, 2010, 2015, 2017, 2018, 2019. Outbreaks of foot and mouth disease of this genotype were recorded in our country in 2010 (isolates O/Russia/Jul/2010 and O/Russia/Aug/2010), in 2019 (isolate O/Primorskiy/RUS/2/2019). Currently, representatives of this genotype also circulate in the countries of Southeast Asia. It should be noted that since 2019, noticeable changes have appeared in the nucleotide and amino acid composition of foot-and-mouth disease virus isolates of this genotype. This genetic modification is significantly different from its predecessor (vaccine strain “O No. 2212/Primorsky/2014”) and, accordingly, the prototype vaccine against foot-and-mouth disease does not provide complete protection against the O/SEA/Mya-98 genotype. Based on the analysis, the most relevant candidate for creating an effective vaccine that will provide protection against foot and mouth disease of the O/SEA/Mya-97 genotype, taking into account the emerging mutations in the virus genome, is the strain “O No. 2383/Primorsky/2019”.
Известны производственные штаммы вируса ящура серотипа О, которые применяются для производства средств специфической профилактики ящура:There are known production strains of foot-and-mouth disease virus serotype O, which are used for the production of specific foot-and-mouth disease prevention products:
- штамм «О/Тайвань/1997» (генотип O/CATHAY/CAM 94),- strain “O/Taiwan/1997” (genotype O/CATHAY/CAM 94),
- штамм «О №2212/Приморский/2014» (генотип O/SEA/Mya-98),- strain “O No. 2212/Primorsky/2014” (genotype O/SEA/Mya-98),
- штамм «О/Приморский/2012» (генотип O/ME-SA/PanAsia),- strain “O/Primorsky/2012” (genotype O/ME-SA/PanAsia),
- штамм «О/Саудовская Аравия/2008» (генотип О/ME-SA/PanAsia2),- strain “O/Saudi Arabia/2008” (genotype O/ME-SA/PanAsia2),
- штамм «О/Забайкальский/2016» (генотип O/ME-SA/Ind-2001d).- strain “O/Zabaikalsky/2016” (genotype O/ME-SA/Ind-2001d).
Изолят «O/Primorskiy/RUS/2/2019» вируса ящура был выделен из патологического материала от крупного рогатого скота на территории села Григорьевка Михайловского района Приморского края Российской Федерации в 2019 году. При проведении научных исследований в ФГБУ «ВНИИЗЖ» путем адаптации к репродукции в первично-трипсинизированной монослойной клеточной линии почки свиньи СП, в перевиваемых культурах клеток BNK-21/SUSP/ARRIAH, IB-RS-2, ПСГК-30 был охарактеризован и получил название - штамм «О №2383/Приморский/2019» серотипа О.The foot-and-mouth disease virus isolate “O/Primorskiy/RUS/2/2019” was isolated from pathological material from cattle in the village of Grigoryevka, Mikhailovsky district, Primorsky Territory, Russian Federation in 2019. During scientific research at the Federal State Budgetary Institution "ARRIAH" by adaptation to reproduction in the primary trypsinized monolayer pig kidney cell line SP, in continuous cell cultures BNK-21/SUSP/ARRIAH, IB-RS-2, PSGK-30 was characterized and named - strain “O No. 2383/Primorsky/2019” of serotype O.
По результатам сравнительного анализа нуклеотидных последовательностей выделенный штамм принадлежит к генотипу O/SEA/Mya-98 вируса ящура, который значительно отличается от производственных штаммов вируса ящура серотипа О (Фиг. 1).According to the results of a comparative analysis of nucleotide sequences, the isolated strain belongs to the O/SEA/Mya-98 genotype of foot-and-mouth disease virus, which differs significantly from the production strains of foot-and-mouth disease virus serotype O (Fig. 1).
По причине значительного увеличения торгово-экономических взаимоотношений между Россией и странами Азии, в которых стабильно регистрируют вспышки ящура генотипа O/SEA/Mya-98, возникает опасность новых случаев возникновения ящура в Российской Федерации и особое значение приобретает проблема возможной экстренной профилактики данного заболевания для формирования иммунитета у восприимчивых животных. Таким образом, возникла необходимость разработать вакцину против ящура генотипа O/SEA/Mya-98 из штамма «О №2383/Приморский/2019» культуральную инактивированную эмульсионную для обеспечения биологической безопасности и ветеринарного благополучия территории Российской Федерации, сопредельных государств и стран, эндемичных по ящуру, которые будут использовать данный препарат для профилактики заболевания.Due to the significant increase in trade and economic relations between Russia and Asian countries, in which outbreaks of foot-and-mouth disease of the O/SEA/Mya-98 genotype are consistently recorded, there is a danger of new cases of foot-and-mouth disease in the Russian Federation and the problem of possible emergency prevention of this disease for the formation of immunity in susceptible animals. Thus, there was a need to develop a cultural inactivated emulsion vaccine against foot-and-mouth disease genotype O/SEA/Mya-98 from the strain “O No. 2383/Primorsky/2019” to ensure the biological safety and veterinary well-being of the territory of the Russian Federation, neighboring states and countries where foot-and-mouth disease is endemic who will use this drug to prevent the disease.
Наиболее близкой предлагаемому изобретению по совокупности существенных признаков является вакцина инактивированная эмульсионная против ящура серотипа О (штамм «О №2212/Приморский/2014», генотип O/SEA/Mya-98) [17], содержащая активное вещество в виде авирулентного и очищенного культурального антигенного материала из гомологичного возбудителю ящура штамма «О №2212/Приморский/2014», полученного в чувствительной биологической системе, и целевые добавки в виде масляного адъюванта Montanide ISA-206 VG («Seppic», P. Франция): концентрация антигена (инактивированные 146S+75S компоненты вируса ящура) не менее 3,0 мкг/см3, содержание масляного адъюванта Montanide ISA-206 VG - 50% по массе, добавка в виде поддерживающей среды - до 1,0 см3 (прототип).The closest to the proposed invention in terms of the totality of essential features is an inactivated emulsion vaccine against foot-and-mouth disease serotype O (strain “O No. 2212/Primorsky/2014”, genotype O/SEA/Mya-98) [17], containing the active substance in the form of an avirulent and purified cultural antigenic material from the strain “O No. 2212/Primorsky/2014” homologous to the foot-and-mouth disease pathogen, obtained in a sensitive biological system, and targeted additives in the form of oil adjuvant Montanide ISA-206 VG (“Seppic”, P. France): antigen concentration (inactivated 146S +75S components of the foot and mouth disease virus) not less than 3.0 μg/cm 3 , the content of the oil adjuvant Montanide ISA-206 VG is 50% by weight, the additive in the form of a supporting medium is up to 1.0 cm 3 (prototype).
В качестве чувствительной биологической системы для репродукции вируса ящура используют перевиваемую клеточную линию почки новорожденного сирийского хомячка BHK-21/2-17, в качестве поддерживающей среды применяют среду Игла DMEM без внесения сыворотки, с добавлением ферментативного гидролизата мышц сухого, гидролизата белков крови сухого при рН среды 7,45-7,65.As a sensitive biological system for the reproduction of the foot and mouth disease virus, a continuous cell line of the kidney of a newborn Syrian hamster BHK-21/2-17 is used; as a supporting medium, Eagle's DMEM medium is used without adding serum, with the addition of enzymatic hydrolyzate of dry muscle, hydrolyzate of dry blood proteins at pH Wednesdays 7.45-7.65.
Для инактивации вируса используют аминоэтилэтиленимин (АЭЭИ). При изготовлении эмульсионной вакцины в качестве адъюванта служит масляный адъювант Montanide ISA-206 VG («Seppic», P. Франция). Очистку вируссодержащей суспензии от балластных примесей осуществляют с применением полигексаметиленгуанидин гидрохлорида (ПГМГ).Aminoethylethylenimine (AEEI) is used to inactivate the virus. When producing an emulsion vaccine, Montanide ISA-206 VG oil adjuvant (Seppic, P. France) is used as an adjuvant. Purification of the virus-containing suspension from ballast impurities is carried out using polyhexamethylene guanidine hydrochloride (PHMG).
Существенный недостаток вакцины-прототипа состоит в его низкой иммуногенной активности относительно появившихся штаммов/изолятов вируса ящура генотипа O/SEA/Mya-98.A significant drawback of the prototype vaccine is its low immunogenic activity relative to the emerging strains/isolates of the foot-and-mouth disease virus genotype O/SEA/Mya-98.
Для решения указанной проблемы было создано настоящее изобретение, в которое входила разработка вакцины против ящура генотипа O/SEA/Mya-98 из штамма «О №2383/Приморский/2019» культуральной инактивированной эмульсионной. Данная вакцина предполагает высокое содержание 146S иммуногенного компонента в дозе препарата [19, 20].To solve this problem, the present invention was created, which included the development of a cultural inactivated emulsion vaccine against foot and mouth disease genotype O/SEA/Mya-98 from the strain “O No. 2383/Primorsky/2019”. This vaccine assumes a high content of the 146S immunogenic component in the dose of the drug [19, 20].
Технический результат от использования предлагаемого изобретения заключается в расширении арсенала противоящурных инактивированных культуральных эмульсионных вакцин для защиты животных против изолятов и штаммов вируса ящура серотипа О и, в частности, генотипа O/SEA/Mya-98.The technical result from the use of the proposed invention is to expand the arsenal of anti-foot-and-mouth disease inactivated cultural emulsion vaccines to protect animals against isolates and strains of foot-and-mouth disease virus serotype O and, in particular, genotype O/SEA/Mya-98.
Указанный технический результат достигнут созданием вакцины против ящура генотипа O/SEA/Mya-98 из штамма «О №2383/Приморский/2019» культуральной инактивированной эмульсионной, охарактеризованной следующей совокупностью признаков, отраженных ниже.The specified technical result was achieved by creating a cultural inactivated emulsion vaccine against foot and mouth disease genotype O/SEA/Mya-98 from the strain “O No. 2383/Primorsky/2019”, characterized by the following set of characteristics reflected below.
Разработанная вакцина в 1,0 см3 препарата содержит следующие основные компоненты: 1) активное вещество в виде авирулентного и очищенного антигенного материала из гомологичного возбудителю инфекции штамма «О №2383/Приморский/2019» (генотип O/SEA/Mya-98) вируса ящура, репродуцированного в перевиваемой суспензионной клеточной линии BHK-21/SUSP/ARRIAH, в количестве не менее 4,0 мкг; 2) масляный адъювант Montanide ISA-71 R VG, обеспечивающий усиление иммунного ответа у животных с содержанием 70% по массе, 3) поддерживающая среда -до 1,0 см3.The developed vaccine in 1.0 cm 3 of the drug contains the following main components: 1) the active substance in the form of avirulent and purified antigenic material from the strain “O No. 2383/Primorsky/2019” (genotype O/SEA/Mya-98) of the virus homologous to the causative agent of the infection foot and mouth disease reproduced in the continuous suspension cell line BHK-21/SUSP/ARRIAH, in an amount of at least 4.0 μg; 2) oil adjuvant Montanide ISA-71 R VG, which provides an enhanced immune response in animals with a content of 70% by weight, 3) maintenance medium - up to 1.0 cm 3 .
Штамм вируса ящура штамма «О №2383/Приморский/2019» (генотип O/SEA/Mya-98) депонирован во Всероссийской государственной коллекции экзотических типов вирусов ящура и других патогенов животных (ГКШМ) ФГБУ «ВНИИЗЖ», под регистрационным номером: №419 - деп / 22-53 -ГКШМ ФГБУ «ВНИИЗЖ».The foot and mouth disease virus strain “O No. 2383/Primorsky/2019” (genotype O/SEA/Mya-98) was deposited in the All-Russian State Collection of Exotic Types of Foot and Mouth Disease Viruses and Other Animal Pathogens (GKSHM) of the Federal State Budgetary Institution “ARRIAH”, under registration number: No. 419 - dep / 22-53 -GKShM FSBI "ARRIAH".
Штамм адаптирован к первично-трипсинизированным монослойным клеткам линии свиной почки (СП) и перевиваемым клеточным линиям из почки новорожденного сирийского хомячка (BHK-21/SUSP/ARRIAH), почки свиньи (IB-RS-2) и почки сибирского горного козерога (ПСГК-30).The strain is adapted to primary trypsinized monolayer cells of the porcine kidney (SP) line and continuous cell lines from newborn Syrian hamster kidney (BHK-21/SUSP/ARRIAH), pig kidney (IB-RS-2) and Siberian ibex kidney (PSGK- thirty).
