RU2810131C1 - CULTURE INACTIVATED SORBED VACCINE AGAINST FOOT AND MOUTH DISEASE OF O/ME-SA/PanAsia2ANT-10 GENOTYPE FROM O N2356/PAKISTAN/2018 STRAIN - Google Patents
CULTURE INACTIVATED SORBED VACCINE AGAINST FOOT AND MOUTH DISEASE OF O/ME-SA/PanAsia2ANT-10 GENOTYPE FROM O N2356/PAKISTAN/2018 STRAIN Download PDFInfo
- Publication number
- RU2810131C1 RU2810131C1 RU2023107768A RU2023107768A RU2810131C1 RU 2810131 C1 RU2810131 C1 RU 2810131C1 RU 2023107768 A RU2023107768 A RU 2023107768A RU 2023107768 A RU2023107768 A RU 2023107768A RU 2810131 C1 RU2810131 C1 RU 2810131C1
- Authority
- RU
- Russia
- Prior art keywords
- foot
- mouth disease
- strain
- pakistan
- genotype
- Prior art date
Links
- 241000710198 Foot-and-mouth disease virus Species 0.000 title claims abstract description 202
- 229960005486 vaccine Drugs 0.000 title claims abstract description 86
- 208000007212 Foot-and-Mouth Disease Diseases 0.000 title claims abstract description 70
- 239000000725 suspension Substances 0.000 claims abstract description 44
- 230000002163 immunogen Effects 0.000 claims abstract description 21
- 239000002671 adjuvant Substances 0.000 claims abstract description 15
- 239000001397 quillaja saponaria molina bark Substances 0.000 claims abstract description 15
- 229930182490 saponin Natural products 0.000 claims abstract description 15
- 150000007949 saponins Chemical class 0.000 claims abstract description 15
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 claims abstract description 13
- 210000003734 kidney Anatomy 0.000 claims abstract description 11
- 241000699673 Mesocricetus auratus Species 0.000 claims abstract description 6
- 239000012678 infectious agent Substances 0.000 claims abstract description 4
- 241001465754 Metazoa Species 0.000 claims description 29
- 230000000890 antigenic effect Effects 0.000 claims description 17
- 239000000463 material Substances 0.000 claims description 8
- 239000013543 active substance Substances 0.000 claims description 7
- 231100000676 disease causative agent Toxicity 0.000 claims description 4
- 230000036541 health Effects 0.000 claims description 3
- 244000037640 animal pathogen Species 0.000 claims description 2
- 239000000427 antigen Substances 0.000 abstract description 29
- 102000036639 antigens Human genes 0.000 abstract description 29
- 108091007433 antigens Proteins 0.000 abstract description 29
- 230000000694 effects Effects 0.000 abstract description 5
- 101710140501 Sulfate adenylyltransferase subunit 2 1 Proteins 0.000 abstract description 2
- 102100030100 Sulfate anion transporter 1 Human genes 0.000 abstract description 2
- 101710144481 Sulfate anion transporter 1 Proteins 0.000 abstract description 2
- 239000000126 substance Substances 0.000 abstract 1
- 210000004027 cell Anatomy 0.000 description 57
- 241000700605 Viruses Species 0.000 description 46
- 108090000623 proteins and genes Proteins 0.000 description 30
- 241000283690 Bos taurus Species 0.000 description 22
- 102000004169 proteins and genes Human genes 0.000 description 19
- 239000002609 medium Substances 0.000 description 16
- 201000010099 disease Diseases 0.000 description 14
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 14
- 208000015181 infectious disease Diseases 0.000 description 14
- 230000002458 infectious effect Effects 0.000 description 14
- 238000004519 manufacturing process Methods 0.000 description 11
- 238000000034 method Methods 0.000 description 11
- 238000004113 cell culture Methods 0.000 description 10
- 238000004458 analytical method Methods 0.000 description 9
- 239000002356 single layer Substances 0.000 description 9
- 238000002255 vaccination Methods 0.000 description 9
- 239000002773 nucleotide Substances 0.000 description 8
- 125000003729 nucleotide group Chemical group 0.000 description 8
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 210000004369 blood Anatomy 0.000 description 7
- 239000008280 blood Substances 0.000 description 7
- 230000002068 genetic effect Effects 0.000 description 7
- 230000003053 immunization Effects 0.000 description 7
- 230000002779 inactivation Effects 0.000 description 7
- 239000002245 particle Substances 0.000 description 7
- 230000001717 pathogenic effect Effects 0.000 description 7
- 210000002966 serum Anatomy 0.000 description 7
- 238000002965 ELISA Methods 0.000 description 6
- 238000009825 accumulation Methods 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 238000004264 monolayer culture Methods 0.000 description 6
- 244000052769 pathogen Species 0.000 description 6
- 230000009385 viral infection Effects 0.000 description 6
- 210000002845 virion Anatomy 0.000 description 6
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 5
- 239000002202 Polyethylene glycol Substances 0.000 description 5
- 239000000654 additive Substances 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 238000010790 dilution Methods 0.000 description 5
- 239000012895 dilution Substances 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 239000000203 mixture Substances 0.000 description 5
- 229920001223 polyethylene glycol Polymers 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- 230000002265 prevention Effects 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 230000003612 virological effect Effects 0.000 description 5
