RU2804875C1 - Culture inactivated adsorbed vaccine against fmd of sat-2/vii genotype from sat-2/eritrea/1998 strain - Google Patents

Abstract

FIELD: veterinary virology and biotechnology.

SUBSTANCE: cultured inactivated adsorbed vaccine against FMD of SAT-2/VII genotype from SAT-2/Eritrea/1998 strain is described. The vaccine contains an avirulent and purified concentrated antigen of SAT-2/Eritrea/1998 strain of foot and mouth disease virus of SAT-2/VII genotype, obtained in a suspension transplanted cell line from the kidney of a newborn Syrian hamster (BHK-21/SUSP/ARRIAH), representing a suspension containing predominantly 146S immunogenic component of FMDV, adjuvant aluminum hydroxide and saponin in effective ratios. The vaccine is highly immunogenic and can provide effective protection against a homologous infectious agent circulating in African countries and Middle East countries.

EFFECT: considering the increase in trade and economic relations between the Russian Federation and the countries of the African continent and Africa, the created vaccine is relevant for ensuring the biological safety of our country and the overall situation of FMD in the world in relation to SAT-2/VII genotype in the world.

3 cl, 1 dwg, 7 tbl, 14 ex

Description

The invention relates to the field of veterinary virology and biotechnology, namely to the development of a culture inactivated sorbed vaccine against foot and mouth disease genotype SAT-2/VII.

Foot and mouth disease is a particularly dangerous viral disease of animals, characterized by intoxication and vesicular-erosive damage to the mucous membranes of the oral and nasal cavities, as well as the skin of the interdigital folds and the periungual bed [1, 2, 3, 4].

Currently, there are 7 serotypes of foot-and-mouth disease virus: O, A, C, Asia-1, SAT-1, SAT-2 and SAT-3. Each serotype is genetically divided into different topotypes, genetic lineages and sublineages. The differences between them are determined by analyzing the nucleotide sequence of the 1D gene (VP ₁ protein), which is characterized by high genomic and antigenic variability [1]. Foot-and-mouth disease virus serotype SAT-2 has greater sequence variability in the VP ₁ protein gene compared to viruses of serotypes O, A and C [2, 3], for which it is considered as a broad antigenic variant; therefore, in the case of SAT-2, careful selection of the immunodominant vaccine strain [3, 4, 6].

The foot-and-mouth disease virus serotype SAT-2 is characterized by high genetic variability, namely, it includes the following 14 topotypes (I-XIV), within which there is no division into genetic groups. Such high genetic and antigenic diversity leads to problems in the specific prevention of foot-and-mouth disease when using culture-inactivated foot-and-mouth disease vaccines, and also complicates the strain-specific diagnosis of isolated foot-and-mouth disease virus isolates. As a result, there is a need to create new diagnostic tools and specific immunoprophylaxis against the foot-and-mouth disease virus serotype SAT-2 [5-11].

Due to the easy and rapid spread of the foot-and-mouth disease pathogen, this disease can acquire the scope of an epizootic [12]. In order to prevent the occurrence of the disease, farms in the Russian Federation apply a system of measures to combat and prevent foot-and-mouth disease, which is aimed at preventing the introduction of the virus into the country, systematic immunization of large and small livestock in the buffer zone, as well as monitoring the immune status of vaccinated animals.

To immunize animals, a vaccine made from a virus homologous to field isolates should be used [6-13]. This infection continues to be a significant economic problem throughout the world. To conduct an effective vaccination campaign, it is necessary to have an effective, safe vaccine containing as an immunogenic part a viral antigen corresponding to the epizootic spreading isolate of a certain genotype [14]. The creation of such vaccines is an urgent task. Achieving this goal will make it possible to effectively use the vaccine in disadvantaged areas and threatened areas to build immunity against a specific genotype of the foot-and-mouth disease virus.

Outbreaks of foot-and-mouth disease serotype SAT-2 are being recorded across the African continent. In North African countries, in particular in Egypt, where outbreaks of foot-and-mouth disease were noted between 2012 and 2022, and in Libya (2012), the predominantly epizootic situation was associated with the SAT-2/VII genotype. In West Africa, in particular in Cameroon (2014), Nigeria (2019-2021), foot-and-mouth disease virus isolates of this genotype are also predominantly widespread. Accordingly, in these countries, measures were taken to eliminate and control foot-and-mouth disease of the specified genotype. At the same time, new representatives of this genotype appear that have genomic and amino acid substitutions, which leads to the emergence of new properties. Experts' forecasts are disappointing regarding the spread of this variant of the foot-and-mouth disease virus. It should be noted that trade and economic ties with the countries of the African continent, in particular East Africa, have intensified in recent years. And therefore, there are risks of introducing isolates of this serotype into the territory of the Russian Federation and other neighboring countries. The degree of variability within one topotype VII is high, so there is an urgent need to study the properties of emerging strains of foot-and-mouth disease virus and to manufacture vaccine preparations and diagnostic test systems based on it.

Analyzing the outbreaks that were registered in Africa, it was found that isolates of different topotypes of the SAT-2 serotype were identified, in particular, I (“SAT-2/ZIM/14/2002”), II (“SAT-2/ZIM/5 /81"), III ("SAT-2/BOT/P3/98"), IV ("SAT-2/ETH/l/90"), V ("SAT-2/GHA/2/90"), VI (“SAT-2/GAM/8/79”), VII (“SAT-2/SAU/6/2000”), VIII (“SAT-2/RWO/l/00”), IX (“SAT- 2/KEN/2/84"), X ("SAT-2/UGA/19/98"), XI ("SAT-2/ANG/4/74"), XII ("SAT-2/UGA/51 /75"), XIII ("SAT-2/ETH/2/2007"), XIV ("SAT-2/ETH/2/9"1). As we can see, outbreaks of all 14 topotypes occurred.

There are known production strains of foot and mouth disease virus serotype SAT-2, which are used or have been used previously in the world for the production of specific preventative agents for foot and mouth disease:

- strain “SAT-2/ZIM/14/2002” (genotype SAT-2/I),

- strain “SAT-2/ZIM/5/81” (genotype SAT-2/II),

- strain “SAT-2/BOT/P3/98” (genotype SAT-2/III),

- strain “SAT-2/ETH/l/90” (genotype SAT-2/IV),

- strain “SAT-2/GHA/2/90” (genotype SAT-2/V),

- strain “SAT-2/GAM/8/79” (genotype SAT-2/VI),

- strain “SAT-2/SAU/6/2000” (genotype SAT-2/VII),

- strain “SAT-2/RWO/l/00” (genotype SAT-2/VIII),

- strain “SAT-2/KEN/2/84” (genotype SAT-2/IX),

- strain “SAT-2/UGA/19/98” (genotype SAT-2/X),

- strain “SAT-2/ANG/4/74” (genotype SAT-2/XI),

- strain “SAT-2/UGA/51/75” (genotype SAT-2/XII),

- strain “SAT-2/ETH/2/2007” (genotype SAT-2/XIII),

- strain “SAT-2/ETH/2/9” (genotype SAT-2/XIV).

The isolate “SAT-2/Eritrea” of the foot-and-mouth disease virus was isolated from cattle in the territory of the state of Eritrea in 1998 and was supplied to the Federal State Budgetary Institution “ARRIAH” from the World Reference Laboratory of the Pirbright Institute for scientific research in 2020. According to this laboratory, modern circulating isolates in African countries and Transcaucasian countries, where the foot-and-mouth disease virus of this genotype is currently aggressively penetrating, are close, according to serological and molecular biological studies, precisely with the “SAT-2/Eritrea” isolate and, accordingly, the “SAT-2/Eritrea” strain /1998".