Для изготовления вакцины в качестве чувствительной биологической системы предпочтительно используют перевиваемую суспензионную культуру клеток BHK-21/SUSP/ARRIAH, а в качестве поддерживающей среды применяют среду Хэнкса без внесения сыворотки, но с добавлением гидролизата белков крови в количестве 5,0% от общего объема при рН среды 7,45-7,65. Инактивацию вируса проводят с использованием аминоэтилэтиленимина (АЭЭИ) с концентрацией 0,034% от объема вируссодержащей суспензии. Инактивированный вирус очищают от балластных примесей с помощью полигексаметиленгуанидина (ПГМГ), который вносят в суспензию до концентрации 0,014%) от общего объема.To produce a vaccine, it is preferable to use a continuous suspension culture of BHK-21/SUSP/ARRIAH cells as a sensitive biological system, and Hanks’ medium is used as a supporting medium without adding serum, but with the addition of blood protein hydrolysate in an amount of 5.0% of the total volume at pH of the medium is 7.45-7.65. Virus inactivation is carried out using aminoethylethylenimine (AEEI) with a concentration of 0.034% of the volume of the virus-containing suspension. The inactivated virus is purified from ballast impurities using polyhexamethylene guanidine (PHMG), which is added to the suspension to a concentration of 0.014%) of the total volume.
Авирулентный и очищенный антиген штамма «О №2383/Приморский/2019» (генотип O/SEA/Mya-98) вируса ящура представляет собой суспензию, содержащую инактивированный 146S иммуногенный компонент вируса ящура. Концентрацию компонента в продукте оценивают с помощью количественного варианта реакции связывания комплемента (РСК) [18, 19].The avirulent and purified antigen of the strain “O No. 2383/Primorsky/2019” (genotype O/SEA/Mya-98) of the foot-and-mouth disease virus is a suspension containing the inactivated 146S immunogenic component of the foot-and-mouth disease virus. The concentration of the component in the product is assessed using a quantitative version of the complement fixation reaction (CRR) [18, 19].
Для создания вакцины используют вирусный материал, содержащий в 1,0 см3 не менее 4,0 мкг инактивированных иммуногенных 146S частиц вируса ящура. Заявленную концентрацию иммуногенного компонента в вакцинном препарате обеспечивают благодаря концентрированию антигена с помощью установки тангенциальной фильтрации Centramate 500S Pall.To create a vaccine, viral material is used that contains at least 4.0 μg of inactivated immunogenic 146S particles of foot-and-mouth disease virus per 1.0 cm 3 . The declared concentration of the immunogenic component in the vaccine preparation is ensured by concentrating the antigen using a Centramate 500S Pall tangential filtration unit.
Вакцину против ящура генотипа O/SEA/Mya-98 из штамма «О №2383/Приморский/2019» культуральную инактивированную эмульсионную получают путем смешивания очищенного антигена и масляного адъюванта Montanide ISA-71 R VG в соотношении 30% на 70% по массе, соответственно. Полученная вакцина представляет собой стабильную эмульсию белого или бледно-розового цвета, содержащую инактивированный 146S компонент вируса ящура, который обеспечивают формирование специфического иммунитета.The cultural inactivated emulsion vaccine against foot and mouth disease genotype O/SEA/Mya-98 from the strain “O No. 2383/Primorsky/2019” is prepared by mixing the purified antigen and the oil adjuvant Montanide ISA-71 R VG in a ratio of 30% to 70% by weight, respectively . The resulting vaccine is a stable white or pale pink emulsion containing an inactivated 146S component of the foot and mouth disease virus, which ensures the formation of specific immunity.
Предлагаемое изобретение включает следующую совокупность существенных признаков, обеспечивающих получение технического результата во всех случаях, на которые спрашивается правовая охрана:The proposed invention includes the following set of essential features that ensure obtaining a technical result in all cases for which legal protection is sought:
1. Вакцина против ящура генотипа O/SEA/Mya-98 из штамма «О №2383/Приморский/2019» культуральная инактивированная эмульсионная.1. Vaccine against foot and mouth disease genotype O/SEA/Mya-98 from the strain “O No. 2383/Primorsky/2019”, cultural inactivated emulsion.
2. Активное вещество в виде авирулентного и очищенного антигенного материала из гомологичного возбудителю заболевания штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура в эффективном количестве.2. The active substance in the form of avirulent and purified antigenic material from the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” of genotype O/SEA/Mya-98 homologous to the causative agent of the disease in an effective amount.
3. Целевые добавки.3. Targeted supplements.
Существенные отличительные признаки предлагаемой вакцины заключаются в том, что в качестве активного вещества она содержит авирулентный очищенный антиген штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура в эффективном количестве.The significant distinctive features of the proposed vaccine are that as an active substance it contains an avirulent purified antigen of the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 of the foot-and-mouth disease virus in an effective amount.
Предлагаемое изобретение характеризуется также другими отличительными признаками, выражающими конкретные формы выполнения или особые условия его использования:The present invention is also characterized by other distinctive features that express specific forms of implementation or special conditions for its use:
1. Авирулентный и очищенный антиген штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура, полученный предпочтительно в суспензионной перевиваемой клеточной линии BHK-21/SUSP/ARRIAH и представляющий собой суспензию, содержащую преимущественно 146S иммуногенный компонент вируса ящура в эффективном количестве.1. Avirulent and purified antigen of the strain “O No. 2383/Primorsky/2019” of the genotype O/SEA/Mya-98 of the foot-and-mouth disease virus, obtained preferably in the suspension continuous cell line BHK-21/SUSP/ARRIAH and representing a suspension containing predominantly 146S immunogenic component of the foot and mouth disease virus in an effective amount.
2. Авирулентный и очищенный антиген штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура, полученный предпочтительно в суспензионной перевиваемой культуре клеток BHK-21/SUSP/ARRIAH и представляющий собой суспензию, содержащую преимущественно 146S иммуногенный компонент вируса ящура в количестве не менее 4,0 мкг в 1,0 см3 готового вакцинного препарата.2. Avirulent and purified antigen of the strain “O No. 2383/Primorsky/2019” of the genotype O/SEA/Mya-98 of the foot-and-mouth disease virus, obtained preferably in a suspension continuous cell culture BHK-21/SUSP/ARRIAH and representing a suspension containing predominantly 146S immunogenic component of the foot and mouth disease virus in an amount of at least 4.0 μg per 1.0 cm 3 of the finished vaccine preparation.
3. Из целевых добавок вакцина содержит масляный адъювант Montanide ISA-71 R VG.3. Among the targeted additives, the vaccine contains the oil adjuvant Montanide ISA-71 R VG.
4. Вакцина содержит масляный адъювант Montanide ISA-71 R VG в количестве 70% (по массе) в 1,0 см3 готового препарата.4. The vaccine contains the oil adjuvant Montanide ISA-71 R VG in an amount of 70% (by weight) per 1.0 cm 3 of the finished product.
5. Авирулентный и очищенный антиген штамма «О №23 83/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура, полученного предпочтительно в перевиваемой суспензионной клеточной линии BHK-21/SUSP/ARRIAH, масляный адъювант Montanide ISA-71 R VG, добавка в готовом препарате в виде поддерживающей среды в следующих количествах:5. Avirulent and purified antigen of the strain “O No. 23 83/Primorsky/2019” of the genotype O/SEA/Mya-98 of the foot-and-mouth disease virus, obtained preferably in the continuous suspension cell line BHK-21/SUSP/ARRIAH, oil adjuvant Montanide ISA-71 R VG, additive in the finished product in the form of a supporting medium in the following quantities:
Предлагаемая вакцина против ящура из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 культуральная инактивированная эмульсионная обладает высокой иммуногенной активностью и обеспечивает надежную защиту против изолятов вируса ящура генотипа O/SEA/Mya-98.The proposed cultural inactivated emulsion vaccine against foot-and-mouth disease from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 has high immunogenic activity and provides reliable protection against isolates of the foot-and-mouth disease virus genotype O/SEA/Mya-98.
Достижение технического результата от использования изобретения обеспечивается тем, что в состав предлагаемой противоящурной эмульсионной вакцины в качестве активного вещества введен антиген штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура, обладающий высокой иммуногенной активностью, создающий эффективную защиту восприимчивых животных против изолятов вируса ящура представленного генотипа, которые в последние годы вызывают вспышки в мире.Achieving a technical result from the use of the invention is ensured by the fact that the antigen of the strain “O No. 2383/Primorsky/2019” of the genotype O/SEA/Mya-98 of the foot-and-mouth disease virus, which has high immunogenic activity, creating an effective protection of susceptible animals against foot-and-mouth disease virus isolates of the presented genotype, which in recent years have caused outbreaks in the world.
Сущность изобретения отражена на графическом изображении:The essence of the invention is reflected in the graphic image:
Фиг. 1. - Дендрограмма, отражающая филогенетическое взаимоотношение штамма «О №2383/Приморский/2019» вируса ящура с эпизоотическими штаммами серологического типа О. Дендрограмма основана на сравнении полных нуклеотидных последовательностей гена VP1.Fig. 1. - Dendrogram reflecting the phylogenetic relationship of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” with epizootic strains of serological type O. The dendrogram is based on a comparison of the complete nucleotide sequences of the VP 1 gene.
Сущность изобретения пояснена следующими перечнями последовательностей:The essence of the invention is illustrated by the following sequence lists:
SEQ ID NO: 1 представляет последовательность нуклеотидов гена, кодирующего белок VP1 штамма «О №2383/Приморский/2019» вируса ящура генотипа O/SEA/Mya-98;SEQ ID NO: 1 represents the nucleotide sequence of the gene encoding the VP 1 protein of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus genotype O/SEA/Mya-98;
SEQ ID NO: 2 представляет последовательность аминокислот белка VP1 штамма «О №2383/Приморский/2019» вируса ящура генотипа O/SEA/Mya-98.SEQ ID NO: 2 represents the amino acid sequence of the VP 1 protein of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus genotype O/SEA/Mya-98.
Штамм «О №2383/Приморский/2019» вируса ящура характеризуется следующими признаками и свойствами.Strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus is characterized by the following characteristics and properties.
Морфологические признакиMorphological characteristics
Штамм «О №2383/Приморский/2019» вируса ящура серотипа О относится к отряду Picornavirales, семейству Picornaviridae, роду Aphthovirus, виду Foot-and-Mouth Disease virus и обладает морфологическими признаками, характерными для возбудителя ящура: форма вириона иксаэдрическая, размер 25 нм. Вирион состоит из молекулы одноцепочечной положительно заряженной молекулы РНК и 60 копий полипептида, каждый из которых представлен протеинами VP4, VP2, VP3, VP1.Strain “O No. 2383/Primorsky/2019” of foot-and-mouth disease virus serotype O belongs to the order Picornavirales, family Picornaviridae, genus Aphthovirus, species Foot-and-Mouth Disease virus and has morphological features characteristic of the causative agent of foot-and-mouth disease: the shape of the virion is ixahedral, size 25 nm . The virion consists of a single-stranded positively charged RNA molecule and 60 copies of a polypeptide, each of which is represented by the proteins VP 4 , VP 2 , VP 3 , VP 1 .
Антигенные свойстваAntigenic properties
По антигенным свойствам штамм «О №2383/Приморский/2019» вируса ящура относится к серотипу О. Вирус стабильно нейтрализуется гомологичной антисывороткой. У переболевших животных в сыворотке крови образуются типоспецифические антитела, выявляемые в иммуноферментном анализе и реакции микронейтрализации (РМН).According to its antigenic properties, the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus belongs to serotype O. The virus is stably neutralized by a homologous antiserum. In recovered animals, type-specific antibodies are formed in the blood serum, which are detected in an enzyme-linked immunosorbent assay and microneutralization reaction (RMN).
Методом нуклеотидного секвенирования была определена первичная структура 1D-гена белка VP1 штамма «О №2383/Приморский/2019» вируса ящура. Сравнительный анализ нуклеотидных последовательностей показал, что штамм «О №2383/Приморский/2019» вируса ящура принадлежит к генотипу O/SEA/Mya-98 (Фиг. 1).Using the method of nucleotide sequencing, the primary structure of the 1D gene of the VP 1 protein of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus was determined. Comparative analysis of nucleotide sequences showed that the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus belongs to the genotype O/SEA/Mya-98 (Fig. 1).