- 241001250090 Capra ibex Species 0.000 description 4
- 241000710194 Foot-and-mouth disease virus - type O Species 0.000 description 4
- 238000010835 comparative analysis Methods 0.000 description 4
- 230000006378 damage Effects 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- -1 polyhexamethylene guanidine hydrochloride Polymers 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 238000012163 sequencing technique Methods 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- LSDGFGPIFBOTJI-UHFFFAOYSA-N 2-(aziridin-1-yl)ethanamine Chemical compound NCCN1CC1 LSDGFGPIFBOTJI-UHFFFAOYSA-N 0.000 description 3
- 208000035473 Communicable disease Diseases 0.000 description 3
- 101710172711 Structural protein Proteins 0.000 description 3
- 241000282887 Suidae Species 0.000 description 3
- 108010067390 Viral Proteins Proteins 0.000 description 3
- 125000003275 alpha amino acid group Chemical group 0.000 description 3
- 230000000052 comparative effect Effects 0.000 description 3
- 238000001914 filtration Methods 0.000 description 3
- 230000036039 immunity Effects 0.000 description 3
- 210000003292 kidney cell Anatomy 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- 238000004114 suspension culture Methods 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 230000036642 wellbeing Effects 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 2
- 108010017384 Blood Proteins Proteins 0.000 description 2
- 102000004506 Blood Proteins Human genes 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- MXRIRQGCELJRSN-UHFFFAOYSA-N O.O.O.[Al] Chemical compound O.O.O.[Al] MXRIRQGCELJRSN-UHFFFAOYSA-N 0.000 description 2
- 239000012980 RPMI-1640 medium Substances 0.000 description 2
- 230000006978 adaptation Effects 0.000 description 2
- 230000000996 additive effect Effects 0.000 description 2
- 208000002399 aphthous stomatitis Diseases 0.000 description 2
- 230000000680 avirulence Effects 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 239000013553 cell monolayer Substances 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 239000012535 impurity Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 230000000877 morphologic effect Effects 0.000 description 2
- 230000017074 necrotic cell death Effects 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 238000001179 sorption measurement Methods 0.000 description 2
- 238000003892 spreading Methods 0.000 description 2
- 230000007480 spreading Effects 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 210000000605 viral structure Anatomy 0.000 description 2
- 241000710189 Aphthovirus Species 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 102100031974 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Human genes 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 101000703754 Homo sapiens CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 238000010629 Molecular evolutionary genetics analysis Methods 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241001493546 Suina Species 0.000 description 1
- 101710173681 Sulfate adenylyltransferase subunit 2 2 Proteins 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 230000027645 antigenic variation Effects 0.000 description 1
- 230000037429 base substitution Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 239000012888 bovine serum Substances 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 230000009351 contact transmission Effects 0.000 description 1
- 238000011217 control strategy Methods 0.000 description 1
- 230000000120 cytopathologic effect Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- BTWUORFYKAZQHW-UHFFFAOYSA-L disodium;2-hydroxy-3-[4-[4-[(2-hydroxy-3-sulfonatopropyl)amino]-3-methylphenyl]-2-methylanilino]propane-1-sulfonate Chemical compound [Na+].[Na+].C1=C(NCC(O)CS([O-])(=O)=O)C(C)=CC(C=2C=C(C)C(NCC(O)CS([O-])(=O)=O)=CC=2)=C1 BTWUORFYKAZQHW-UHFFFAOYSA-L 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 230000003067 hemagglutinative effect Effects 0.000 description 1
- 244000144980 herd Species 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 238000013081 phylogenetic analysis Methods 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000011886 postmortem examination Methods 0.000 description 1
- 239000003531 protein hydrolysate Substances 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 230000000601 reactogenic effect Effects 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000004062 sedimentation Methods 0.000 description 1
- 230000000405 serological effect Effects 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 238000012384 transportation and delivery Methods 0.000 description 1
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 1
- 230000017613 viral reproduction Effects 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 229940126581 whole-virion vaccine Drugs 0.000 description 1
Abstract
Description
Изобретение относится к области ветеринарной вирусологии и биотехнологии, а именно к разработке вакцины против ящура генотипа О/ME-SA/PanAsia2ANT-10 из штамма «О №2356/Пакистан/2018» культуральной инактивированной сорбированной.The invention relates to the field of veterinary virology and biotechnology, namely to the development of a culturally inactivated sorbed vaccine against foot and mouth disease genotype O/ME-SA/PanAsia2 ANT-10 from the strain “O No. 2356/Pakistan/2018”.