According to the results of a comparative analysis of nucleotide sequences, the isolated isolate belongs to topotype VII of serotype SAT-2 foot-and-mouth disease virus, which differs significantly from the production strains of foot-and-mouth disease virus type SAT-2, including the strain “SAT-2/SAU/6/2000” (genotype SAT -2/VII), which is widely used nowadays [1].

Given the increase in trade and economic relations between Russia and the countries of the African continent, there is a danger of foot-and-mouth disease entering the Russian Federation and the problem of possible emergency prevention of this disease to build immunity in susceptible animals is of particular importance. Thus, the need arose to develop a new vaccine against foot and mouth disease genotype SAT-2/VII, culturally inactivated, sorbed, to ensure the biological safety of the territory of the Russian Federation and neighboring countries.

The closest to the proposed invention in terms of the totality of essential features is the inactivated vaccine sorbed against foot-and-mouth disease serotype SAT-2 (strain “SAT-2/SAU/6/2000”), containing the active substance in the form of avirulent and purified cultural antigenic material from the strain homologous to the causative agent of foot-and-mouth disease SAT-2/SAU/6/2000", obtained in a sensitive biological system, and targeted additives in the form of aluminum hydroxide and saponin (adjuvant): antigen concentration (inactivated 146S+75S components of the foot-and-mouth disease virus) not less than 3.0 μg/cm ³ , the content of a 10% aluminum hydroxide solution is 50% by volume, the concentration of saponin is 1.5 mg/cm ³ , the additive in the form of a supporting medium is up to 1.0 cm ³ (prototype) [15, 16].

As a sensitive biological system for the reproduction of the foot-and-mouth disease virus, a continuous suspension cell line of the kidney of a newborn Syrian hamster BNK-21 is used, as a supporting medium, the Eagle DMEM medium is used without adding serum, with the addition of enzymatic hydrolyzate of dry muscles, hydrolyzate of dried blood proteins at a pH of 7, 4-7.6.

Aminoethylethylenimine (AEEI) is used to inactivate the virus. When producing a sorbed vaccine, aluminum hydroxide (Al(OH) ₃ ) is used as an adjuvant. Purification of the virus-containing suspension from ballast impurities is carried out using polyhexamethylene guanidine hydrochloride (PHMG).

Avirulent and purified inactivated antigenic material from the foot-and-mouth disease virus strain serotype SAT-2 is a suspension consisting of 146S+75S components of the foot-and-mouth disease virus, that is, complete immunogenic particles and “empty” capsids.

A significant drawback of the prototype vaccine is its very low immunogenic activity against foot-and-mouth disease virus isolates of genotype SAT-2/VII circulating in Africa and the Middle East. In addition, the prototype version of the vaccine takes into account the sum of the 146S and 75S components, while only 146S particles, which are complete virions, carrying absolutely all immunogenic sites and structural viral proteins and viral RNA, have full immunogenic properties.

To solve this problem, the present invention was created, which included the development of a culture inactivated sorbed vaccine against foot and mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998”.

The technical result from the use of the proposed invention is to expand the arsenal of inactivated culture-sorbed vaccines to protect animals against isolates and strains of foot-and-mouth disease virus serotype SAT-2 and, in particular, genotype SAT-2/VII.

The specified technical result was achieved by creating a vaccine against foot-and-mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998”, a culture-inactivated sorbed vaccine, characterized by the following set of characteristics reflected below.

The developed vaccine in a 2.0 cm ³ preparation contains the following main components: 1) the active substance in the form of an avirulent and purified 146S component from the strain “SAT-2/Eritrea/1998” of the genotype SAT-2/VII of the foot-and-mouth disease virus, homologous to the infectious agent, reproduced in continuous suspension cell line BNK-21/SUSP/ARRIAH, in an amount of at least 3.5 μg; 2) aluminum hydroxide 10% colloidal solution containing 44% by volume (4.4% in terms of dry matter), 3) saponin in the amount of 1.9 mg, 4) supporting medium - up to 2.0 cm ³ .

The strain “SAT-2/Eritrea/1998”, which was obtained from the isolate “SAT-2/Eritrea”, was deposited in the All-Russian State Collection of Exotic Types of Foot and Mouth Disease Virus and other Animal Pathogens (FMD) of the Federal State Budgetary Institution “Federal Center for Animal Health Protection” (FGBU "ARRIAH"), under registration number: No. 459 - dep / 23-9 - GKShM FGBU "ARRIAH".

The strain is adapted to primary trypsinized porcine kidney (SP) cells and continuous cell lines from newborn Syrian hamster kidney (BNK-21/SUSP/ARRIAH), pig kidney (IB-RS-2) and Siberian ibex kidney (PSGK-30 ).

To produce a vaccine, preferably a continuous suspension cell culture BHK-21/SUSP/ARRIAH is used as a sensitive biological system, and Eagle's DMEM medium is used as a supporting medium without adding serum, but with the addition of blood protein hydrolyzate in an amount of 5% of the total volume at pH Wednesdays 7.45-7.65. Virus inactivation is carried out using aminoethylethylenimine (AEEI) with a concentration of 0.023% of the volume of the virus-containing suspension. The inactivated virus is purified from ballast impurities using polyhexamethylene guanidine (PHMG), which is added to the suspension to a concentration of 0.016% of the total volume.

Avirulent and purified strain antigen

"SAT-2/Eritrea/1998" foot-and-mouth disease virus is a suspension containing predominantly the inactivated 146S immunogenic component of the foot-and-mouth disease virus. The content of the component in the product is assessed using a quantitative version of the complement fixation reaction (CRR) [19]. To prepare the vaccine, use viral material containing at least 3.5 μg of inactivated immunogenic 146S particles of foot-and-mouth disease virus per 2.0 cm ³ . The required concentration of the immunogenic component in the vaccine preparation is ensured by concentrating the antigen through sorption on the surface of colloidal particles of aluminum hydroxide.

The vaccine against foot and mouth disease from the strain "SAT-2/Eritrea/1998" genotype SAT-2/VII, culture inactivated sorbed, is prepared by mixing purified antigen (inactivated 146S immunogenic component) and a 10% suspension of aluminum hydroxide in a ratio of 56% to 44% volume, respectively. To enhance the immune response, saponin is used in an amount of 1.9 mg per dose. The resulting vaccine is a suspension containing particles of water-insoluble aluminum hydroxide, carrying on their surface inactivated 146S particles of the foot-and-mouth disease virus, which ensure the formation of immunity in animals.

The proposed invention includes the following set of essential features that ensure obtaining a technical result in all cases for which legal protection is sought:

1. Vaccine against foot and mouth disease genotype SAT-2/VII, culture-inactivated, sorbed.

2. The active substance in the form of avirulent and purified antigenic material from the strain “SAT-2/Eritrea/1998” of genotype SAT-2/VII of the foot-and-mouth disease virus, homologous to the causative agent of the disease, in an effective amount.

3. Targeted supplements.

The significant distinctive features of the proposed vaccine are that as an active substance it contains the avirulent purified 146S component of the strain “SAT-2/Eritrea/1998” of the genotype SAT-2/VII of the foot-and-mouth disease virus in an effective amount.