Антигенное родство (r1) штамма «О №2383/Приморский/2019» вируса ящура изучено в РМН, в перекрестном исследовании штамма со специфическими сыворотками, полученными на следующие производственные штаммы вируса ящура:The antigenic affinity (r 1 ) of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus was studied at the Russian Medical Research Institute, in a cross-study of the strain with specific sera obtained for the following production strains of the foot-and-mouth disease virus:
- штамм «О/Тайвань/1997» (генотип O/CATHAY/CAM 94),- strain “O/Taiwan/1997” (genotype O/CATHAY/CAM 94),
- штамм «О №2212/Приморский/2014» (генотип O/SEA/Mya-98),- strain “O No. 2212/Primorsky/2014” (genotype O/SEA/Mya-98),
- штамм «О/Приморский/2012» (генотип O/ME-SA/PanAsia),- strain “O/Primorsky/2012” (genotype O/ME-SA/PanAsia),
- штамм «О/Саудовская Аравия/2008» (генотип O/ME-SA/PanAsia2),- strain “O/Saudi Arabia/2008” (genotype O/ME-SA/PanAsia2),
- штамм «О/Забайкальский/2016» (генотип O/ME-SA/Ind-2001d).- strain “O/Zabaikalsky/2016” (genotype O/ME-SA/Ind-2001d).
Титр референтных сывороток крови КРС, полученных путем иммунизации животных моновалентными вакцинами из производственных штаммов вируса ящура серотипа О, против 102 ТЦД50 гомологичного и гетерологичного вируса определяли в РМН при перекрестном титровании, рассчитывая значения с использованием уравнения линейной регрессии, и выражали в lg. Значение r1 определяли, как антилогарифм разности lg титров сыворотки против гетерологичного и гомологичного вируса [19, 20].The titer of reference cattle blood sera obtained by immunizing animals with monovalent vaccines from production strains of foot-and-mouth disease virus serotype O against 10 2 TCD 50 of homologous and heterologous virus was determined in the RMN during cross-titration, calculating the values using a linear regression equation, and expressed in lg. The r 1 value was determined as the antilogarithm of the difference in serum lg titers against heterologous and homologous viruses [19, 20].
Значение r1 в РМН интерпретировали следующим образом:The value of r 1 in the RMN was interpreted as follows:
при ≥0,3 - исследуемый и производственный штаммы вируса ящура являются родственными;at ≥0.3 - the studied and production strains of foot-and-mouth disease virus are related;
при <0,3 - исследуемый образец штамма вируса ящура значительно отличается от производственного штамма.at <0.3 - the studied sample of the foot-and-mouth disease virus strain differs significantly from the production strain.
Максимальное родство отмечается при значении r1 в РМН, стремящимся к 1,0.Maximum relatedness is observed when the value of r 1 in the RMN tends to 1.0.
Показатели антигенного родства при изучении штамма «О №2383/Приморский/2019» составили r1 от 0,07 до 0,31, что свидетельствует об отсутствии явного антигенного родства с производственными штаммами вируса ящура серотипа О. Полученные следующие данные r1 для штаммов:Indicators of antigenic relatedness when studying the strain “O No. 2383/Primorsky/2019” amounted to r 1 from 0.07 to 0.31, which indicates the absence of obvious antigenic relatedness with production strains of foot-and-mouth disease virus serotype O. The following r 1 data were obtained for the strains:
По данным антигенного родства штамм «О №2212/Приморский/2014»According to antigenic relatedness data, strain “O No. 2212/Primorsky/2014”
(генотип O/SEA/Mya-98) являются родственным штамму «О №2383/Приморский/2019», значение r1 составляет 0,31. Хотя они относятся к одному генотипу O/SEA/Mya-98, при филогенетическом анализе (фиг. 1) штамм «О №2383/Приморский/2019» схож по нуклеотидным последовательностям со штаммом «О №2212/Приморский/2014» только на 67%, иными словами, степень различия между ними составила 33%. Данный факт обуславливает необходимость создания вакцины из штамма «О №2383/Приморский/2019», который в отличии от первоначального варианта распространен в настоящее время в мире.(genotype O/SEA/Mya-98) are related to the strain “O No. 2383/Primorsky/2019”, the r 1 value is 0.31. Although they belong to the same genotype O/SEA/Mya-98, during phylogenetic analysis (Fig. 1) the strain “O No. 2383/Primorsky/2019” is similar in nucleotide sequences to the strain “O No. 2212/Primorsky/2014” by only 67 %, in other words, the degree of difference between them was 33%. This fact necessitates the creation of a vaccine from the “O No. 2383/Primorsky/2019” strain, which, unlike the original version, is currently widespread in the world.
Гено- и хемотаксономическая характеристикиGeno- and chemotaxonomic characteristics
Штамм «О №2383/Приморский/2019» вируса ящура является РНК(+) -содержащим вирусом с молекулярной массой 8,08×106 Д. Нуклеиновая кислота представлена одноцепочной линейной молекулой молекулярной массой 2,8×106 Д. Вирион имеет белковую оболочку, состоящую из четырех основных белков VP1, VP2, VP3 и VP4. Липопротеидная оболочка отсутствует.Strain “O No. 2383/Primorsky/2019” of foot-and-mouth disease virus is an RNA(+)-containing virus with a molecular weight of 8.08×10 6 D. Nucleic acid is represented by a single-chain linear molecule with a molecular weight of 2.8×10 6 D. The virion has a protein shell, consisting of four main proteins VP 1 , VP 2 , VP 3 and VP 4 . The lipoprotein membrane is absent.
Основным антигенным белком является VP1. В вирионе содержится приблизительно 31,5% РНК и 68,5% белка. Вирусная РНК является инфекционной и участвует в образовании белков-предшественников в инфицированных клетках. Предшественники, в свою очередь, расщепляются с образованием более стабильных структурных и неструктурных полипептидов вируса. Из 8 неструктурных полипептидов, накапливающихся в инфицированных клетках, выделяют РНК-зависимую РНК-полимеразу (3D-ген), участвующую в репликации РНК для сборки вирионов.The main antigenic protein is VP 1 . The virion contains approximately 31.5% RNA and 68.5% protein. Viral RNA is infectious and is involved in the formation of precursor proteins in infected cells. The precursors, in turn, are cleaved to form more stable structural and nonstructural polypeptides of the virus. From 8 non-structural polypeptides that accumulate in infected cells, an RNA-dependent RNA polymerase (3D gene) is isolated, which is involved in RNA replication for the assembly of virions.
Физические свойстваPhysical properties
Масса вириона составляет 8,4×10-18 г. Плавучая плотность в градиенте плотности сахарозы составляет 1,44 г/см3.The mass of the virion is 8.4×10 -18 g. The buoyant density in the sucrose density gradient is 1.44 g/cm 3 .
Устойчивость к внешним факторамResistance to external factors
Штамм «О №2383/Приморский/2019» вируса ящура устойчив к эфиру, хлороформу, и ацетону. Наиболее стабилен при рН 7,45-7,65. Сдвиги рН в кислую и сильно щелочную сторону ведут к инактивации вируса. Чувствителен к формальдегиду, УФ-облучению, γ-облучению, высоким температурам (выше 37,9°С).Strain “O No. 2383/Primorsky/2019” of foot-and-mouth disease virus is resistant to ether, chloroform, and acetone. Most stable at pH 7.45-7.65. Shifts in pH to the acidic and strongly alkaline side lead to inactivation of the virus. Sensitive to formaldehyde, UV irradiation, γ-irradiation, high temperatures (above 37.9°C).
Дополнительные признаки и свойстваAdditional characteristics and properties
Реактогенность - реактогенными свойствами не обладает.Reactogenicity - does not have reactogenic properties.
Патогенность - патогенен для парнокопытных животных.Pathogenicity - pathogenic for artiodactyl animals.
Вирулентность - вирулентен для естественно-восприимчивых животных при контактном, аэрозольном и парентеральном заражении.Virulence - virulent for naturally susceptible animals during contact, aerosol and parenteral infection.
Стабильность - сохраняет исходные биологические свойства при пассировании в чувствительных биологических системах в течение 5 пассажей (срок наблюдения) на перевиваемых культурах.Stability - retains the original biological properties when passaging in sensitive biological systems for 5 passages (observation period) on continuous crops.
Биотехнологические характеристикиBiotechnological characteristics
Штамм «О №2383/Приморский/2019» вируса ящура репродуцируется в перевиваемых культурах клеток: почки сибирского горного козерога (ПСГК-30), почки свиньи (IB-RS-2), почки сирийского хомячка (BHK-21).The foot and mouth disease virus strain “O No. 2383/Primorsky/2019” is reproduced in continuous cell cultures: Siberian mountain ibex kidneys (PSGK-30), pig kidneys (IB-RS-2), Syrian hamster kidneys (BHK-21).
При испытании было проведено 5 последовательных пассажей штамма «О №2383/Приморский/2019» вируса ящура в перевиваемых культурах клеток ПСГК-30, BHK-21, IB-RS-2. Биологические свойства характеризовали путем определения инфекционной активности вируса каждого пассажа в перевиваемой клеточной линии IB-RS-2 и на естественно восприимчивых животных - крупном рогатом скоте (КРС) и свиньях.During the test, 5 consecutive passages of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus were carried out in continuous cell cultures PSGK-30, BHK-21, IB-RS-2. Biological properties were characterized by determining the infectious activity of the virus of each passage in the continuous cell line IB-RS-2 and in naturally susceptible animals - cattle (cattle) and pigs.
Для снижения эпизоотической опасности возникновения ящура, вызванного генотипом O/SEA/Mya-98, и предотвращения возникновения новых очагов болезни важна своевременная вакцинопрофилактика, что требует разработки новой безопасной и эффективной вакцины.To reduce the epizootic risk of foot and mouth disease caused by the O/SEA/Mya-98 genotype and prevent the emergence of new foci of the disease, timely vaccine prevention is important, which requires the development of a new safe and effective vaccine.
Получена безопасная и эффективная вакцина против ящура генотипа O/SEA/Mya-98 из штамма «О №2383/Приморский/2019» культуральная инактивированная эмульсионная.A safe and effective vaccine against foot and mouth disease of the O/SEA/Mya-98 genotype from the strain “O No. 2383/Primorsky/2019”, culture inactivated emulsion, has been obtained.
Сущность предлагаемого изобретения пояснена примерами его использования, которые не ограничивают объем изобретения.The essence of the proposed invention is illustrated by examples of its use, which do not limit the scope of the invention.
Пример 1. Генетическая характеристика штамма «О №2383/Приморский/2019» вируса ящура по данным ПЦР и нуклеотидного секвенирования.Example 1. Genetic characteristics of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” according to PCR and nucleotide sequencing data.
Проводили анализ первичной структуры гена 1D (белок VP1) (639 н.о.) штамма «О №2383/Приморский/2019» вируса ящура методом нуклеотидного секвенирования методом Сенгера и определении положения данного штамма на филогенетическом древе вируса ящура серотипа О. Метод основан на определении первичной структуры гена 1D (белок VP1) испытуемого изолята / штамма с последующим анализом филогенетического родства с другими изолятами (19 представителей) вируса ящура серотипа О.The primary structure of the 1D gene (VP 1 protein) (639 nt) of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” was analyzed using the Sanger nucleotide sequencing method and the position of this strain was determined on the phylogenetic tree of the foot-and-mouth disease virus serotype O. The method is based on determining the primary structure of the 1D gene (VP 1 protein) of the test isolate/strain, followed by analysis of the phylogenetic relationship with other isolates (19 representatives) of foot-and-mouth disease virus serotype O.
Было необходимо провести сравнительный анализ нуклеотидных последовательностей гена 1D, кодирующего белок VP1 вируса ящура вакцинного штамма «О №2383/Приморский/2019» с другими изолятами и штаммами. Последовательность нуклеотидов гена белка VP1 штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура представлена SEQ ID NO: 1. Последовательность аминокислот 1D-гена, кодирующего белок VP1 штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура отражена на SEQ ID NO: 2.It was necessary to conduct a comparative analysis of the nucleotide sequences of the 1D gene encoding the VP 1 protein of the foot-and-mouth disease virus vaccine strain “O No. 2383/Primorsky/2019” with other isolates and strains. The nucleotide sequence of the VP 1 protein gene of the strain “O No. 2383/Primorsky/2019” of the genotype O/SEA/Mya-98 of the foot-and-mouth disease virus is presented by SEQ ID NO: 1. The amino acid sequence of the 1D gene encoding the VP 1 protein of the strain “O No. 2383/Primorsky” /2019" genotype O/SEA/Mya-98 foot and mouth disease virus is reflected in SEQ ID NO: 2.