Ящур представляет собой наиболее контагиозное заболевание млекопитающих и причиняет серьезные экономические потери для многих государств мира. Выделяют семь следующих серотипов вируса ящура: О, А, С, Азия-1 и SAT-1, SAT-2, SAT-3, при этом представители серотипа О является наиболее распространенными, что определяет актуальность изготовления вакцин для защиты от ящура данного серотипа [2].Foot and mouth disease is the most contagious disease of mammals and causes serious economic losses for many countries around the world. There are the following seven serotypes of foot-and-mouth disease virus: O, A, C, Asia-1 and SAT-1, SAT-2, SAT-3, with representatives of serotype O being the most common, which determines the relevance of producing vaccines to protect against foot-and-mouth disease of this serotype [ 2].
Каждый серотип генетически разделен на различные топотипы, а иногда на отдельные генетические линии и даже сублинии. Различия между ними определяют при анализе нуклеотидной последовательности высоковариабельного гена 1D, который кодирует аминокислотную последовательность поверхностного белка VP1 [1]. Учитывая, что возбудитель ящура является РНК-содержащим вирусом, для него характерно образование большого количества мутаций во время репликации вирусного генома (преимущество в 5'-участке) и явление рекомбинации (преимущественно в 3'-участке).Each serotype is genetically divided into different topotypes, and sometimes into separate genetic lineages and even sublineages. The differences between them are determined by analyzing the nucleotide sequence of the highly variable 1D gene, which encodes the amino acid sequence of the surface protein VP 1 [1]. Considering that the causative agent of foot-and-mouth disease is an RNA-containing virus, it is characterized by the formation of a large number of mutations during replication of the viral genome (predominantly in the 5' region) and the phenomenon of recombination (mainly in the 3' region).
Важность знания генетического разнообразия вируса ящура заключается в возможности тщательного анализа эпизоотической ситуации в конкретном регионе и детальном подборе подходящей вакцины, которая должна быть адаптирована именно к интересующему генотипу. Переболевшие одним серотипом животные не имеют иммунной защиты против другого серотипа и даже некоторых других генетических линий [3]. Такие животные долго восстанавливаются, принося экономические потери хозяйству. Даже если животное не проявляет клинических признаков заболевания, оно может являться вирусоносителем, тем самым распространять заболевание в стаде.The importance of knowing the genetic diversity of the foot-and-mouth disease virus lies in the possibility of a thorough analysis of the epizootic situation in a particular region and a detailed selection of a suitable vaccine, which should be adapted specifically to the genotype of interest. Animals that have been ill with one serotype do not have immune protection against another serotype and even some other genetic lines [3]. Such animals take a long time to recover, causing economic losses to the farm. Even if an animal does not show clinical signs of the disease, it can be a virus carrier, thereby spreading the disease in the herd.
Выявление генетических связей между различными изолятами и штаммами проводят с помощью нуклеотидного секвенирования, что дает возможность в условиях вспышки заболевания определить происхождение вируса. Антигенные характеристики вируса, связанные с появлением новых штаммов, важны для анализа вспышек и создания оптимальных вакцин для экстренного применения [4, 6].Identification of genetic relationships between different isolates and strains is carried out using nucleotide sequencing, which makes it possible to determine the origin of the virus during a disease outbreak. Antigenic characteristics of the virus associated with the emergence of new strains are important for analyzing outbreaks and creating optimal vaccines for emergency use [4, 6].