The present invention is also characterized by other distinctive features that express specific forms of implementation or special conditions for its use:

1. Avirulent and purified antigen of the strain “SAT-2/Eritrea/1998” of the genotype SAT-2/VII of the foot-and-mouth disease virus, obtained in the suspension continuous cell line BNK-21/SUSP/ARRIAH and representing a suspension containing the 146S immunogenic component of the foot-and-mouth disease virus in effective amount.

2. Avirulent and purified antigen of the strain “SAT-2/Eritrea/1998” of the genotype SAT-2/VII of the foot-and-mouth disease virus, obtained in a suspension continuous cell culture BHK-21/SUSP/ARRIAH and representing a suspension containing predominantly the 146S immunogenic component of the foot-and-mouth disease virus in an amount of at least 3.5 mcg per 2.0 cm ³ of the finished vaccine preparation.

3. Among the targeted additives, the vaccine contains an adjuvant.

4. Of the targeted additives, the vaccine contains an adjuvant - aluminum hydroxide in combination with saponin.

5. The vaccine contains an adjuvant - aluminum hydroxide 4.4% in terms of dry residue in combination with saponin at a concentration of 1.9 mg per 2.0 cm ³ of the finished product.

6. Avirulent and purified antigen of the strain “SAT-2/Eritrea/1998” of the genotype SAT-2/VII of the foot-and-mouth disease virus, obtained in the continuous suspension cell line BNK-21/SUSP/ARRIAH, adjuvant - aluminum hydroxide and saponin, additive in the finished preparation in the form of a supporting medium in the following quantities:

Avirulent and purified antigen strain "SAT-2/Eritrea/1998" genotype SAT-2/VII foot and mouth disease virus not less than 3.5 mcg Aluminum hydroxide 4.4% (based on dry matter) Saponin 1.9 mg Supportive environment up to 2.0 cm ³

The proposed culture-inactivated sorbed vaccine against foot-and-mouth disease genotype SAT-2/VII has high immunogenic activity and provides reliable protection against foot-and-mouth disease virus isolates genotype SAT-2/VII circulating in Africa and Asia.

Achieving a technical result from the use of the invention is ensured by the fact that the composition of the proposed foot-and-mouth disease vaccine contains as an active substance an inactivated 146S component of the strain “SAT-2/Eritrea/1998” of the genotype SAT-2/VII of the foot-and-mouth disease virus, which has high immunogenic activity, creating effective protection susceptible animals against foot-and-mouth disease virus isolates of the presented genotype, which in recent years have caused outbreaks of the disease in African and Asian countries.

The essence of the invention is reflected in graphic images:

Fig. 1 - Position of the strain “SAT-2/Eritrea/1998” on the phylogenetic tree of foot-and-mouth disease virus serotype SAT-2. The dendrogram is based on a comparison of the complete nucleotide sequences of the 1D gene (VP ₁ protein). The strain is highlighted in red and labeled "SAT-2/Eritrea/1998".

The essence of the invention is illustrated by the following sequence lists:

SEQ ID NO: 1 represents the nucleotide sequence of the VP ₁ protein gene of the strain “SAT-2/Eritrea/1998” of the foot-and-mouth disease virus genotype SAT-2/VII;

SEQ ID NO: 2 represents the amino acid sequence of the VP ₁ protein gene of the strain “SAT-2/Eritrea/1998” of the foot and mouth disease virus genotype SAT-2/VII.

The foot and mouth disease virus strain “SAT-2/Eritrea/1998” is characterized by the following characteristics and properties.

Morphological characteristics

Strain “SAT-2/Eritrea/1998” of foot-and-mouth disease virus serotype SAT-2 belongs to the order Picornavirales, family Picornaviridae, genus Aphthovirus, species Foot-and-Mouth Disease Virus and has morphological characteristics characteristic of the causative agent of foot-and-mouth disease: the shape of the virion is ixahedral, the size 21 nm. A virion consists of a single-stranded, positive-sense RNA molecule enclosed in a protein shell.

Antigenic properties

According to antigenic properties, the strain “SAT-2/Eritrea/1998” of the foot-and-mouth disease virus belongs to the SAT-2 serotype. The virus is stably neutralized by homologous antiserum and does not exhibit hemagglutinating activity. In recovered animals, type-specific antibodies are formed in the blood serum, which are detected in enzyme-linked immunosorbent assay (ELISA) and microneutralization reaction (RMN).

Using the nucleotide sequencing method, the primary structure of the ID gene of the VP ₁ protein of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” was determined. Comparative analysis of nucleotide sequences showed that the strain “SAT-2/Eritrea/1998” of the foot-and-mouth disease virus belongs to the genotype SAT-2/VII.

The antigenic affinity (r ₁ ) of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” was studied in a microneutralization reaction (RMN) in a cross-study of the strain with specific sera obtained for the following production strains of the foot-and-mouth disease virus: “SAT-2/ZIM/14/ 2002", "SAT-2/ZIM/5/81", "SAT-2/BOT/P3/98", "SAT-2/ETH/l/90", "SAT-2/GHA/2/90" , "SAT-2/GAM/8/79", "SAT-2/SAU/6/2000", "SAT-2/RWO/l/00", "SAT-2/KEN/2/84", "SAT-2/UGA/19/98","SAT-2/ANG/4/74","SAT-2/UGA/51/75","SAT-2/ETH/2/2007","SAT-2/ETH/2/91". The titer of reference cattle blood sera obtained by immunizing animals with monovalent vaccines from industrial strains of foot-and-mouth disease virus serotype SAT-2 against 10 ² TCD ₅₀ of homologous and heterologous virus was determined in the RMN with cross-titration, calculating values using a linear regression equation, and expressed in lg . The r ₁ value was determined as the antilogarithm of the difference in serum lg titers against heterologous and homologous viruses [17-20].

The value of r ₁ in the RMN was interpreted as follows:

at ≥0.3 - the studied and production strains of foot-and-mouth disease virus are closely related;

at <0.3 - the studied sample of the foot-and-mouth disease virus strain differs significantly from the production strain.

Indicators of antigenic relatedness when studying the strain “SAT-2/Eritrea/1998” amounted to r ₁ from 0.01 to 0.20, namely for the strain “SAT-2/ZIM/14/2002” (genotype SAT-2/I) - 0.05, for “SAT-2/ZIM/5/81” (genotype SAT-2/II) - 0.07, for “SAT-2/BOT/P3/98” (genotype SAT-2/III) - 0.06, for “SAT-2/ETH/1/90” (genotype SAT-2/IV) - 0.01, for “SAT-2/GHA/2/90” (genotype SAT-2/V) - 0.09, for “SAT-2/GAM/8/79” (genotype SAT-2/VI) - 0.08, for “SAT-2/SAU/6/2000” (genotype SAT-2/VII) - 0.20, for “SAT-2/RWO/l/00” (genotype SAT-2/VIII) - 0.17, for “SAT-2/KEN/2/84” (genotype SAT-2/IX) - 0.11, for “SAT-2/UGA/19/98” (genotype SAT-2/X) - 0.13, for “SAT-2/ANG/4/74” (genotype SAT-2/XI) - 0.11, for “SAT-2/UGA/51/75” (genotype SAT-2/XII) - 0.12, for “SAT-2/ETH/2/2007” (genotype SAT-2/XIII) - 0.19, for “SAT-2/ETH/2/9”1 (genotype SAT-2/XIV) - 0.18.