Осуществлен филогенетический анализ для штамма «О №2383/Приморский/2019». Филогенетическое дерево выведено с использованием программы MEGA6 и алгоритма Neighbor-Joining. Процент повторяющихся ветвей, в которых связанные таксоны сгруппированы вместе в тесте начальной загрузки (увеличили со стандартных 100 до 400 повторов для высокой степени достоверности), показан рядом с ветвями [20, 21]. Эволюционные расстояния были рассчитаны с использованием метода Maximum Composite Likelihood [22] и выражены в единицах количества замен оснований на сайт. Этот анализ включал 19 нуклеотидных последовательностей, в том числе последовательность 1D-гена штамма «О №2383/Приморский/2019» вируса ящура. Все позиции, содержащие пробелы и отсутствующие данные, были удалены (вариант полного удаления). В окончательном наборе данных было всего 639 позиций. Эволюционный анализ проводился в MEGA 6 [23, 24].A phylogenetic analysis was carried out for the strain “O No. 2383/Primorsky/2019”. The phylogenetic tree was inferred using the MEGA6 program and the Neighbor-Joining algorithm. The percentage of replicate branches in which related taxa cluster together in the bootstrap test (increased from the standard 100 to 400 replicates for high confidence) is shown next to the branches [20, 21]. Evolutionary distances were calculated using the Maximum Composite Likelihood method [22] and expressed in units of the number of base substitutions per site. This analysis included 19 nucleotide sequences, including the sequence of the 1D gene of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus. All items containing spaces and missing data were removed (complete deletion option). There were a total of 639 items in the final data set. Evolutionary analysis was carried out in MEGA 6 [23, 24].
В результате проведенной работы по сравнению полных нуклеотидных последовательностей гена 1D (белок VP1) штамма «О №2383/Приморский/2019» и других изолятов / штаммов вируса ящура серотипа О определено положение исследуемого штамма на филогенетическом древе (фиг. 1).As a result of the work carried out by comparing the complete nucleotide sequences of the 1D gene (VP 1 protein) of the strain “O No. 2383/Primorsky/2019” and other isolates/strains of foot-and-mouth disease virus serotype O, the position of the studied strain on the phylogenetic tree was determined (Fig. 1).
Таким образом, исследуемый штамм «О №2383/Приморский/2019» относится к генотипу O/SEA/Mya-98, что подтверждают данные нуклеотидного и аминокислотного анализа.Thus, the studied strain “O No. 2383/Primorsky/2019” belongs to the genotype O/SEA/Mya-98, which is confirmed by nucleotide and amino acid analysis data.
Пример 2. Адаптация штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 к перевиваемой монослойной культуре клеток почки сибирского горного козерога ПСГК-30.Example 2. Adaptation of the strain “O No. 2383/Primorsky/2019” of genotype O/SEA/Mya-98 to a continuous monolayer cell culture of the kidney cells of the Siberian mountain ibex PSGK-30.
Для заражения перевиваемой монослойной культуры клеток почки сибирского горного козерога ПСГК-30 использовали 10%-ную афтозную суспензию вируса ящура, полученную из афт свиньи (2 пассаж). Посевная концентрация клеток составляла 0,20-0,25 млн кл./см3, доза заражения вирусом - 0,001 ТЦД50/кл. По результатам исследования репродукция вируса ящура штамма «О №2383/Приморский/2019» проходила при специфическом разрушении монослоя на 90-100% за 18-20 ч. В течение 6 последовательных пассажей отмечали рост значений титра инфекционной активности вируса от 6,00±0,10 до 7,50±0,10 lg ТЦД50/см3.To infect a continuous monolayer cell culture of Siberian mountain ibex kidney cells PSGK-30, a 10% aphthous suspension of foot-and-mouth disease virus obtained from pig aphthae (passage 2) was used. The inoculating cell concentration was 0.20-0.25 million cells/cm 3 , the virus infection dose was 0.001 TCD 50 /cell. According to the results of the study, the reproduction of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” took place with a specific destruction of the monolayer by 90-100% in 18-20 hours. Over the course of 6 consecutive passages, an increase in the titer of infectious activity of the virus from 6.00 ± 0 was noted ,10 to 7.50±0.10 lg TCD 50 /cm 3 .
Максимальное значение титра инфекционной активности вируса было достигнуто на этапе 6 пассажа (7,50±0,10 lg ТЦД50/см3). Концентрация 146S частиц с 1 по 6 пассажи изменялась с 0,41±0,02 до 1,02±0,02 мкг/см3. При этом наибольшее количество 146S компонента отмечали на этапе 6 пассажа (1,02±0,02 мкг/см3). Степень достоверности (R2) результатов исследования в количественном варианте ОТ-ПЦР-РВ колебалась от 96,58 до 99,79%. Таким образом, на протяжении 6-ти последовательных пассажей была успешно проведена адаптация штамма «О №2383/Приморский/2019» вируса ящура к перевиваемой монослойной клеточной линии ПСГК-30.The maximum titer of infectious activity of the virus was achieved at stage 6 of passage (7.50±0.10 lg TCD 50 /cm 3 ). The concentration of 146S particles from passages 1 to 6 changed from 0.41±0.02 to 1.02±0.02 μg/ cm3 . In this case, the largest amount of the 146S component was noted at the stage of passage 6 (1.02±0.02 μg/cm 3 ). The degree of reliability (R 2 ) of the study results in the quantitative version of RT-PCR-RT ranged from 96.58 to 99.79%. Thus, over the course of 6 consecutive passages, the adaptation of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” to the continuous monolayer cell line PSGK-30 was successfully carried out.
Пример 3. Изучение условий монослойного культивирования вируса ящура штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 в промышленных масштабах.Example 3. Study of the conditions for monolayer cultivation of foot and mouth disease virus strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 on an industrial scale.
В процессе промышленного культивирования штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура в перевиваемой монослойной культуре клеток ПСГК-30 осуществляли подбор оптимальных условий культивирования вируса по поддерживающей среде, температурному фактору и дозе заражения исследуемым вирусом клеток.In the process of industrial cultivation of the strain “O No. 2383/Primorsky/2019” of the genotype O/SEA/Mya-98 of the foot-and-mouth disease virus in a continuous monolayer cell culture PSGK-30, the optimal conditions for cultivating the virus were selected according to the supporting medium, temperature factor and dose of infection of cells with the studied virus .
На первом этапе исследования оценивали влияние состава поддерживающей среды на репродукцию штамма «О №2383/Приморский/2019» вируса ящура в монослойной культуре клеток ПСГК-30 в масштабах производства (на этапе с 5-го на 6-ой пассажи). Для сравнения применяли три среды с добавлением 2,0% фетальной сыворотки крови телят: 1) среда Игла DMEM; 2) среда RPMI-1640; 3) раствор Хэнкса. Посевная концентрация клеток составляла 0,20 млн кл./см3, доза заражения вирусом - 0,1000-0,0001 ТЦД50/кл. Культивирование вируса осуществляли при температурах 35±0,2 - 38±0,2°С до разрушения клеточного монослоя не менее 85%. Результаты репродукции штамма «О №2383/Приморский/2019» вируса ящура с поддерживающими средами разного состава отражены в таблице 1.At the first stage of the study, the effect of the composition of the supporting medium on the reproduction of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” in a monolayer culture of PSGK-30 cells was assessed on a production scale (at the stage from the 5th to the 6th passages). For comparison, three media were used with the addition of 2.0% fetal calf serum: 1) Eagle's medium DMEM; 2) RPMI-1640 environment; 3) Hanks solution. The inoculating cell concentration was 0.20 million cells/cm 3 , the dose of virus infection was 0.1000-0.0001 TCD 50 /cell. Cultivation of the virus was carried out at temperatures of 35±0.2 - 38±0.2°C until the cell monolayer was destroyed by at least 85%. The results of the reproduction of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” with supporting media of different compositions are shown in Table 1.
Из данных таблицы видно, что при репродукции штамма «О №2383/Приморский/2019» вируса ящура в монослойной культуре клеток ПСГК-30 с применением поддерживающих сред разного состава, оптимальной является среда Хэнкса, позволяющая за 18-20 ч достичь специфического разрушения клеточного монослоя на 95-100% с накоплением в полученной суспензии 146S компонента в количестве 1,02±0,02 мкг/см3 и титром инфекционной активности 7,50±0,10 lg ТЦД50/см3. При использовании среды RPMI-1640 и Игла DMEM показатели репродукции вируса были ниже.The table data shows that when reproducing the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus in a monolayer culture of PSGK-30 cells using supporting media of different compositions, Hanks’ medium is optimal, allowing for specific destruction of the cell monolayer in 18-20 hours by 95-100% with accumulation of the 146S component in the resulting suspension in an amount of 1.02±0.02 μg/cm 3 and an infectious activity titer of 7.50±0.10 lg TCD 50 /cm 3 . Viral reproduction rates were lower when using RPMI-1640 and Eagle DMEM media.
На следующем этапе изучения условий монослойного культивирования штамма «О №2383/Приморский/2019» вируса ящура в культуре клеток ПСГК-30 в условиях производства оценивали влияние на процесс репродукции вируса температурного фактора. Для этого культивирование вируса проводили в среде Игла DMEM с 2% сыворотки КРС при следующих температурах: 35,0±0,2; 36,0±0,2; 37,0±0,2; 38,0±0,2°С. Доза заражения культуры клеток вирусом ящура составляла 0,010-0,001 ТЦД50/КЛ. Культивирование вируса осуществляли до разрушения клеточного монослоя на 85-100% в течение 18-28 ч (табл. 1). По итогам исследования выявили, что для полной репродукции штамма «О №2383/Приморский/2019» вируса ящура в монослойной культуре клеток ПСГК-30 оптимальной является температура среды 37,0±0,02°С, при которой за 18-20 ч развитие ЦПД достигало 95-100% с накоплением 146S частиц, равным 1,02±0,02 мкг/см3 и титром инфекционной активности вируса 7,50±0,10 lg ТЦД50/см3.At the next stage of studying the conditions for monolayer cultivation of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus in the PSGK-30 cell culture under production conditions, the influence of the temperature factor on the virus reproduction process was assessed. To do this, the virus was cultivated in Eagle's medium DMEM with 2% bovine serum at the following temperatures: 35.0±0.2; 36.0±0.2; 37.0±0.2; 38.0±0.2°C. The dose of infection of the cell culture with the foot-and-mouth disease virus was 0.010-0.001 TCD50/CL. The virus was cultivated until the cell monolayer was destroyed by 85-100% within 18-28 hours (Table 1). Based on the results of the study, it was revealed that for complete reproduction of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus in a monolayer cell culture PSGK-30, the optimal temperature is 37.0 ± 0.02 ° C, at which the development of The CPE reached 95-100% with the accumulation of 146S particles equal to 1.02±0.02 μg/cm 3 and the titer of infectious activity of the virus 7.50±0.10 lg TCD 50 /cm 3 .
Оценивали влияние дозы заражения монослоя клеток линии ПСГК-30 штаммом «О №2383/Приморский/2019» при культивировании в масштабах производства. Для этого использовали разные дозы вируса: 0,10-0,01; 0,010-0,001; 0,0010-0,0001 ТЦД50/кл. В качестве поддерживающей среды применяли среду Игла MEM с 2% сыворотки крови КРС. Репродукцию вируса проводили при температуре 37,0±0,2°С в течение 18-32 ч до специфического разрушения клеток на 85-100%). По итогам культивирования определяли концентрацию 146S компонента и титр инфекционной активности вируса ящура. Как следует из данных таблицы 1, наибольшее накопление 146S компонента вируса достигалось при дозе заражения 0,01-0,001 ТЦД50/кл. и составило 1,02±0,02 мкг/см3 с титром инфекционной активности вируса 7,50±0,10 lg ТЦД50/см3.We assessed the effect of the dose of infection of a monolayer of cells of the PSGK-30 line with the strain “O No. 2383/Primorsky/2019” during cultivation on a production scale. For this, different doses of the virus were used: 0.10-0.01; 0.010-0.001; 0.0010-0.0001 TCD 50 /cl. Eagle's MEM medium with 2% cattle blood serum was used as a supporting medium. Virus reproduction was carried out at a temperature of 37.0±0.2°C for 18-32 hours until specific cell destruction was 85-100%). Based on the results of cultivation, the concentration of the 146S component and the titer of infectious activity of the foot-and-mouth disease virus were determined. As follows from the data in Table 1, the greatest accumulation of the 146S component of the virus was achieved at an infection dose of 0.01-0.001 TCD 50 /cell. and amounted to 1.02±0.02 μg/cm 3 with a titer of infectious activity of the virus of 7.50±0.10 lg TCD 50 /cm 3 .