Серотип О вируса ящура разделен на 11 следующих топотипов: EAST AFRICA 1-4 (Восточная Африка) (ЕА-1-4), SOUTHEAST ASIA (Юго-Восточная Азия) (SEA), EUROPE-SOUTH AMERICA (Европа-Южная Америка) (EURO-SA), INDONESIA-1 и 2 (Индонезия-1 и 2) (ISA-1 и -2), CATHAY (Китай), MIDDLE EAST-SOUTH ASIA (ME-SA) (Ближний Восток-Южная Азия) и WEST AFRICA (Западная Африка) (WA). Такое высокое генетическое и антигенное разнообразие приводит к проблемам при специфической профилактике ящура при применении культуральных инактивированных противоящурных вакцин. В результате возникает необходимость создания новых средств специфической иммунопрофилактики в отношении вируса ящура серотипа О [5-11].Foot and mouth disease virus serotype O is divided into the following 11 topotypes: EAST AFRICA 1-4 (EA-1-4), SOUTHEAST ASIA (SEA), EUROPE-SOUTH AMERICA (Europe-South America) ( EURO-SA), INDONESIA-1 and 2 (ISA-1 and 2), CATHAY (China), MIDDLE EAST-SOUTH ASIA (ME-SA) and WEST AFRICA (West Africa) (WA). This high genetic and antigenic diversity leads to problems in the specific prevention of FMD when using culture-inactivated FMD vaccines. As a result, there is a need to create new means of specific immunoprophylaxis against foot-and-mouth disease virus serotype O [5-11].
Данное многообразие представителей серотипа О обусловлено высокой степенью изменчивости РНК-содержащего вируса и активным перемещением данного возбудителя по территории стран Азии.This diversity of representatives of serotype O is due to the high degree of variability of the RNA-containing virus and the active movement of this pathogen throughout the territory of Asian countries.
По причине легкого и быстрого распространения возбудителя ящура данное заболевание может приобретать размах эпизоотий [12]. С целью недопущения возникновения болезни в хозяйствах Российской Федерации применяется комплекс мероприятий по борьбе и профилактике ящура, который направлен на предупреждение заноса вируса в страну, систематическую иммунизацию крупного и мелкого рогатого скота в буферной зоне, а также проведение мониторинга иммунного статуса привитых животных.Due to the easy and rapid spread of the foot-and-mouth disease pathogen, this disease can acquire the scope of an epizootic [12]. In order to prevent the occurrence of the disease, farms in the Russian Federation apply a set of measures to combat and prevent foot-and-mouth disease, which is aimed at preventing the introduction of the virus into the country, systematic immunization of large and small livestock in the buffer zone, as well as monitoring the immune status of vaccinated animals.
Для иммунизации животных должна применяться вакцина, изготовленная из вируса, гомологичного полевым изолятам, что подтверждено исследованиями многих авторов [6, 7, 8, 9, 10, 11].To immunize animals, a vaccine made from a virus homologous to field isolates should be used, which is confirmed by studies of many authors [6, 7, 8, 9, 10, 11].
Возникающие в мире вспышки ящура продолжают оставаться значимой экономической проблемой во всем мире. Наиболее эффективным способом реагирования на вспышки ящура в странах, свободных от болезней, на сегодняшний день - это использование цельновирионных вакцин. [8, 9, 12, 13].Global outbreaks of foot and mouth disease continue to be a significant economic problem worldwide. The most effective way to respond to foot-and-mouth disease outbreaks in disease-free countries today is through the use of whole-virion vaccines. [8, 9, 12, 13].
Для проведения экстренной вакцинации нужно наличие эффективной и безопасной вакцины, содержащей антиген вируса, соответствующий эпизоотическому распространяющемуся изоляту определенного генотипа. Создание подобных вакцин по-прежнему является крайне актуальной задачей. Достижение данной цели позволит применять вакцину в неблагополучных регионах и угрожаемой зоне для формирования иммунитета против конкретного генотипа вируса ящура с целью обеспечения ветеринарного благополучия страны.Emergency vaccination requires the availability of an effective and safe vaccine containing a virus antigen corresponding to the epizootic spreading isolate of a specific genotype. The creation of such vaccines is still an extremely urgent task. Achieving this goal will make it possible to use the vaccine in disadvantaged regions and threatened areas to build immunity against a specific genotype of the foot-and-mouth disease virus in order to ensure the veterinary well-being of the country.