The data obtained indicate the absence of antigenic relationship with production strains of foot-and-mouth disease virus serotype SAT-2. The microneutralization reaction is a sensitive system, however, the antigenic affinity of the strain “SAT-2/Eritrea/1998” with the strain “SAT-2/SAU/6/2000” (genotype SAT-2/VII) was 0.2, with ≥0 ,3 - the research and production strains of foot-and-mouth disease virus are closely related. This indicates an internal change, a genetic mutation of the “SAT-2/Eritrea/1998” strain.

Geno- and chemotaxonomic characteristics

The foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” is an RNA(+)-containing virus with a molecular weight of 8.08×10 ⁶ D. The nucleic acid is represented by a single-chain linear molecule with a molecular weight of 2.8×10 ⁶ D. The virion has a protein shell, consisting of four main proteins VP ₁ , VP ₂ , VP ₃ and VP ₄ . The lipoprotein membrane is absent.

The main antigenic protein is VP ₁ . The virion contains approximately 31.5% RNA and 68.5% protein. Viral RNA is infectious and is involved in the formation of precursor proteins in infected cells. The precursors, in turn, are cleaved to form more stable structural and nonstructural polypeptides of the virus. From 8 non-structural polypeptides that accumulate in infected cells, an RNA-dependent RNA polymerase (3D gene) is isolated, which is involved in RNA replication for the assembly of virions. Physical properties

The mass of the virion is 8.4×10 ^-18 g. The buoyant density is 1.42 g/cm ³ .

Resistance to external factors

Strain "SAT-2/Eritrea/1998" of foot and mouth disease virus is resistant to detergents and organic solvents such as ether, chloroform, freon, acetone. Most stable at pH 7.45-7.65. Shifts in pH both to the acidic and alkaline sides lead to inactivation of the virus. Sensitive to formaldehyde

UV irradiation, γ-irradiation, high temperatures (above 38.0°C).

Additional characteristics and properties

Reactogenicity - does not have reactogenic properties.

Pathogenicity - pathogenic for artiodactyl animals.

Virulence - virulent for naturally susceptible animals during contact, aerosol and parenteral infection.

Stability - retains the original biological properties when passaging in sensitive biological systems for 5 passages (observation period) on continuous crops.

Biotechnological characteristics

The foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” is reproduced in continuous cell cultures: Siberian mountain ibex kidneys (PSGK-30), pig kidneys (IB-RS-2), Syrian hamster kidneys (VNK-21).

During the test, 5 consecutive passages of the foot and mouth disease virus strain “SAT-2/Eritrea/1998” were carried out in continuous cell cultures PSGK-30, BNK-21, IB-RS-2. Biological properties were characterized by determining the infectious activity of the virus of each passage in the continuous cell line IB-RS-2 and in naturally susceptible animals - cattle (cattle) and pigs.

To reduce the epizootic risk of foot and mouth disease caused by the SAT-2/VII genotype and prevent the emergence of new foci of the disease, timely vaccine prevention is important, which requires the development of a new highly immunogenic and effective vaccine.

A highly immunogenic and effective vaccine against foot and mouth disease genotype SAT-2/VII was obtained from the strain “SAT-2/Eritrea/1998”, culture inactivated sorbed.

The essence of the proposed invention is illustrated by examples of its use, which do not limit the scope of the invention.

Example 1. Genetic characteristics of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” according to PCR and nucleotide sequencing data.

The studies carried out consisted of studying the primary structure of the 1D gene (VP ₁ protein) (648 nt) of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” by nucleotide sequencing using the Sanger method and determining the position of this strain on the phylogenetic tree of the foot-and-mouth disease virus serotype SAT -2. The method is based on determining the primary structure of the 1D gene (VP ₁ protein) of the tested isolate/strain, followed by analysis of phylogenetic relationship with other isolates of foot-and-mouth disease virus serotype SAT-2. A comparative analysis of the nucleotide sequences of the 1D gene encoding the VP ₁ protein of the foot-and-mouth disease virus vaccine strain “SAT-2/Eritrea/1998” was carried out with other isolates and strains. The nucleotide sequence of the VP ₁ protein gene of the strain “SAT-2/Eritrea/1998” of the genotype SAT-2/VII of the foot-and-mouth disease virus is presented by SEQ ID NO: 1. The amino acid sequence of the 1D gene encoding the VP ₁ protein of the strain “SAT-2/Eritrea/1998” "FMD virus genotype SAT-2/VII is reflected in SEQ ID NO: 2.

A phylogenetic analysis of the strain “SAT-2/Eritrea/1998” was carried out. The phylogenetic tree was derived using the MEGA6 program and the Neighbor-Joining algorithm [21]. The percentage of replicate branches in which related taxa cluster together in a bootstrap test (300 replicates) is shown next to the branches [22, 23]. Evolutionary distances were calculated using the Maximum Composite Likelihood method [24] and expressed in units of the number of base substitutions per site. This analysis included 16 nucleotide sequences, including the sequence of the 1D gene of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998”. All items containing spaces and missing data were removed (complete deletion option). There were a total of 648 items in the final data set. Evolutionary analysis was carried out in MEGA 6 [24].

As a result of the work carried out by comparing the complete nucleotide sequences of the 1D gene (VP ₁ protein) of the strain “SAT-2/Eritrea/1998” and other isolates/strains of foot-and-mouth disease virus serotype SAT-2, the position of the studied strain on the phylogenetic tree was determined (Fig. 1).

Based on the results of the entire analysis, it was concluded that the studied strain “SAT-2/Eritrea/1998” belongs to the SAT-2 serotype, topotype VII, which is confirmed by the data of nucleotide and amino acid analysis.

Example 2. Adaptation of the strain “SAT-2/Eritrea/1998” to a continuous monolayer culture of kidney cells of the Siberian mountain ibex PSGK-30.

To infect a continuous monolayer culture of Siberian mountain ibex kidney cells PSGK-30, a 10% aphthous suspension of foot-and-mouth disease virus obtained from bovine aphthae (passage 2) was used. The inoculating cell concentration was 0.15-0.20 million cells/cm ³ , the virus infection dose was 0.01 TCD ₅₀ /cell. According to the results of the study, the reproduction of the foot-and-mouth disease virus strain "SAT-2/Eritrea/1998" took place with a specific destruction of the monolayer by 90-100% in 24 hours. Over the course of 6 consecutive passages, an increase in the titer of infectious activity of the virus was noted from 5.75±0.10 up to 7.25±0.10 lg TCD ₅₀ /cm ³ .

The maximum titer of infectious activity of the virus was achieved at stage 6 of passage (7.25±0.10 lg TCD ₅₀ /cm ³ ). The concentration of 146S particles from passages 1 to 6 changed from 0.28±0.01 to 0.66±0.01 μg/ ^cm3 . In this case, the largest amount of the 146S component was noted at stage 6 of passage (0.66±0.01 μg/cm ³ ). The degree of reliability (R ² ) of the study results in the quantitative version of RT-PCR-RT ranged from 96.36 to 99.74%. Thus, over the course of 6 consecutive passages, the adaptation of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” to the continuous monolayer cell line PSGK-30 was successfully carried out.

Example 3. Study of conditions for monolayer cultivation of foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” on an industrial scale.