Таким образом, проведено изучение условий монослойного культивирования штамма «О №2383/Приморский/2019» вируса ящура в культуре клеток ПСГК-30 в промышленных масштабах. В результате исследования определены следующие оптимальные параметры репродукции штамма «О №2383/Приморский/2019» вируса ящура в монослойной клеточной линии ПСГК-30: 1) поддерживающая среда - среда Хэнкса; 2) температурный режим культивирования - 37,0±0,02°С; 3) доза заражения вирусом - 0,01-0,001 ТЦД50/кл.Thus, the conditions for monolayer cultivation of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” in PSGK-30 cell culture on an industrial scale were studied. As a result of the study, the following optimal parameters for the reproduction of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus in the monolayer cell line PSGK-30 were determined: 1) maintenance medium - Hanks’ medium; 2) cultivation temperature - 37.0±0.02°C; 3) dose of virus infection - 0.01-0.001 TCD 50 / cell.
Пример 4. Изучение условий суспензионного культивирования штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура в промышленных масштабах.Example 4. Study of the conditions for suspension cultivation of the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 of the foot-and-mouth disease virus on an industrial scale.
При промышленном культивирования штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура в перевиваемой суспензионной культуре клеток BHK-21/SUSP/ARRIAH проводили поиск оптимальных параметров для успешной репродукции возбудителя ящура, используя разные концентрации клеток, температурные условия и дозу заражения вирусом.During the industrial cultivation of the strain “O No. 2383/Primorsky/2019” of the genotype O/SEA/Mya-98 of the foot-and-mouth disease virus in a continuous suspension cell culture BHK-21/SUSP/ARRIAH, the search for optimal parameters for the successful reproduction of the foot-and-mouth disease pathogen was carried out, using different concentrations of cells, temperature conditions and dose of virus infection.
На первом этапе работы определяли влияние посевной концентрации клеток линии BHK-21/SUSP/ARRIAH в суспензии на репродукцию штамма «О №2383/Приморский/2019» вируса ящура в промышленных масштабах. Для анализа подготовили суспензии со следующими концентрации клеток: 2,5; 3,0; 3,5; 4,0 млн кл./см3. Водородный показатель рН поддерживали в диапазоне 7,45-7,65. Температура культивирования вируса составляла 37,0±0,02°С, доза заражения вирусом - 0,010-0,001 ТЦД50/кл. Репродукцию вируса проводили до специфической гибели клеток на 95-100%, которая осуществлялась в течение 11-23 ч. Результаты суспензионного культивирования штамма «О №2383/Приморский/2019» вируса ящура в суспензии с разными концентрациями клеток представлены в таблице 2.At the first stage of the work, we determined the effect of the seed concentration of cells of the BHK-21/SUSP/ARRIAH line in suspension on the reproduction of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” on an industrial scale. Suspensions with the following cell concentrations were prepared for analysis: 2.5; 3.0; 3.5; 4.0 million cells/ cm3 . The pH value was maintained in the range of 7.45-7.65. The virus cultivation temperature was 37.0±0.02°C, the dose of virus infection was 0.010-0.001 TCD 50 /cell. Virus reproduction was carried out until specific cell death was 95-100%, which was carried out within 11-23 hours. The results of suspension cultivation of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” in suspension with different cell concentrations are presented in Table 2.
Как следует из таблицы 2, при культивировании вируса ящура штамма «О №2383/Приморский/2019» в суспензионной клеточной линии BHK-21/SUSP/ARRIAH с разными концентрациями клеток, определили, что накопление 146S компонента в суспензии с концентрацией клеток 2,5 млн кл./см3 составило 0,75±0,02 мкг/см3, с концентрацией 3,0 млн кл./см3 -1,10±0,02 мкг/см3, с концентрацией 3,5 млн кл./см3 - 1,59±0,02 мкг/см3, и с концентрацией 4,0 млн кл./см3 - 1,65±0,02 мкг/см3. Как следует из полученных данных для репродукции штамма «О №2383/Приморский/2019» вируса ящура достаточной является концентрация клеток BHK-21/SUSP/ARRIAH в суспензии, равная 3,5 млн кл./см3 (при концентрации 4,0 млн кл./см3 концентрация незначительно выше, но затраты на производство по количеству клеток выше, исходя из этого, экономически целесообразно использовать концентрацию клеток, равную 3,5 млн кл./см3). Значение титра инфекционной активности вируса при этом составило 9,25±0,10 lg ТЦД50/см3.As follows from Table 2, when cultivating the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” in the suspension cell line BHK-21/SUSP/ARRIAH with different cell concentrations, it was determined that the accumulation of the 146S component in the suspension with a cell concentration of 2.5 million cells/cm 3 was 0.75±0.02 μg/cm 3 , with a concentration of 3.0 million cells/cm 3 -1.10±0.02 μg/cm 3 , with a concentration of 3.5 million cells ./cm 3 - 1.59±0.02 μg/cm 3 , and with a concentration of 4.0 million cells/cm 3 - 1.65±0.02 μg/cm 3 . As follows from the data obtained, for the reproduction of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus, the concentration of BHK-21/SUSP/ARRIAH cells in suspension is equal to 3.5 million cells/cm 3 (at a concentration of 4.0 million cells/ cm3 , the concentration is slightly higher, but the production costs for the number of cells are higher; based on this, it is economically feasible to use a cell concentration equal to 3.5 million cells/ cm3 ). The titer of infectious activity of the virus was 9.25±0.10 lg TCD 50 /cm 3 .
На следующем этапе работы исследовали влияние температурного фактора на репродукцию штамма «О №2383/Приморский/2019» вируса ящура в суспензионной культуре клеток линии BHK-21/SUSP/ARRIAH в промышленных масштабах. Для этого репродукцию вируса проводили при следующих температурных условиях: 35,0±0,2; 36,0±0,2; 37,0±0,2; 38,0±0,2°С. Доза заражения культуры клеток вирусом составляла 0,010-0,001 ТЦД50/кл. Водородный показатель рН вирусной суспензии поддерживали в диапазоне 7,45-7,65. Культивирование вируса проводили до ЦПД, равного не менее 80% (приоритет отдавали полной специфической деструкции клеток), в течение 11-23 ч. По результатам анализа определили, что для полной репродукции штамма «О №2383/Приморский/2019» вируса ящура в суспензионной культуре клеток BHK-21/SUSP/ARRIAH оптимальной является температура среды 37,0±0,02°С, при которой в течение 13-14 ч наблюдается специфическая гибель клеток на 95-100%) с высоким накоплением 146S компонента (1,59±0,02 мкг/см3) и титром инфекционной активности вируса 9,25±0,10 lg ТЦД50/см3.At the next stage of the work, we studied the influence of the temperature factor on the reproduction of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus in a suspension culture of cells of the BHK-21/SUSP/ARRIAH line on an industrial scale. For this purpose, virus reproduction was carried out under the following temperature conditions: 35.0±0.2; 36.0±0.2; 37.0±0.2; 38.0±0.2°C. The dose of infection of the cell culture with the virus was 0.010-0.001 TCD 50 /cell. The pH value of the viral suspension was maintained in the range of 7.45-7.65. Cultivation of the virus was carried out until the CPD was equal to at least 80% (priority was given to complete specific destruction of cells), for 11-23 hours. Based on the results of the analysis, it was determined that for complete reproduction of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus in suspension For the BHK-21/SUSP/ARRIAH cell culture, the optimal temperature is 37.0±0.02°C, at which 95-100% specific cell death is observed within 13-14 hours with a high accumulation of the 146S component (1.59 ±0.02 μg/cm 3 ) and the titer of infectious activity of the virus is 9.25 ± 0.10 lg TCD 50 / cm 3 .
В ходе работы по изучению условий суспензионного культивирования штамма «О №2383/Приморский/2019» вируса ящура в промышленных масштабах с применением культуры клеток BHK-21/SUSP/ARRIAH оценивали влияние дозы заражения клеток. Для этого клеточные суспензии заражали вирусом в разных дозах: 0,10-0,01; 0,01-0,001; 0,001-0,0001 ТЦД50/кл. Репродукцию вируса осуществляли при температуре 37,0±0,2°С в течение 11-22 ч до цитопатического действия, равного не менее 90%». По итогам культивирования определяли концентрацию 146S частиц и титр инфекционной активности вируса ящура. Как видно из данных таблицы 2, наибольшее накопление 146S компонента отмечали при дозе заражения 0,010-0,001 ТЦД50/кл. (1,59±0,02 мкг/см3) с титром инфекционной активности вируса, равным 9,25±0,10 lg ТЦД50/см3.In the course of work to study the conditions for suspension cultivation of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” on an industrial scale using cell culture BHK-21/SUSP/ARRIAH, the effect of the dose of cell infection was assessed. To do this, cell suspensions were infected with the virus in different doses: 0.10-0.01; 0.01-0.001; 0.001-0.0001 TCD 50 /cl. Virus reproduction was carried out at a temperature of 37.0±0.2°C for 11-22 hours until the cytopathic effect was at least 90%.” Based on the results of cultivation, the concentration of 146S particles and the titer of infectious activity of the foot-and-mouth disease virus were determined. As can be seen from the data in Table 2, the greatest accumulation of the 146S component was observed at an infection dose of 0.010-0.001 TCD 50 /cell. (1.59±0.02 μg/cm 3 ) with a titer of infectious activity of the virus equal to 9.25±0.10 lg TCD 50 /cm 3 .
Таким образом, проведено изучение трех параметров суспензионного культивирования штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура в суспензионной клеточной линии BHK-21/SUSP/ARRIAH в промышленных масштабах. Выявлены оптимальные условия репродукции штамма «О №2383/Приморский/2019» в суспензионной культуре клеток BHK-21/SUSP/ARRIAH: 1) концентрация клеток перед заражением - 3,5 млн кл./см3; 2) температурный режим культивирования -37,0±0,02°С; 3) доза заражения вирусом - 0,010-0,001 ТЦД50/кл.Thus, we studied three parameters of suspension cultivation of the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 of foot-and-mouth disease virus in the suspension cell line BHK-21/SUSP/ARRIAH on an industrial scale. The optimal conditions for the reproduction of the strain “O No. 2383/Primorsky/2019” in a suspension culture of BHK-21/SUSP/ARRIAH cells were identified: 1) cell concentration before infection - 3.5 million cells/cm 3 ; 2) cultivation temperature -37.0±0.02°C; 3) dose of virus infection - 0.010-0.001 TCD 50 / cell.
Пример 5. Инактивация суспензии вируса ящура штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98.Example 5. Inactivation of a suspension of foot and mouth disease virus strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98.
По окончании цикла репродукции вируса ящура, не прекращая процесс термостатирования (37,0±0,02°С), в вируссодержащую суспензию добавляли подкисленный раствор аминоэтилэтиленимина (АЭЭИ) с рН, равным 8,2-8,5. Конечная концентрация АЭЭИ в вируссодержащей суспензии должна быть равной 0,034%. Инактивацию инфекционной активности вируса ящура штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 проводили в течение 12 часов при температуре 37,0±0,1°С и рН 7,45-7,65 с периодическим перемешиванием.At the end of the reproduction cycle of the foot-and-mouth disease virus, without stopping the thermostatting process (37.0±0.02°C), an acidified solution of aminoethylethylenimine (AEEI) with a pH of 8.2-8.5 was added to the virus-containing suspension. The final concentration of AEEI in the virus-containing suspension should be equal to 0.034%. Inactivation of the infectious activity of the foot and mouth disease virus strain "O No. 2383/Primorsky/2019" genotype O/SEA/Mya-98 was carried out for 12 hours at a temperature of 37.0±0.1°C and pH 7.45-7.65 with periodic stirring.
Для определения времени полной инактивации после добавления 1,2-АЭЭИ каждый час производили отбор проб. Полученные образцы проверяли на наличие инфекционной активности вируса ящура в первичной культуре клеток почки свиньи СП. Результаты представлены в таблице 3, из данных которой видно, что полная инактивация вируса ящура штамма «О №2383/Приморский/2019», репродуцированного в культиваторах, произошла через 6 часов после внесения 1,2-АЭЭИ.To determine the time of complete inactivation after the addition of 1,2-AEEI, samples were taken every hour. The obtained samples were tested for the presence of infectious activity of the foot-and-mouth disease virus in the primary culture of pig kidney cells SP. The results are presented in Table 3, from which it can be seen that complete inactivation of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” reproduced in cultivators occurred 6 hours after the addition of 1,2-AEEI.