Критерии, определяющие успешное проведение экстренной вакцинации, включают в себя следующие характеристики: 1) содержит антиген вируса ящура с достаточным антигенным родством по отношению к изолятам, циркулирующим в очаге; 2) относится к требуемому виду среди разработанных вакцин; 3) характеризуется приемлемой безвредностью и эффективностью; 4) имеет соответствующий доступ, в том числе объем партий и своевременность их поставок [14].The criteria for successful emergency vaccination include the following characteristics: 1) contains a foot-and-mouth disease virus antigen with sufficient antigenic affinity to isolates circulating in the outbreak; 2) belongs to the required type among the developed vaccines; 3) characterized by acceptable safety and effectiveness; 4) has appropriate access, including the volume of batches and the timeliness of their deliveries [14].
На территории Российской Федерации вспышки ящура имеют спорадический характер и вызваны заносом возбудителя с территории сопредельных стран. Так как отдельные регионы России граничат с эндемичными по ящуру странами на территории Азии и подвержены очень высокой степени риска заноса инфекционного агента с территории данных государств. Усилились торгово-экономические связи со странами Азиатского континента, что создает серьезные риски заноса изолятов данного генотипа на территорию Российской Федерации, и может подорвать ветеринарное благополучие нашей страны по ящуру [15].On the territory of the Russian Federation, outbreaks of foot and mouth disease are sporadic and are caused by the introduction of the pathogen from the territory of neighboring countries. Since certain regions of Russia border on countries endemic for foot-and-mouth disease in Asia and are subject to a very high risk of introducing an infectious agent from the territory of these states. Trade and economic ties with the countries of the Asian continent have increased, which creates serious risks of introducing isolates of this genotype into the territory of the Russian Federation, and can undermine the veterinary well-being of our country regarding foot-and-mouth disease [15].
В Российской Федерации вспышки ящура типа О регистрировались начиная с 2000 по 2021 гг. на территории Приморского, Хабаровского, Забайкальского краев, Амурской, Оренбургской областей, Республики Башкирия. Вспышки болезни были вызваны вирусом ящура типа О и генотипов: O/SEA/Mya-98, O/ME-SA/PanAsia, O/ME-SA/Ind-2001.In the Russian Federation, outbreaks of foot-and-mouth disease type O were recorded from 2000 to 2021. on the territory of Primorsky, Khabarovsk, Transbaikal territories, Amur, Orenburg regions, the Republic of Bashkiria. Outbreaks of the disease were caused by foot and mouth disease virus type O and genotypes: O/SEA/Mya-98, O/ME-SA/PanAsia, O/ME-SA/Ind-2001.
Анализируя вспышки, которые регистрировались на территории Азии, обнаружено, что в Пакистане изоляты вируса ящура генотипа О/ME-SA/PanAsia2ANT-10 были выделены в 2010, 2011, 2012, 2013, 2014, 2015, 2017, 2018, 2019, 2020, 2021 и особенно много в 2022 гг., в Афганистане - в 2010, 2011, 2012, 2014, 2016, 2017, 2018 и 2022 гг., в Бахрейне - в 2011, 2014 и 2022 гг., в Иране - в 2010, 2011, 2012, 2013, 2015, 2017, 2018, 2021, в Ираке - в 2011, 2022 гг., в Израиле - в 2011, 2012 и массового в 2022 гг. Аналогичная ситуация отмечается и в других странах Азии, что не может не настораживать. Это является опасным для нашей страны и требует создания средств диагностики и экстренной специфической профилактики ящура генотипа О/МЕ-SA/PanAsia2ANT-10.Analyzing the outbreaks that were recorded in Asia, it was found that in Pakistan, isolates of the foot and mouth disease virus genotype O/ME-SA/PanAsia2 ANT-10 were isolated in 2010, 2011, 2012, 2013, 2014, 2015, 2017, 2018, 2019, 2020 , 2021 and especially many in 2022, in Afghanistan - in 2010, 2011, 2012, 2014, 2016, 2017, 2018 and 2022, in Bahrain - in 2011, 2014 and 2022, in Iran - in 2010, 2011, 2012, 2013, 2015, 2017, 2018, 2021, in Iraq - in 2011, 2022, in Israel - in 2011, 2012 and massively in 2022. A similar situation is observed in other Asian countries, which cannot but be alarming. This is dangerous for our country and requires the creation of diagnostic tools and emergency specific prevention of foot and mouth disease genotype O/ME-SA/PanAsia2 ANT-10 .