In the process of industrial cultivation of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” in a continuous monolayer cell culture PSGK-30, the optimal conditions for cultivating the virus were selected, analyzing the different composition of the supporting medium, the temperature factor and the dose of cell infection (n=5).

At the first stage of the study, the effect of the composition of the supporting medium on the reproduction of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” in a monolayer culture of PSGK-30 cells was assessed on a production scale (at the stage from the 5th to the 6th passages). For comparison, three media were used with the addition of 2.5% fetal calf serum: 1) Eagle's medium DMEM; 2) RPMI-1640 environment; 3) Hanks solution with 5.0% blood protein hydrolyzate. The inoculating cell concentration was 0.15-0.20 million cells/cm ³ , the dose of virus infection was 0.1000-0.0001 TCD ₅₀ /cell. Cultivation of the virus was carried out at temperatures of 35±0.2 - 38±0.2°C until the cell monolayer was destroyed by 90-100% within 24-38 hours. Results of reproduction of the foot-and-mouth disease virus strain "SAT-2/Eritrea/1998" with supporting media of different compositions are shown in Table 1.

From the data in Table 1 it is clear that when reproducing the strain “SAT-2/Eritrea/1998” of the foot-and-mouth disease virus in a monolayer culture of PSGK-30 cells using supporting media of different compositions, the optimal medium is “Hank’s solution with 5% blood protein hydrolysate and 2, 5% fetal cattle blood serum”, which makes it possible to achieve specific destruction of the cell monolayer by 95-100% within 24 hours with the accumulation of the 146S component in the resulting suspension in an amount of 0.66±0.01 μg/cm ³ and a titer of infectious activity of 7.25± 0.10 lg TCD ₅₀ / cm ³ . When using the RPMI-1640 and Igla DMEM + 2.5% S _KPC medium, the virus reproduction rates were lower.

At the next stage of studying the conditions for monolayer cultivation of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” in the PSGK-30 cell culture under production conditions, the influence of the temperature factor on the virus reproduction process was assessed. For this purpose, the virus was cultivated in the medium “Hank’s solution with 5% hydrolyzed blood proteins and 2.5% fetal bovine serum” at the following temperatures: 35.0±0.2; 36.0±0.2; 37.0±0.2; 38.0±0.2°C. The dose of infection of the cell culture with the foot-and-mouth disease virus was 0.010-0.001 TCD ₅₀ /cell. The virus was cultivated until the cell monolayer was destroyed by 80-100% within 24-38 hours (Table 1). Based on the results of the study, it was revealed that for complete reproduction of the strain “SAT-2/Eritrea/1998” of the foot-and-mouth disease virus in a monolayer culture of PSGK-30 cells, the optimal temperature of the environment is 37.0 ± 0.02 ° C, at which within 24 hours the development of CPP reached 95-100% with an accumulation of 146S particles equal to 0.66±0.01 μg/cm ³ and a titer of infectious activity of the virus of 7.25±0.10 lg TCD ₅₀ /cm ³ .

The influence of the dose of infection of a monolayer of PSGK-30 cells with the strain “SAT-2/Eritrea/1998” during cultivation on a production scale was assessed. For this, different doses of the virus were used: 0.10-0.01; 0.010-0.001; 0.0010-0.0001 TCD ₅₀ /cl. Hanks solution with 5% blood protein hydrolyzate and 2.5% fetal bovine serum was used as a supporting medium. Virus reproduction was carried out at a temperature of 37.0±0.2°C for 24 hours until specific cell destruction was 90-100%. Based on the results of cultivation, the concentration of the 146S component and the titer of infectious activity of the foot-and-mouth disease virus were determined. As follows from the data in Table 1, the greatest accumulation of “full” virus particles was achieved at an infection dose of 0.01-0.001 TCD ₅₀ /cell. and amounted to 0.66±0.01 μg/cm ³ with a titer of infectious activity of the virus of 7.25±0.10 lg TCD ₅₀ /cm ³ .

Thus, the conditions for monolayer cultivation of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” in PSGK-30 cell culture on an industrial scale were studied. As a result of the study, the following optimal parameters for the reproduction of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” in the monolayer cell line PSGK-30 were determined:

1) maintenance medium - medium “Hank’s solution with 5% hydrolyzed blood proteins and 2.5% fetal cattle serum”;

2) cultivation temperature - 37.0±0.02°C;

3) dose of virus infection - 0.01-0.001 TCD ₅₀ / cell.

Example 4. Study of conditions for suspension cultivation of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” on an industrial scale.

When industrially cultivating the strain “SAT-2/Eritrea/1998” of the foot-and-mouth disease virus in a continuous suspension culture of BHK-21/SUSP/ARRIAH cells, the search for optimal parameters for the successful reproduction of the foot-and-mouth disease pathogen was carried out, using different cell concentrations, temperatures and doses of infection.

At the first stage of the work, the effect of the seeding concentration of BHK-21/SUSP/ARRIAH cells in suspension on the reproduction of the “SAT-2/Eritrea/1998” strain of foot-and-mouth disease virus on an industrial scale was determined. Suspensions with the following cell concentrations were prepared for analysis: 2.5; 3.0; 3.5; 4.0 million cells/ ^cm3 . The pH value was maintained in the range of 7.45-7.65. The virus cultivation temperature was 37.0±0.02°C, the dose of virus infection was 0.010-0.001 TCD ₅₀ /cell. Virus reproduction was carried out until specific cell death was 95-100%, which was carried out within 13-16 hours. The results of suspension cultivation of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” in suspension with different cell concentrations are presented in Table 2.

As follows from Table 2, when cultivating the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” in the suspension cell line BNK-21/SUSP/ARRIAH with different cell concentrations, it was determined that the accumulation of the 146S component in a suspension with a cell concentration of 2.5 million cells/cm ³ was 0.75±0.03 μg/cm ³ , with a concentration of 3.0 million cells/cm ³ - 1.10±0.03 μg/cm ³ , with a concentration of 3.5 million cells ./cm ³ - 1.49±0.03 μg/cm ³ , and with a concentration of 4.0 million cells/cm ³ - 1.15±0.03 μg/cm ³ . As follows from the data obtained, for the reproduction of the strain “SAT-2/Eritrea/1998” of the foot-and-mouth disease virus, the concentration of BHK-21/SUSP/ARRIAH cells in suspension equal to 3.5 million cells is optimal and sufficient from the point of view of results and economic feasibility. cm ³ . The titer of infectious activity of the virus was 8.75±0.10 lg TCD ₅₀ /cm ³ .

At the next stage of the work, we studied the effect of temperature on the suspension cultivation of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” in a cell culture of the BHK-21/SUSP/ARRIAH line on an industrial scale. For this purpose, virus reproduction was carried out under the following temperature conditions: 35.0±0.2; 36.0±0.2; 37.0±0.2; 38.0±0.2°C. The dose of infection of the cell culture with the virus was 0.010-0.001 TCD ₅₀ /cell. The pH value of the viral suspension was maintained in the range of 7.45-7.65. Cultivation of the virus was carried out to a CPE of 90-100% for 14-32 hours. Based on the results of the analysis, it was determined that for complete reproduction of the strain “SAT-2/Eritrea/1998” of the foot-and-mouth disease virus in a suspension cell culture BHK-21/SUSP/ ARRIAH the optimal environmental temperature is 37.0±0.02°C, at which 95-100% specific cell death is observed within 14-15 hours with a high accumulation of the 146S component (1.49±0.03 μg/cm ³ ) and the titer of infectious activity of the virus is 8.75±0.10 lg TCD ₅₀ /cm ³ .