Готовые вирусные инактивированные суспензии исследовали в РСК для оценки содержания в них компонентов вируса. Концентрация 146S компонента составила 1,55±0,02 мкг/см3, a 146S+75S компонента - 2,04±0,02 мкг/см3.The prepared inactivated viral suspensions were examined at the RSC to assess the content of virus components in them. The concentration of the 146S component was 1.55±0.02 μg/cm 3 , and the 146S+75S component was 2.04±0.02 μg/cm 3 .
Пример 6. Подбор условий очистки суспензии вируса ящура штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98.Example 6. Selection of conditions for purification of a suspension of foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98.
Суспензию вируса ящура штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98, полученную при репродукции в суспензионной клеточной линии BHK-21/SUSP/ARRIAH, подвергали инактивации и очистке. Для получения очищенного антигена вируса ящура использовали полигексаметиленгуанидин (ПГМГ) с концентрациями 0,010, 0,014 и 0,018%. До и после процесса очистки антигена вируса ящура штамма «О №2383/Приморский/2019» в количественном варианте РСК определяли концентрацию общего вирусного белка и иммуногенных компонентов. Результаты анализа отражены в таблице 4, из которой следует, что в результате очистки антигена вируса ящура штамма «О №2383/Приморский/2019» с помощью ПГМГ в концентрации 0,010% отмечали снижение концентрации балластного белка на 12%, иммуногенных компонентов - на 2%. При использовании ПГМГ в концентрации 0,014% наблюдали снижение количества балластного белка на 38%, 146S компонента - на 3,2%. Применяя ПГМГ в концентрации 0,018% содержание балластного белка уменьшалось на 45%, а иммуногенных компонентов - на 24%.A suspension of foot and mouth disease virus strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98, obtained during reproduction in the suspension cell line BHK-21/SUSP/ARRIAH, was subjected to inactivation and purification. To obtain purified foot-and-mouth disease virus antigen, polyhexamethylene guanidine (PHMG) was used with concentrations of 0.010, 0.014 and 0.018%. Before and after the process of purifying the antigen of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” in the quantitative version of the RSC, the concentration of the total viral protein and immunogenic components was determined. The results of the analysis are reflected in Table 4, from which it follows that as a result of purification of the antigen of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019” using PHMG at a concentration of 0.010%, a decrease in the concentration of ballast protein by 12% and immunogenic components by 2% was noted . When using PHMG at a concentration of 0.014%, a decrease in the amount of ballast protein by 38% and the 146S component by 3.2% was observed. Using PHMG at a concentration of 0.018%, the content of ballast protein decreased by 45%, and immunogenic components by 24%.
Таким образом, исследуя условия очистки антигена штамма «О №2383/Приморский/2019», пришли к выводу о том, что для получения очищенного продукта оптимально использовать ПГМГ с концентрацией 0,014%.Thus, having studied the conditions for purifying the antigen of the strain “O No. 2383/Primorsky/2019”, we came to the conclusion that to obtain a purified product it is optimal to use PHMG with a concentration of 0.014%.
Пример 7. Подбор условий концентрирования суспензии антигена штамма «О №2383/Приморский/2019» вируса ящура генотипа O/SEA/Mya-98.Example 7. Selection of conditions for concentrating the antigen suspension of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus genotype O/SEA/Mya-98.
Культуральную инактивированною суспензию штамма «О №2383/Приморский/2019», полученную с применением суспензионной клеточной линии BHK-21/SUSP/ARRIAH, подвергали концентрированию в 5 раз по объему. Для увеличения концентрации иммуногенных компонентов антигена вируса ящура использовали следующие приемы: 1) добавление полиэтиленгликоля (ПЭГ-6000) с концентрацией 50% к антигену в соотношении 1:4, с экспозицией 4 ч; 2) добавление полиэтиленгликоля (ПЭГ-6000) с концентрацией 50% к антигену в соотношении 1:4, с экспозицией 12 ч; 3) концентрирование с помощью установки тангенциальной фильтрации Centramate 500S Pall в течение 6 ч при рабочем давлении на фильтр 2,2-2,3 атм.A cultural inactivated suspension of the strain “O No. 2383/Primorsky/2019”, obtained using the suspension cell line BHK-21/SUSP/ARRIAH, was concentrated 5 times by volume. To increase the concentration of immunogenic components of the foot-and-mouth disease virus antigen, the following methods were used: 1) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 4 hours; 2) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 12 hours; 3) concentration using a tangential filtration unit Centramate 500S Pall for 6 hours at an operating pressure on the filter of 2.2-2.3 atm.
До и после процесса концентрирования суспензии антигена вируса ящура штамма «О №2383/Приморский/2019» определяли концентрацию общего вирусного белка и иммуногенных компонентов в количественном варианте РСК. Результаты исследований представлены в таблице 5, из которой видно, что при концентрировании антигена штамма «О №2383/Приморский/2019» вируса ящура с помощью ПЭГ-6000 в течение 4 ч отмечали увеличение содержания компонентов по сравнению с исходными значениями (до концентрирования) в 3,5 раз. Используя тот же полимер, но повышая время воздействия до 12 ч, увеличили концентрацию компонентов вируса в 3,9 раз. Применяя метод концентрирования с помощью тангенциальной фильтрации, удалось увеличить количество иммуногенных компонентов антигена штамма «О №2383/Приморский/2019» вируса ящура в суспензии в 4,9 раз. Таким образом, технология танценциальной фильтрации позволила получить антиген штамма «О №2383/Приморский/2019» с высокой концентрацией структурных вирусных белков.Before and after the process of concentrating the antigen suspension of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019,” the concentration of the total viral protein and immunogenic components was determined in the quantitative version of the RSC. The research results are presented in Table 5, from which it can be seen that when concentrating the antigen of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus using PEG-6000 for 4 hours, an increase in the content of components was noted compared to the initial values (before concentration) in 3.5 times. Using the same polymer, but increasing the exposure time to 12 hours, we increased the concentration of virus components by 3.9 times. Using the concentration method using tangential filtration, it was possible to increase the amount of immunogenic components of the antigen of the strain “O No. 2383/Primorsky/2019” of the foot-and-mouth disease virus in suspension by 4.9 times. Thus, dance filtration technology made it possible to obtain the antigen of the strain “O No. 2383/Primorsky/2019” with a high concentration of structural viral proteins.
Пример 8. Подбор адъюванта и соотношения антиген-адъювант.Example 8. Selection of adjuvant and antigen-adjuvant ratio.
Для изготовления противоящурной моновалентной эмульсионной вакцины из антигена штамма «О №2383/Приморский/2019» в качестве адъюванта была выбран гидроксид алюминия в комплексе с сапонином. При изготовлении данного вакцинного препарата использовали масляный адъювант Montanide ISA-71 R VG в количестве 70% по массе.To produce an anti-foot-and-mouth disease monovalent emulsion vaccine from the antigen of the strain “O No. 2383/Primorsky/2019,” aluminum hydroxide in combination with saponin was chosen as an adjuvant. In the manufacture of this vaccine preparation, the oil adjuvant Montanide ISA-71 R VG was used in an amount of 70% by weight.
Пример 9. Компоновка вакцины против ящура из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 культуральной инактивированной эмульсионной.Example 9. Composition of a vaccine against foot-and-mouth disease from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 in a culture-inactivated emulsion.
Из полученного концентрата антигена вируса ящура штамма «О №2383/Приморский/2019» изготовили вакцину против ящура генотипа O/SEA/Mya-98 культуральную инактивированную эмульсионную с применением в качестве адъювантов гидроксида алюминия и сапонина. Количество 146S иммуногенного компонента в 1,0 см3 антигена составило 7,35±0,02 мкг/см3 (таблица 5).From the resulting concentrate of the antigen of the foot-and-mouth disease virus strain “O No. 2383/Primorsky/2019,” a cultural inactivated emulsion vaccine against foot-and-mouth disease genotype O/SEA/Mya-98 was prepared using aluminum hydroxide and saponin as adjuvants. The amount of 146S immunogenic component per 1.0 cm 3 of antigen was 7.35 ± 0.02 μg/cm 3 (Table 5).
Пример 10. Иммунизация животных вакциной против ящура из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 культуральной инактивированной эмульсионной.Example 10. Immunization of animals with a vaccine against foot and mouth disease from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98, cultural inactivated emulsion.
Из полученной вакцины против ящура из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 культуральной инактивированной эмульсионной (предлагаемое изобретение) был приготовлен ряд разведений для свиней с 5-ти кратным шагом. 15 голов свиней разделили на 3 группы по 5 голов в каждой. Иммунизирующая доза составляла 2,0 см3. Первую группу животных (№№ 1-5) иммунизировали вакциной без разведения, вторую группу свиней (№№ 6-10) привили вакциной, разведенной 1/5, третья группа животных (№№ 11-15) - вакциной, разведенной 1/25. Препарат вводили внутримышечно в среднюю треть шеи. В качестве контроля вируса оставили 2 головы без вакцинации.From the resulting vaccine against foot and mouth disease from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98, a cultural inactivated emulsion (the proposed invention), a series of dilutions were prepared for pigs in 5-fold increments. 15 pigs were divided into 3 groups of 5 pigs each. The immunizing dose was 2.0 cm 3 . The first group of animals (No. 1-5) were immunized with the vaccine without dilution, the second group of pigs (No. 6-10) were vaccinated with the vaccine diluted 1/5, the third group of animals (No. 11-15) - with the vaccine diluted 1/25 . The drug was administered intramuscularly into the middle third of the neck. As a control for the virus, 2 heads were left without vaccination.
Пример 11. Исследование сывороток крови вакцинированных животных на наличие антител к неструктурным белкам вируса ящура.Example 11. Study of blood sera of vaccinated animals for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus.
Сыворотки крови от свиней, полученные до иммунизации и через 14 суток после иммунизации, исследовали на наличие антител к неструктурным белкам вируса ящура с помощью блокирующего варианта иммуноферментного анализа (ИФА) в соответствии с рекомендациями OIE (МЭБ) [3]. Тестирование полученных сывороток проводили с использованием тест-системы для ИФА «Prio CHECK®FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs» (Prionics Lelystad B.V., Нидерланды). Полученные результаты исследований отражены в таблице 6, из которой видно, что сыворотки крови животных не содержали антител к неструктурным белкам вируса ящура (значения PI для сывороток крови свиней <50%).Blood sera from pigs obtained before immunization and 14 days after immunization were examined for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus using a blocking enzyme-linked immunosorbent assay (ELISA) in accordance with OIE recommendations [3]. The obtained sera were tested using the ELISA test system “Prio CHECK ® FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs” (Prionics Lelystad BV, the Netherlands). The research results obtained are reflected in Table 6, from which it can be seen that the animal blood sera did not contain antibodies to non-structural proteins of the foot-and-mouth disease virus (PI values for pig blood sera <50%).
Пример 12. Оценка аеирулентности и безвредности вакцины против ящура из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 культуральной инактивированной эмульсионной (предлагаемое изобретение).Example 12. Assessment of the aerulence and harmlessness of a vaccine against foot-and-mouth disease from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 cultural inactivated emulsion (the proposed invention).
Для определения авирулентности вакцины для свиней отобранную пробу вакцинного препарата вводили внутрикожно по 0,1 см3. В исследовании использовали свиней массой 30-40 кг. В течение 10 суток наблюдения животные остались клинически здоровыми, и при патологоанатомическом исследовании не было обнаружено изменений, характерных для ящура. Это свидетельствовало об отсутствии вирулентных свойств разработанной вакцины.To determine the avirulence of the vaccine for pigs, a selected sample of the vaccine preparation was injected intradermally at 0.1 cm 3 . The study used pigs weighing 30-40 kg. During 10 days of observation, the animals remained clinically healthy, and the pathological examination did not reveal any changes characteristic of foot-and-mouth disease. This indicated the absence of virulent properties of the developed vaccine.
Контроль безвредности продукта на животных проводили путем внутримышечного введения вакцины в дозе 6,0 см3 (тройная доза по 2,0 см3). Срок наблюдения также составлял 10 суток. Следует отметить, что после иммунизации температура тела животного может повышаться до 41,5°С и удерживаться на этом уровне в течение 1-2 суток, что не выходит за рамки нормы после введения вакцинного препарата.Control of the safety of the product in animals was carried out by intramuscular injection of the vaccine at a dose of 6.0 cm 3 (triple dose of 2.0 cm 3 ). The observation period was also 10 days. It should be noted that after immunization, the animal’s body temperature can rise to 41.5°C and remain at this level for 1-2 days, which does not go beyond the norm after administration of the vaccine preparation.