В настоящее время известны штаммы вируса ящура типа О, которые применяются для производства средств диагностики ящура:Currently known strains of foot-and-mouth disease virus type O are used for the production of foot-and-mouth disease diagnostic tools:
- штамм вируса ящура O1 Манисса (генотип O/SEA/Mya-98);- foot and mouth disease virus strain O1 Manissa (genotype O/SEA/Mya-98);
- штамм вируса ящура О №1734/Приморский/2000 (генотип О/МЕ-SA/PanAsia),- foot and mouth disease virus strain O No. 1734/Primorsky/2000 (genotype O/ME-SA/PanAsia),
- штамм вируса ящура О №2147/Приморский/12 (генотип O/ME-SA/PanAsia),- foot and mouth disease virus strain O No. 2147/Primorsky/12 (genotype O/ME-SA/PanAsia),
- штамм вируса ящура О №2212/Приморский/14 (генотип O/SEA/Mya-98),- foot and mouth disease virus strain O No. 2212/Primorsky/14 (genotype O/SEA/Mya-98),
- штамм вируса ящура О №2311/Забайкальский/2016 (генотип O/ME-SA/Ind-2001),- foot and mouth disease virus strain O No. 2311/Zabaikalsky/2016 (genotype O/ME-SA/Ind-2001),
- штамм вируса ящура О №2047/Саудовская Аравия/2008 (генотип O/ME-SA/PanAsia2).- foot and mouth disease virus strain O No. 2047/Saudi Arabia/2008 (genotype O/ME-SA/PanAsia2).
В 2018 г. на территории Исламской Республики Пакистан от крупного рогатого скота с клиническими признаками ящура был отобран патологический материал, который поступил в ФГБУ «ВНИИЗЖ». Изолят вируса ящура «О РК18/12», послуживший источником для получения штамма О №2356/Пакистан/2018, был адаптирован и выделен в культуре клеток IB-RS-2. По результатам сравнительного анализа нуклеотидных последовательностей, выделенный изолят принадлежит к вирусу ящура типа О топотипа ME-SA генетической линии PanAsia2 новой сублинии ANT-10.In 2018, on the territory of the Islamic Republic of Pakistan, pathological material was collected from cattle with clinical signs of foot and mouth disease, which was sent to the Federal State Budgetary Institution "ARRIAH". The foot-and-mouth disease virus isolate “O RK18/12,” which served as the source for obtaining strain O No. 2356/Pakistan/2018, was adapted and isolated in IB-RS-2 cell culture. According to the results of a comparative analysis of nucleotide sequences, the isolated isolate belongs to the foot-and-mouth disease virus type O of the ME-SA topotype of the PanAsia2 genetic line of the new subline ANT-10.
По результатам сравнительного анализа нуклеотидных последовательностей выделенный штамм принадлежит к генотипу О/ME-SA/PanAsia2ANT-10 вируса ящура, который значительно отличается от производственных штаммов вируса ящура серотипа О (Фиг. 1) [16].According to the results of a comparative analysis of nucleotide sequences, the isolated strain belongs to the O/ME-SA/PanAsia2 ANT-10 genotype of foot-and-mouth disease virus, which differs significantly from the production strains of foot-and-mouth disease virus serotype O (Fig. 1) [16].
Учитывая увеличение торгово-экономических взаимоотношений между Россией и странами Азии, в которых стабильно стали регистрировать вспышки ящура генотипа О/ME-SA/PanAsia2ANT-10, возникает опасность возникновения ящура в Российской Федерации и особое значение приобретает проблема возможной экстренной профилактики данного заболевания для формирования иммунитета у восприимчивых животных. Таким образом, возникла необходимость разработать новую вакцину против ящура генотипа О/ME-SA/PanAsia2ANT-10 из штамма «О №2356/Пакистан/2018» культуральную инактивированную сорбированную для обеспечения биологической безопасности и ветеринарного благополучия территории Российской Федерации, сопредельных государств и стран, эндемичных по ящуру, которые будут использовать данный препарат для профилактики этого особо опасного заболевания.Considering the increase in trade and economic relations between Russia and Asian countries, in which outbreaks of foot-and-mouth disease of the O/ME-SA/PanAsia2 ANT-10 genotype began to be steadily recorded, there is a danger of the occurrence of foot-and-mouth disease in the Russian Federation and the problem of possible emergency prevention of this disease for the formation of immunity in susceptible animals. Thus, there was a need to develop a new vaccine against foot and mouth disease genotype O/ME-SA/PanAsia2 ANT-10 from the strain “O No. 2356/Pakistan/2018”, culturally inactivated, sorbed to ensure the biological safety and veterinary well-being of the territory of the Russian Federation, neighboring states and countries , endemic for foot-and-mouth disease, who will use this drug to prevent this particularly dangerous disease.