In the course of work to study the conditions for suspension cultivation of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” on an industrial scale using cell culture BHK-21/SUSP/ARRIAH, the effect of the dose of cell infection was assessed. To do this, cell suspensions were infected with the virus in different doses: 0.10-0.01; 0.01-0.001; 0.001-0.0001 TCD ₅₀ /cl. Virus reproduction was carried out at a temperature of 37.0±0.2°C for 14-20 hours until the cytopathic effect was 90-95%. Based on the results of cultivation, the concentration of 146S particles and the titer of infectious activity of the foot-and-mouth disease virus were determined. As can be seen from the data in Table 2, the greatest accumulation of the 146S component was observed at an infection dose of 0.010-0.001 TCD ₅₀ /CL. (1.49±0.03 μg/cm ³ ) with a titer of infectious activity of the virus equal to 8.75±0.10 lg TCD ₅₀ /cm ³ .

Thus, the parameters of suspension cultivation of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” in the suspension cell line BHK-21/SUSP/ARRIAH on an industrial scale were studied. The optimal conditions for the reproduction of the strain “SAT-2/Eritrea/1998” in the suspension culture of BNK-21 cells were identified: 1) cell concentration before infection - 3.5 million cells/cm ³ ; 2) cultivation temperature - 37.0±0.02°C; 3) dose of virus infection - 0.010-0.001 TCD ₅₀ / cell.

Example 5. Inactivation of a suspension of foot and mouth disease virus strain “SAT-2/Eritrea/1998”.

At the end of the reproduction cycle of the foot-and-mouth disease virus, without stopping the thermostatting process (37.0±0.02°C), an acidified solution of aminoethylethylenimine (AEEI) with a pH of 8.2-8.6 was added to the virus-containing suspension. The final concentration of AEEI in the virus-containing suspension should be equal to 0.023%. Inactivation of the infectious activity of the foot and mouth disease virus strain “SAT-2/Eritrea/1998” was carried out for 12 hours at a temperature of 37.0±0.1°C and pH 7.45-7.65 with stirring.

To determine the time of complete inactivation after adding AEEI, samples were taken every hour. The obtained samples were tested for the presence of infectious activity of the foot-and-mouth disease virus in the primary culture of pig kidney cells SP. The results are presented in Table 3.

As can be seen from Table 3, complete inactivation of the infectious activity of the cultured foot-and-mouth disease virus strain “SAT-2/Eritrea/1998”, reproduced in cultivators, occurred 6 hours after the addition of the inactivant.

The finished inactivated viral suspensions were tested in a complement fixation reaction to assess the content of viral components in them. The concentration of the 146S component was 1.45±0.03 μg/cm ³ , and the 146S+75S component was 1.98±0.03 μg/cm ³ .

Example 6. Selection of conditions for purification of a suspension of foot-and-mouth disease virus strain “SAT-2/Eritrea/1998”.

A suspension of foot-and-mouth disease virus strain "SAT-2/Eritrea/1998", obtained by reproduction in the suspension cell line BHK-21/SUSP/ARRIAH, is subjected to inactivation and purification. To obtain purified foot-and-mouth disease virus antigen, polyhexamethylene guanidine (PHMG) was used with concentrations of 0.012, 0.016 and 0.020%. Before and after the process of purifying the antigen of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998”, the concentration of the total viral protein and immunogenic components was determined in a quantitative version of the complement fixation reaction. The results of the analysis are shown in Table 4.

As follows from the data in Table 4, as a result of purification of the antigen of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” using PHMG at a concentration of 0.012%, a decrease in the concentration of ballast protein was noted by 13%, and immunogenic components by 1.8%. When using PHMG at a concentration of 0.016%, a decrease in the amount of ballast protein by 39% and the 146S component by 3.1% was observed. Using PHMG at a concentration of 0.020%, the content of ballast protein decreased by 74%, and immunogenic components by 31%. Thus, having studied the conditions for purifying the antigen of the “SAT-2/Eritrea/1998” strain, we came to the conclusion that to obtain a purified product it is optimal to use PHMG with a concentration of 0.016%.

Example 7. Selection of conditions for concentrating a suspension of antigen of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998”.

A cultural inactivated suspension of the strain “SAT-2/Eritrea/1998”, obtained using the suspension cell line BNK-21/SUSP/ARRIAH, was concentrated 9 times by volume. To increase the concentration of immunogenic components of the foot-and-mouth disease virus antigen, the following methods were used: 1) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 4 hours; 2) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 12 hours; 3) concentration with aluminum hydroxide (10% colloidal solution in an amount of 40%, virus antigen - 60% of the total volume).

Before and after the process of concentrating the suspension of the antigen of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998”, the concentration of the total viral protein and immunogenic components in the quantitative version of the RSC was determined. The research results are presented in Table 5.

As follows from the data in Table 5, when concentrating the antigen of the strain “SAT-2/Eritrea/1998” of the foot-and-mouth disease virus using PEG-6000 for 4 hours, an increase in the content of components was noted compared to the initial values (before concentration) by 6.5 times. Using the same polymer, but increasing the exposure time to 12 hours, we increased the concentration of virus components by 7.8 times. Using the sorption method using aluminum hydroxide, it was possible to increase the amount of immunogenic components of the foot-and-mouth disease virus strain “SAT-2/Eritrea/1998” antigen in suspension by 8.9 times (from the theoretical 9 times). Thus, by studying the conditions for concentrating the antigen of the “SAT-2/Eritrea/1998” strain, we came to the conclusion that the optimal way to increase the concentration of foot-and-mouth disease virus components is the sorption method using a colloidal solution of aluminum hydroxide.

Example 8. Selection of adjuvant and antigen-adjuvant ratio.

To produce an anti-foot-and-mouth disease monovalent sorbed vaccine from the antigen of the “SAT-2/Eritrea/1998” strain, aluminum hydroxide in combination with saponin was chosen as an adjuvant. In the preparation of a monovalent sorbed vaccine against foot-and-mouth disease virus, 4.4% aluminum hydroxide was used in terms of dry matter and saponin in an amount of 1.9 mg per dose.

Example 9. The composition of the vaccine against foot and mouth disease genotype SAT-2/VII is culture inactivated sorbed.

From the resulting concentrate of the antigen of the foot-and-mouth disease virus strain "SAT-2/Eritrea/1998" a culture-inactivated sorbed vaccine against foot-and-mouth disease genotype SAT-2/VII was prepared using aluminum hydroxide and saponin as adjuvants. The amount of 146S immunogenic component in 1.0 cm ³ of the finished antigen was 12.55 ± 0.03 μg (Table 5).

Example 10. Immunization of animals with a culture inactivated sorbed vaccine against foot and mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998”.

From the resulting culture-inactivated sorbed vaccine against foot-and-mouth disease genotype SAT-2/VII, a series of dilutions for cattle were prepared in 4-fold increments. 15 heads of cattle were divided into 3 groups of 5 heads each. The immunizing dose was 2.0 cm ³ . The first group of cattle (No. 1-5) was immunized with the vaccine without dilution, the second group of cattle (No. 6-10) was vaccinated with the vaccine diluted 1/4, the third group of cattle (No. 11-15) with the vaccine diluted 1/16 . The drug was administered intramuscularly into the middle third of the neck. As a control for the virus, 2 heads were left without vaccination.