По результатам исследований вакцина против ящура из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 культуральная инактивированная эмульсионная (предлагаемое изобретение) была признана безвредной, все животные в период наблюдения оставались клинически здоровыми, при патологоанатомическом анализе некроза тканей на месте введения вакцины не обнаружено.According to the results of the research, the vaccine against foot and mouth disease from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98, cultural inactivated emulsion (the proposed invention) was found to be harmless, all animals during the observation period remained clinically healthy, with postmortem analysis of tissue necrosis No vaccine was found at the injection site.
Пример 13. Изучение иммуногенных свойств вакцины против ящура из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 культуральной инактивированной эмульсионной (предлагаемое изобретение) по способности индуцирования вируснейтрализующих антител у естественно восприимчивых животных.Example 13. Study of the immunogenic properties of the vaccine against foot and mouth disease from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 cultural inactivated emulsion (the proposed invention) in terms of the ability to induce virus-neutralizing antibodies in naturally susceptible animals.
На 21 сутки после введения вакцины против ящура из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 культуральной инактивированной эмульсионной (предлагаемое изобретение) у свиней отбирали кровь и проводили исследование полученных сывороток крови в реакции микронейтрализации [3]. Выявлено, что у свиней, иммунизированных вакциной в цельной дозе (5 голов), средние значения титра антител составили 7,85±0,22 log2 SN50, с разведением 1/5 (5 голов) - 4,75±0,18 log2 SN50, с разведением 1/25 (5 голов) - 3,50±0,31 log2SN50. (табл. 7). Полученные данные реакции микронейтрализации свидетельствуют о том, что после введения вакцины в цельном виде обеспечивается формирование гуморального иммунитета с защитными титрами штаммоспецифических антител (5,5 и более log2SN50), что соответствует требованиям международных стандартов [3].On the 21st day after the introduction of the vaccine against foot and mouth disease from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 cultural inactivated emulsion (the proposed invention), blood was taken from pigs and the resulting blood sera were examined in a microneutralization reaction [3] . It was revealed that in pigs immunized with the vaccine in a whole dose (5 heads), the average antibody titer was 7.85±0.22 log 2 SN 50 , with a dilution of 1/5 (5 heads) - 4.75±0.18 log 2 SN 50 , with breeding 1/25 (5 heads) - 3.50±0.31 log 2 SN 50 . (Table 7). The data obtained from the microneutralization reaction indicate that after administration of the vaccine in its entirety, the formation of humoral immunity with protective titers of strain-specific antibodies (5.5 or more log 2 SN 50 ) is ensured, which meets the requirements of international standards [3].
Пример 14. Контрольное заражение естественно восприимчивых животных. Изучение защитной способности вакцины против ящура из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 культуральной инактивированной эмульсионной (предлагаемое изобретение) на естественно восприимчивых видах животных.Example 14: Challenge of naturally susceptible animals. Study of the protective ability of the vaccine against foot and mouth disease from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 cultural inactivated emulsion (the proposed invention) on naturally susceptible animal species.
Свиньи, иммунизированные в количестве 15 голов, вакциной в цельном виде и в разведениях, заражали контрольным штаммом «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 вируса ящура, адаптированного к этим животным в дозе 104,0 ИД50/0,20 см3 (в две точки по 0,10±0,05 см3). Спустя 7 суток после заражения всех животных подвергли эвтаназии и провели патологоанатомический осмотр. Защищенными от ящура считали животных, у которых на конечностях отсутствовали поражения. Первичные афты не учитывали.Pigs immunized in the amount of 15 heads with the vaccine in whole form and in dilutions were infected with the control strain “O No. 2383/Primorsky/2019” of the genotype O/SEA/Mya-98 of the foot-and-mouth disease virus, adapted to these animals at a dose of 10 4.0 ID 50 /0.20 cm 3 (in two points of 0.10 ± 0.05 cm 3 ). 7 days after infection, all animals were euthanized and a postmortem examination was performed. Animals that had no lesions on their limbs were considered protected from foot and mouth disease. Primary aphthae were not taken into account.
Результаты контрольного заражения представлены в таблице 7, из которой следует, что вакцина против ящура из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 культуральная инактивированная эмульсионная (предлагаемое изобретение) в цельном виде, а также в разведениях 1/5 и 1/25, введенная в однократной дозе (2,0 см3) защищает свиней от заражения гомологичным штаммом всех животных (5 из 5 голов).The results of the control infection are presented in Table 7, from which it follows that the vaccine against foot and mouth disease from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 is a cultural inactivated emulsion (the proposed invention) in whole form, as well as in dilutions 1/5 and 1/25, administered in a single dose (2.0 cm 3 ), protects pigs from infection with a homologous strain of all animals (5 out of 5 heads).
По результатам контрольного заражения было установлено, что в прививном объеме данной вакцины содержится 40,516 ПД50 и 0,049 ИМД50 для свиней.Based on the results of the control infection, it was found that the vaccination volume of this vaccine contains 40.516 PD 50 and 0.049 IMD 50 for pigs.
Таким образом, приведенная выше информация свидетельствует о том, что вакцина против ящура генотипа O/SEA/Mya-98 из штамма «О №2383/Приморский/2019» культуральная инактивированная эмульсионная, воплощающая предлагаемое изобретение, предназначена как резервная для использования в сельском хозяйстве, а именно в ветеринарной вирусологии и биотехнологии; подтверждена возможность осуществления представленного; вакцина, изготовленная из штамма «О №2383/Приморский/2019» генотипа O/SEA/Mya-98 в соответствии с предлагаемым изобретением, обладает высокой иммуногенной активностью и способна обеспечить эффективную защиту восприимчивых животных против эпизоотического штамма вируса ящура серотипа О, генотипа O/SEA/Mya-98.Thus, the above information indicates that the cultural inactivated emulsion vaccine against foot and mouth disease genotype O/SEA/Mya-98 from the strain “O No. 2383/Primorsky/2019”, embodying the proposed invention, is intended as a reserve for use in agriculture, namely in veterinary virology and biotechnology; the possibility of implementing the presented has been confirmed; the vaccine made from the strain “O No. 2383/Primorsky/2019” genotype O/SEA/Mya-98 in accordance with the proposed invention has high immunogenic activity and is capable of providing effective protection of susceptible animals against the epizootic strain of foot-and-mouth disease virus serotype O, genotype O/ SEA/Mya-98.
Источники информации, принятые во внимание при составлении описания изобретения к заявке на выдачу патента РФ на изобретение «Вакцина против ящура генотипа O/SEA/Mya-98 из штамма «О №2383/Приморский/2019» культуральная инактивированная эмульсионная»:Sources of information taken into account when compiling a description of the invention for the application for a RF patent for the invention “Vaccine against foot-and-mouth disease genotype O/SEA/Mya-98 from the strain “O No. 2383/Primorsky/2019”, cultural inactivated emulsion”:
1. Ящур. Меры профилактики. URL: http://89.rospotrebnadzor.ru/directions/epid_nadzor/146902 (Дата обращения: 13.02.2023).1. Foot and mouth disease. Prevention measures. URL: http://89.rospotrebnadzor.ru/directions/epid_nadzor/146902 (Access date: 02/13/2023).
2. Опасность болезни ящура. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Дата обращения: 01.02.2023).2. The danger of foot and mouth disease. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Access date: 02/01/2023).
3. OIE. Manual of diagnostic tests and vaccines for terrestrial animals -24th Ed.-Paris, 2015-Vol. 1, Chapter 2.1.5. - P. 166-169.3. OIE. Manual of diagnostic tests and vaccines for terrestrial animals -24th Ed.-Paris, 2015-Vol. 1, Chapter 2.1.5. - P. 166-169.
4. Бурдов А.Н., Дудников А.И., Малярец П.В. и др. Ящур. -М.: Агропромиздат, 1990. - 320 с.4. Burdov A.N., Dudnikov A.I., Malyarets P.V. and others. Foot and mouth disease. -M.: Agropromizdat, 1990. - 320 p.
5. Пономарев А.П., Узюмов В Л., Груздев К.Н. Вирус ящура: структура, биологические и физико-химические свойства. - Владимир: Фолиант, 2006. - 250 с.5. Ponomarev A.P., Uzyumov V.L., Gruzdev K.N. Foot and mouth disease virus: structure, biological and physicochemical properties. - Vladimir: Folio, 2006. - 250 p.
6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.
7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strateies: Proc. Jnt. Symp.2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strategies: Proc. Jnt. Symp.2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.
8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J. M. Pachecoa, T. Doel [et.al.] // Vaccine. -December 2005. - V. 23. - P. 5775-5782.8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J. M. Pachecoa, T. Doel [et.al.] // Vaccine. -December 2005. - V. 23. - P. 5775-5782.
9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M / Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M. / Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.
10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.
11. Официальный сайт The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wrlfmd.org/ref_labs/fmd_ref_lab_reports.htm (Дата обращения 02.02.2023).11. Official website of The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wrlfmd.org/ref_labs/fmd_ref_lab_reports.htm (Access date 02/02/2023).
12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - P. 746-754.12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - P. 746-754.
13. Рахманов A.M. Современная эпизоотическая ситуация в мире по ящуру и меры ее контроля // Ветеринарная медицина мiжвiд. тем. наук. Харкiв, 2013. - С. 37-38.13. Rakhmanov A.M. Current epizootic situation in the world regarding foot and mouth disease and measures for its control // Veterinary medicine of the interspecies. topics Sci. Kharkiv, 2013. - pp. 37-38.
14. Longjam N., Тауо Т. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol. 4(10). - P. 475-479.14. Longjam N., Tauo T. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol. 4(10). - P. 475-479.
15. Мельник Р.Н., Хаустова Н.В., Мельник Н.В., Самуйленко А.Я., Гринь С.А., Святенко М.С., Литенкова И.Ю. Антигенная вариабельность вируса ящура серотипа А и обоснование необходимости получения новых актуальных производственных штаммов/ Ветеринария и кормление. - 2019. -№3. - С. 29-31.15. Melnik R.N., Khaustova N.V., Melnik N.V., Samuylenko A.Ya., Grin S.A., Svyatenko M.S., Litenkova I.Yu. Antigenic variability of foot and mouth disease virus serotype A and justification for the need to obtain new current production strains / Veterinary medicine and feeding. - 2019. -№3. - pp. 29-31.
16. Paton D.J., Sumption K.J., Charleston В. Options for control of foot-and-mouth disease: knowledge, capability and policy/ Phil. Trans. R. Soc. В (2009) 364. - P. 2657-2667.16. Paton D.J., Sumption K.J., Charleston B. Options for control of foot-and-mouth disease: knowledge, capability and policy/ Phil. Trans. R. Soc. In (2009) 364. - P. 2657-2667.
17. Патент RU 2 665 849 Вакцина инактивированная эмульсионная против ящура типа О / Лозовой Дмитрий Анатольевич, Михалишин Дмитрий Валерьевич, Стариков Вячеслав Алексеевич, Борисов Алексей Валерьевич, Доронин Максим Игоревич, заявка: 2017144155, 2017.12.15, опубликовано: 2018.09.04.17. Patent RU 2 665 849 Inactivated emulsion vaccine against foot and mouth disease type O / Lozovoy Dmitry Anatolyevich, Mikhalishin Dmitry Valerievich, Starikov Vyacheslav Alekseevich, Borisov Alexey Valerievich, Doronin Maxim Igorevich, application: 2017144155, 2017.12.15, published o: 2018.09.04.
18. Методические рекомендации по определению концентрации 146S, 75S, 12S компонентов вакцинных штаммов культурального вируса ящура в реакции связывания комплемента (РСК) / ФГБУ «ВНИИЗЖ». - Утв. 21.09.17.18. Methodological recommendations for determining the concentration of 146S, 75S, 12S components of vaccine strains of cultural foot-and-mouth disease virus in the complement fixation reaction (FRR) / Federal State Budgetary Institution "ARRIAH". - Approved 09.21.17.
19. Методические указания по определению антигенного соответствия между эпизоотическими изолятами и производственными штаммами вируса ящура в перекрестной реакции микронейтрализации: утв. Россельхознадзором 13.09.2017 / ФГБУ «ВНИИЗЖ». - Владимир: 2017. - 24 с.19. Guidelines for determining antigenic correspondence between epizootic isolates and production strains of foot-and-mouth disease virus in a cross-microneutralization reaction: approved. Rosselkhoznadzor 09/13/2017 / FSBI "ARRIAH". - Vladimir: 2017. - 24 p.