Example 11. Study of blood sera of vaccinated animals for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus.

Blood sera from cattle obtained before immunization of animals, 14 days after the start of testing the vaccine for avirulence and harmlessness, and on the 14th day after immunization, were examined for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus using a blocking version of the enzyme-linked immunosorbent assay (ELISA) in accordance with the recommendations OIE (OIE) [3]. The obtained sera were tested using the ELISA test system “Prio CHECK®FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs” (Prionics Lelystad B.V., the Netherlands). The research results obtained are reflected in Table 6, from which it can be seen that the animal blood sera did not contain antibodies to non-structural proteins of the foot-and-mouth disease virus (PI values for cattle blood sera <50%).

Example 12. Determination of the avirulence and harmlessness of the culture inactivated sorbed vaccine against foot and mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998”.

To determine the avirulence of the vaccine for cattle, a selected sample of the vaccine preparation was injected intradermally at 0.1 cm ³ . The study used cattle weighing 250-300 kg. During 10 days of observation, the animals remained clinically healthy, and the pathological examination did not reveal any changes characteristic of foot-and-mouth disease. These results indicated the absence of virulent properties of the developed vaccine.

The safety of the product in cattle was monitored by intramuscular injection of the vaccine at a dose of 6.0 cm ³ . The observation period was also 10 days. It should be noted that after immunization, the animal’s body temperature can rise to 41.6°C and remain at this level for 1-2 days.

According to the research results, the culture-inactivated sorbed vaccine against foot-and-mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998” was harmless, all animals remained clinically healthy during the observation period, and no tissue necrosis was detected at the site of vaccine administration during the pathological analysis.

Example 13. Study of the immunogenic properties of the vaccine against foot-and-mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998”, a culture-inactivated sorbed vaccine based on the ability to induce virus-neutralizing antibodies in naturally susceptible animals.

On the 21st day after the administration of the vaccine against foot-and-mouth disease genotype SAT-2/VII from the culture-inactivated sorbed strain “SAT-2/Eritrea/1998”, blood was taken from cattle and the resulting blood sera were studied in a microneutralization reaction [3]. It was revealed that in cattle immunized with the vaccine in a whole dose (5 heads), the average antibody titer values were 7.20±0.33 log ₂ SN ₅₀ , with a 1/4 dilution (5 heads) - 4.15±0.14 log ₂ SN ₅₀ , with a dilution of 1/16 (5 heads) - 3.15 ± 0.55 log ₂ SN ₅₀ (Table 7). The data obtained from the microneutralization reaction (RMN) indicate that after administration of the vaccine in its entirety, the formation of humoral immunity with protective titers of strain-specific antibodies (5.5 or more log ₂ SN ₅₀ ) is ensured, which meets the requirements of international standards [3].

Example 14. Study of the protective ability of the vaccine against foot-and-mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998”, culture inactivated, adsorbed by control infection of naturally susceptible animals.

Cattle, immunized in the amount of 15 heads, with the vaccine in whole form and in dilutions, were infected with the control strain “SAT-2/Eritrea/1998” of the genotype SAT-2/VII of the foot-and-mouth disease virus, adapted to these animals in the mucous membrane of the tongue at a dose of 10 ^{4 0} ID ₅₀ /0.20 cm ³ (in two points of 0.10 ± 0.05 cm ³ ). 7 days after infection, all animals were euthanized and a postmortem examination was performed. Animals that had no lesions on their limbs were considered protected from foot and mouth disease. Primary aphthae were not taken into account.

The results of the control infection are presented in Table 7, from which it follows that the vaccine against foot-and-mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998” is culture-inactivated, sorbed in whole form and in a 1/4 dilution, administered in a single dose (2.0 cm ³ ) protects cattle from infection with a homologous strain of all animals (5 out of 5 heads).

The drug inoculated at a 1/16 dilution protected 4 out of 5 animals. Based on the results of the control infection, it was found that the vaccination volume of this vaccine contains 24.25 PD ₅₀ and 0.08 IMD ₅₀ for cattle.

Thus, the above information indicates that the vaccine against foot-and-mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998”, a culturally inactivated sorbed, embodying the proposed invention, is intended for use in agriculture, namely in veterinary virology and biotechnology; the possibility of implementing the presented has been confirmed; vaccine against foot and mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998”, culture inactivated sorbed, has high immunogenic activity and is capable of providing effective protection of susceptible animals against the epizootic strain of foot and mouth disease virus serotype SAT-2 genotype SAT-2/VII, circulating in Africa and Asia.

Sources of information taken into account when compiling a description of the invention for the application for a RF patent for the invention “Vaccine against foot-and-mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998”, culture inactivated sorbed”:

1. Foot and mouth disease. Prevention measures. URL: http://89.rospotrebnadzor.ru /directions/epid_nadzor/146902 (Date of access: 09/03/2022).

2. The danger of foot and mouth disease. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Access date: 08/14/2022).

3. OIE. Manual of diagnostic tests and vaccines for terrestrial animals - 24th Ed. - Paris, 2015-Vol.1, Chapter 2.1.5. - P. 166-169.

4. Burdov A.N., Dudnikov A.I., Malyarets P.V. and others. Foot and mouth disease. - M.: Agropromizdat, 1990. - 320 p.

5. Ponomarev A.P., Uzyumov V.L., Gruzdev K.N. Foot and mouth disease virus: structure, biological and physicochemical properties. - Vladimir: Folio, 2006. - 250 p.

6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.

7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strategies: Proc. Jnt. Symp.2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.

8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J. M. Pachecoa, T. Doel [et.al.] // Vaccine. - December 2005. - V. 23. - P. 5775-5782.

9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M. / Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.

10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.

11. Official website of The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wrlfmd.org/ref_labs/fmd_ref_lab__reports.htm (Date accessed 08/14/2022).

12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - P. 746-754.

13. Rakhmanov AM Current epizootic situation in the world regarding foot and mouth disease and measures for its control // Veterinary Medicine topics Sci. 2013. - pp. 37-38.

14. Longjam N., Tauo T. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol.4(10). - P. 475-479.

15. Doronin M.I. Indirect determination of the titer of the foot-and-mouth disease virus in raw materials for the vaccine using the method of isothermal amplification of viral RNA (NASBA) // Current issues in veterinary biology. - 2022. - No. 2. - pp. 29-37.

16. Melnik R.N., Khaustova N.V., Melnik N.V., Samuylenko A.Ya., Grin S.A., Svyatenko M.S., Litenkova I.Yu. Antigenic variability of foot and mouth disease virus serotype A and justification for the need to obtain new current production strains / Veterinary medicine and feeding. - 2019. - No. 3. - pp. 29-31.

17. Paton D.J., Sumption K.J., Charleston B. Options for control of foot-and-mouth disease: knowledge, capability and policy/ Phil. Trans. R. Soc. In (2009) 364. - P. 2657-2667.

18. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.

19. Methodological recommendations for determining the concentration of 146S, 75S, 12S components of vaccine strains of cultural foot-and-mouth disease virus in the complement fixation reaction (FRR) / Federal State Budgetary Institution "ARRIAH". - Approved 09.21.17.

20. Guidelines for determining antigenic correspondence between epizootic isolates and industrial strains of foot-and-mouth disease virus in a cross-microneutralization reaction: approved. Rosselkhoznadzor 09/13/2017 / FSBI "ARRIAH". - Vladimir: 2017. - 24 p.

21. Saitou N. and Nei M. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4:406–42.

22. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap. Evolution 39:783-791.

23. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101:11030–11035.

24. Kumar S., Stecher G., Li M., Knyaz C., and Tamura K. (2018). MEGA 6: Molecular Evolutionary Genetics Analysis across computing platforms. Molecular Biology and Evolution 35:1547–1549.

--->

<?xml version="1.0" encoding="UTF-8"?>

<!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing

1.3//EN" "ST26SequenceListing_V1_3.dtd">

<ST26SequenceListing dtdVersion="V1_3" fileName="Vaccine FMD SAT-2

VII_1678349295169.xml" softwareName="WIPO Sequence"

softwareVersion="2.1.2" productionDate="2023-03-09">

<ApplicationIdentification>

<IPOfficeCode>RU</IPOfficeCode>

<ApplicationNumberText>0</ApplicationNumberText>

<FilingDate>2023-03-09</FilingDate>

</ApplicationIdentification>

<ApplicantFileReference>492</ApplicantFileReference>

<EarliestPriorityApplicationIdentification>

<IPOfficeCode>RU</IPOfficeCode>

<ApplicationNumberText>0</ApplicationNumberText>

<FilingDate>2023-03-09</FilingDate>

</EarliestPriorityApplicationIdentification>

<ApplicantName languageCode="ru">FSBI "Federal Security Center"

animal health" (FSBI "ARRIAH")</ApplicantName>

<ApplicantNameLatin>FGBI &quot;ARRIAH&quot;</ApplicantNameLatin>

<InventorName languageCode="ru">Doronin Maxim

Igorevich</InventorName>

<InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin>

<InventionTitle languageCode="en">Vaccine against foot and mouth disease genotype

SAT-2/VII from strain “SAT-2/Eritrea/1998” cultured

inactivated sorbed</InventionTitle>

<SequenceTotalQuantity>2</SequenceTotalQuantity>

<SequenceData sequenceIDNumber="1">

<INSDSeq>

<INSDSeq_length>648</INSDSeq_length>

<INSDSeq_moltype>DNA</INSDSeq_moltype>

<INSDSeq_division>PAT</INSDSeq_division>

<INSDSeq_feature-table>

<INSDFeature>

<INSDFeature_key>source</INSDFeature_key>

<INSDFeature_location>1..648</INSDFeature_location>

<INSDFeature_quals>

<INSDQualifier>

<INSDQualifier_name>mol_type</INSDQualifier_name>

<INSDQualifier_value>genomic DNA</INSDQualifier_value>

</INSDQualifier>

<INSDQualifier id="q1">

<INSDQualifier_name>organism</INSDQualifier_name>

<INSDQualifier_value>FMDV</INSDQualifier_value>

</INSDQualifier>

</INSDFeature_quals>

</INSDFeature>

</INSDSeq_feature-table>

<INSDSeq_sequence>accacctcggcgggagaaggcgcggatgtcgtcaccacggacccgtcta

cacacggcgggaacgtgcaagagggccgacgcaagcacactgaagtcgccttccttcttgaccgcagtac

acatgtccacacaaacaaaacatcattcgttgtggacctcatggacacaaagggaaaagcactcgtaggt

gcgatcctgcgggcttccacttactacttttgtgaccttgagattgcatgtgtgggtgaccacactaggg

tcttttggcagcctaacggggcgccgcggactacccaacttggtgacaaccccatggtttacgccaaggg

cggtgtgacccgctttgctatcccgttcacggccccacacaggctgctgtccactgtctacaatggcgag

tgcacctacgcaaaaaccgccaccgccattcgtggagaccgcgcagcactcgcggcgaagtacgctgcca

gcgtgcacactctaccgcaaaccttcaacttcgggttcgtgaccgtcgacaaaccagtcgatgtttacta

ccggatgaagagggctgagttgtactgtccacgcccactgctgccagcctacgaccacgcaagcagagac

agattcgacgcgcccattggcgtcgaaaggcagaccctg</INSDSeq_sequence>

</INSDSeq>

</SequenceData>

<SequenceData sequenceIDNumber="2">

<INSDSeq>

<INSDSeq_length>216</INSDSeq_length>

<INSDSeq_moltype>AA</INSDSeq_moltype>

<INSDSeq_division>PAT</INSDSeq_division>

<INSDSeq_feature-table>

<INSDFeature>

<INSDFeature_key>source</INSDFeature_key>

<INSDFeature_location>1..216</INSDFeature_location>

<INSDFeature_quals>

<INSDQualifier>

<INSDQualifier_name>mol_type</INSDQualifier_name>

<INSDQualifier_value>protein</INSDQualifier_value>

</INSDQualifier>

<INSDQualifier id="q2">

<INSDQualifier_name>organism</INSDQualifier_name>

<INSDQualifier_value>FMDV</INSDQualifier_value>

</INSDQualifier>

</INSDFeature_quals>

</INSDFeature>

</INSDSeq_feature-table>

<INSDSeq_sequence>TTSAGEGADVVTTDPSTHGGNVQEGRRKHTEVAFLLDRSTHVHTNKTSF

VVDLMDTKGKALVGAILRASTYYFCDLEIACVGDHTRVFWQPNGAPRTTQLGDNPMVYAKGGVTRFAIPF

TAPHRLLSTVYNGECTYAKTATAIRGDRAALAAKYAASVHTLPQTFNFGFVTVDKPVDVYYRMKRAELYC

PRPLLPAYDHASRDRFDAPIGVERQTL</INSDSeq_sequence>

</INSDSeq>

</SequenceData>

</ST26SequenceListing>

<---

Claims (3)

1. Vaccine against foot-and-mouth disease genotype SAT-2/VII from the strain “SAT-2/Eritrea/1998” is a culture-inactivated sorbed vaccine containing an active substance and an adjuvant, characterized in that it consists of an active substance in the form of avirulent and purified antigenic material homologous to the pathogen infections of the strain “SAT-2/Eritrea/1998” of genotype SAT-2/VII, deposited in the All-Russian State Collection of Exotic Types of Foot-and-Mouth Disease Virus and other Animal Pathogens (FMDV) of the Federal State Budgetary Institution “ARRIAH”, under registration number: No. 459 - dep / 23- 9 - GKSHM FSBI "ARRIAH", reproduced in the continuous suspension cell line BHK-21/SUSP/ARRIAH, in an amount of at least 3.5 μg; from an aluminum hydroxide adjuvant, a 10% colloidal solution containing 44% by volume, 4.4% in terms of dry matter, saponin in the amount of 1.9 mg, supporting medium - up to 2.0 cm ³ . 2. The vaccine according to claim 1, characterized in that it contains avirulent and purified antigenic material from the SAT-2/Eritrea/1998 genotype SAT-2/VII strain homologous to the infectious agent, obtained in a sensitive biological system and representing a suspension, containing predominantly the 146S immunogenic component of the foot and mouth disease virus serotype SAT-2. 3. The vaccine according to claim 2, characterized in that it contains avirulent and purified antigenic material from the strain “SAT-2/Eritrea/1998” of genotype SAT-2/VII, homologous to the pathogen, obtained in a continuous suspension cell line of the kidney of a newborn Syrian hamster BHK-21/SUSP/ARRIAH and is a suspension containing predominantly the 146S immunogenic component of the foot and mouth disease virus serotype SAT-2.