20. Saitou N. and Nei М. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4:406-42.20. Saitou N. and Nei M. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4:406–42.
21. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap. Evolution 39:783-791.21. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap. Evolution 39:783–791.
22. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101:11030-11035.22. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101:11030–11035.
23. Kumar S., Stecher G., Li M., Knyaz C., and Tamura K. (2018). MEGA 6: Molecular Evolutionary Genetics Analysis across computing platforms. Molecular Biology and Evolution 35:1547-1549.23. Kumar S., Stecher G., Li M., Knyaz C., and Tamura K. (2018). MEGA 6: Molecular Evolutionary Genetics Analysis across computing platforms. Molecular Biology and Evolution 35:1547–1549.
24. Barnett P. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M / Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - 2002. - V. 25. - P. 345-364.24. Barnett P. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M. / Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - 2002. - V. 25. - P. 345-364.
--->--->
<?xml version="1.0" encoding="UTF-8"?><?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing <!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing
1.3//EN" "ST26SequenceListing_V1_3.dtd">1.3//EN" "ST26SequenceListing_V1_3.dtd">
<ST26SequenceListing dtdVersion="V1_3" fileName="Mya-98.xml" <ST26SequenceListing dtdVersion="V1_3" fileName="Mya-98.xml"
softwareName="WIPO Sequence" softwareVersion="2.1.2" softwareName="WIPO Sequence" softwareVersion="2.1.2"
productionDate="2023-03-23">productionDate="2023-03-23">
<ApplicationIdentification> <ApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-03-23</FilingDate> <FilingDate>2023-03-23</FilingDate>
</ApplicationIdentification> </ApplicationIdentification>
<ApplicantFileReference>496</ApplicantFileReference> <ApplicantFileReference>496</ApplicantFileReference>
<EarliestPriorityApplicationIdentification> <EarliestPriorityApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-03-23</FilingDate> <FilingDate>2023-03-23</FilingDate>
</EarliestPriorityApplicationIdentification> </EarliestPriorityApplicationIdentification>
<ApplicantName languageCode="ru">ФГБУ "Федеральный центр охраны <ApplicantName languageCode="ru">FSBI "Federal Security Center"
здоровья животных" (ФГБУ "ВНИИЗЖ")</ApplicantName>animal health" (FSBI "ARRIAH")</ApplicantName>
<ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin> <ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin>
<InventorName languageCode="ru">Доронин Максим <InventorName languageCode="ru">Doronin Maxim
Игоревич</InventorName>Igorevich</InventorName>
<InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin> <InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin>
<InventionTitle languageCode="ru">Вакцина против ящура генотипа <InventionTitle languageCode="en">Vaccine against foot and mouth disease genotype
O/SEA/Mya-98 из штамма «О №2383/Приморский/2019» культуральная O/SEA/Mya-98 from strain “O No. 2383/Primorsky/2019” cultural
инактивированная эмульсионная</InventionTitle>inactivated emulsion</InventionTitle>
<SequenceTotalQuantity>2</SequenceTotalQuantity> <SequenceTotalQuantity>2</SequenceTotalQuantity>
<SequenceData sequenceIDNumber="1"> <SequenceData sequenceIDNumber="1">
<INSDSeq> <INSDSeq>
<INSDSeq_length>639</INSDSeq_length> <INSDSeq_length>639</INSDSeq_length>
<INSDSeq_moltype>DNA</INSDSeq_moltype> <INSDSeq_moltype>DNA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..639</INSDFeature_location> <INSDFeature_location>1..639</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>genomic DNA</INSDQualifier_value> <INSDQualifier_value>genomic DNA</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q1"> <INSDQualifier id="q1">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>accacctccacaggtgagtcagctgaccccgtgaccgccactgttgaaa <INSDSeq_sequence>accacctccacaggtgagtcagctgaccccgtgaccgccactgttgaaa
actacggcggtgagacacaggtccagaggcgccaacacacggacgtctcattcattttggacagatttgtactacggcggtgagacacaggtccagaggcgccaacacacggacgtctcattcattttggacagatttgt
aaaagtgacgccaaaagaccaaattaatgtactggacctgatgcaaacccccgctcacactctggtgggaaaaagtgacgccaaaagaccaaattaatgtactggacctgatgcaaacccccgctcacactctggtggga
gcgctccttcgtactgccacttactatttcgctgacttagaagtggcagtgaaatacgagggaaacctcagcgctccttcgtactgccacttactatttcgctgacttagaagtggcagtgaaatacgagggaaacctca
cttgggtcccgaatggggcgcctgaaaacgcgttggataacaccaccaacccaacggcataccacaaggccttgggtcccgaatggggcgcctgaaaacgcgttggataacaccaccaacccaacggcataccacaaggc
accactcacccggcttgcattgccgtacacggcaccacaacgtgtgttggcaaccgtttacaacgggaacaccactcacccggcttgcattgccgtacacggcaccacaacgtgtgttggcaaccgtttacaacgggaac
tgcaagtacggtgatggttcggtgaccaacataagaggtgacctacaagtgttggcccagaaggcggcgatgcaagtacggtgatggttcggtgaccaacataagaggtgacctacaagtgttggcccagaaggcggcga
gaacgctgcctacctccttcaactacggtgccatcaaagctactcgggtgactgaactgctttaccgcatgaacgctgcctacctccttcaactacggtgccatcaaagctactcgggtgactgaactgctttaccgcat
gaagagggctgagacgtactgcccccggcctcttttggccattcacccgaacgaggccagacacaaacaggaagagggctgagacgtactgcccccggcctcttttggccattcacccgaacgaggccagacacaaacag
aagattgtggcacctgtgaagcagctcctg</INSDSeq_sequence>aagattgtggcacctgtgaagcagctcctg</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
<SequenceData sequenceIDNumber="2"> <SequenceData sequenceIDNumber="2">
<INSDSeq> <INSDSeq>
<INSDSeq_length>213</INSDSeq_length> <INSDSeq_length>213</INSDSeq_length>
<INSDSeq_moltype>AA</INSDSeq_moltype> <INSDSeq_moltype>AA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..213</INSDFeature_location> <INSDFeature_location>1..213</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>protein</INSDQualifier_value> <INSDQualifier_value>protein</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q2"> <INSDQualifier id="q2">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>TTSTGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQIN <INSDSeq_sequence>TTSTGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQIN
VLDLMQTPAHTLVGALLRTATYYFADLEVAVKYEGNLTWVPNGAPENALDNTTNPTAYHKAPLTRLALPYVLDLMQTPAHTLVGALLRTATYYFADLEVAVKYEGNLTWVPNGAPENALDNTTNPTAYHKAPLTRLALPY
TAPQRVLATVYNGNCKYGDGSVTNIRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRMKRAETYCPRTAPQRVLATVYNGNCKYGDGSVTNIRGDLQVLAQKAARTLPTSFNYGAIKATRVTELLYRMKRAETYCPR
PLLAIHPNEARHKQKIVAPVKQLL</INSDSeq_sequence>PLLAIHPNEARHKQKIVAPVKQLL</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
</ST26SequenceListing></ST26SequenceListing>
<---<---
Claims (3)
Publications (1)
Publication Number | Publication Date |
---|---|
RU2804803C1 true RU2804803C1 (en) | 2023-10-05 |
Family
ID=
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2816264C1 (en) * | 2023-07-31 | 2024-03-28 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Cultural inactivated emulsion vaccine against o/ea-3 genotype foot-and-mouth disease of o n2241/ethiopia/2011 strain |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2665849C1 (en) * | 2017-12-15 | 2018-09-04 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Inactivated emulsion vaccine against foot-and-mouth disease type o |
WO2019021305A1 (en) * | 2017-07-24 | 2019-01-31 | Ella Foundation | Vaccine against foot-and-mouth disease |
RU2772713C1 (en) * | 2021-05-12 | 2022-05-24 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Vaccine for early protection against foot-and-mouth disease from strain a 2205/g iv cultural inactivated emulsion |
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2019021305A1 (en) * | 2017-07-24 | 2019-01-31 | Ella Foundation | Vaccine against foot-and-mouth disease |
RU2665849C1 (en) * | 2017-12-15 | 2018-09-04 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Inactivated emulsion vaccine against foot-and-mouth disease type o |
RU2772713C1 (en) * | 2021-05-12 | 2022-05-24 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Vaccine for early protection against foot-and-mouth disease from strain a 2205/g iv cultural inactivated emulsion |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2816264C1 (en) * | 2023-07-31 | 2024-03-28 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Cultural inactivated emulsion vaccine against o/ea-3 genotype foot-and-mouth disease of o n2241/ethiopia/2011 strain |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Botros et al. | Adverse response of non‐indigenous cattle of European breeds to live attenuated Smithburn Rift Valley fever vaccine | |
Diaz-San Segundo et al. | Synonymous deoptimization of foot-and-mouth disease virus causes attenuation in vivo while inducing a strong neutralizing antibody response | |
DK2331682T3 (en) | INFECTIOUS BRONKITIS VACCINES DERIVED FROM IB-QX SIMILAR TREASURES | |
RU2593718C1 (en) | Inactivated emulsion vaccine against foot-and-mouth disease types a, o, asia-1 | |
RU2603003C1 (en) | Inactivated sorptive vaccine to fmd types a, o, asia-1 | |
CN111491663B (en) | Porcine influenza A virus vaccine | |
RU2451745C2 (en) | A 2045/KYRGYZSTAN/ 2007 STRAIN OF FOOT-AND-MOUTH DISEASE VIRUS Aphtae epizooticae TYPE A FOR ANTIGENIC AND IMMUNOGENIC PERFORMANCE CONTROL OF FOOT-AND-MOUTH DISEASE VACCINES AND FOR PRODUCTION OF BIOPREPARATIONS FOR DIAGNOSIS AND SPECIFIC PREVENTION OF FOOT-AND-MOUTH DISEASE TYPE A | |
RU2699671C1 (en) | Vaccine for early protection against foot-and-mouth disease of type o inactivated emulsion | |
RU2804803C1 (en) | Culture inactivated emulsion vaccine against fmd of o/sea/mya-98 genotype from o n2383/primorsky/2019 strain | |
RU2665849C1 (en) | Inactivated emulsion vaccine against foot-and-mouth disease type o | |
RU2815537C1 (en) | Cultural inactivated emulsion vaccine against foot and mouth disease from o no. 2620/orenburgsky/2021 strain of o/me-sa/ind-2001e genotype | |
RU2810131C1 (en) | CULTURE INACTIVATED SORBED VACCINE AGAINST FOOT AND MOUTH DISEASE OF O/ME-SA/PanAsia2ANT-10 GENOTYPE FROM O N2356/PAKISTAN/2018 STRAIN | |
RU2816264C1 (en) | Cultural inactivated emulsion vaccine against o/ea-3 genotype foot-and-mouth disease of o n2241/ethiopia/2011 strain | |
RU2817381C1 (en) | Cultural inactivated sorbed vaccine against foot-and-mouth disease from the strain "a/egypt/euro-sa/2022" | |
RU2815536C1 (en) | Culture inactivated sorbed vaccine against foot and mouth disease from a/tanzania/2013 strain of a/africa/g-i genotype | |
RU2816944C1 (en) | Cultural inactivated emulsion vaccine against foot-and-mouth disease serotype o from strain "o/arriah/mya-98" | |
RU2804875C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-2/vii genotype from sat-2/eritrea/1998 strain | |
RU2815534C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-1/i genotype from sat-1/tanzania/2012 strain | |
RU2815541C1 (en) | Culturally inactivated sorbed vaccine against foot and mouth disease of sat-2/iv genotype | |
RU2810132C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-1/x genotype from sat-1/nigeria/2015 strain | |
RU2809219C1 (en) | Culturally inactivated sorbed vaccine against foot and mouth disease of sat-1/nwz genotype | |
RU2802192C1 (en) | Inactivated sorbed vaccine against fmd of o/ea-2 genotype from o/kenya/2017 strain culture | |
RU2824662C1 (en) | Culture inactivated emulsion vaccine against foot-and-mouth disease of asia-1/g-v genotype from asia-1/g-v/2006 strain | |
RU2799605C1 (en) | FMD CULTURE INACTIVATED SORBED VACCINE FROM A/Iran/2018 STRAIN OF A/ASIA/Iran-05SIS-13 NEW GENOTYPE | |
RU2340672C2 (en) | Mutant of virus infectious of bursal disease (ibdv), expressing virus-neutralised epitopes specific to classical and alternative ibdv strains |