Наиболее близкой предлагаемому изобретению по совокупности существенных признаков является вакцина инактивированная сорбированная против ящура серотипа О (штамм «О №2047/Саудовская Аравия/2008»), содержащая активное вещество в виде авирулентного и очищенного культурального антигенного материала из гомологичного возбудителю ящура штамма «О №2047/Саудовская Аравия/2008», полученного в чувствительной биологической системе, и целевые добавки в виде гидроксида алюминия и сапонина (адъювант): концентрация антигена (инактивированные 146S+75S компоненты вируса ящура) не менее 3,0 мкг/см3, содержание 10%-ного раствора гидроокиси алюминия - 30% по объему, концентрация сапонина - 1,5 мг/см3, добавка в виде поддерживающей среды - до 1,0 см3 (прототип).The closest to the proposed invention in terms of the totality of essential features is an inactivated sorbed vaccine against foot-and-mouth disease serotype O (strain “O No. 2047/Saudi Arabia/2008”), containing the active substance in the form of avirulent and purified cultural antigenic material from the strain “O No. 2047” homologous to the foot-and-mouth disease pathogen /Saudi Arabia/2008”, obtained in a sensitive biological system, and targeted additives in the form of aluminum hydroxide and saponin (adjuvant): antigen concentration (inactivated 146S+75S components of the foot and mouth disease virus) not less than 3.0 μg/cm 3 , content 10% solution of aluminum hydroxide - 30% by volume, saponin concentration - 1.5 mg/cm 3 , additive in the form of a supporting medium - up to 1.0 cm 3 (prototype).
В качестве чувствительной биологической системы для репродукции вируса ящура используют перевиваемую клеточную линию почки новорожденного сирийского хомячка ВНК-21/2-17, в качестве поддерживающей среды применяют среду Игла MEM без внесения сыворотки, с добавлением ферментативного гидролизата мышц сухого, гидролизата белков крови сухого при рН среды 7,40-7,60.As a sensitive biological system for the reproduction of the foot and mouth disease virus, a continuous cell line of the kidney of a newborn Syrian hamster BNK-21/2-17 is used; as a supporting medium, the Eagle MEM medium is used without adding serum, with the addition of enzymatic hydrolyzate of dry muscle, hydrolyzate of dry blood proteins at pH Wednesdays 7.40-7.60.
Для инактивации вируса используют аминоэтилэтиленимин (АЭЭИ). При изготовлении сорбированной вакцины в качестве адъюванта служит гидроксид алюминия (Al(ОН)3). Очистку вируссодержащей суспензии от балластных примесей осуществляют с применением полигексаметиленгуанидин гидрохлорида (ПГМГ).Aminoethylethylenimine (AEEI) is used to inactivate the virus. When producing a sorbed vaccine, aluminum hydroxide (Al(OH) 3 ) is used as an adjuvant. Purification of the virus-containing suspension from ballast impurities is carried out using polyhexamethylene guanidine hydrochloride (PHMG).
Существенный недостаток вакцины-прототипа состоит в его очень низкой иммуногенной активности относительно штаммов/полевых изолятов вируса ящура генотипа О/ME-SA/PanAsia2ANT-10, циркулирующих в странах Азии.A significant drawback of the prototype vaccine is its very low immunogenic activity against strains/field isolates of foot-and-mouth disease virus genotype O/ME-SA/PanAsia2 ANT-10 circulating in Asian countries.
Для решения этой проблемы было создано настоящее изобретение, в которую входила разработка вакцины против ящура генотипа О/ME-SA/PanAsia2ANT-10 из штамма «О №2356/Пакистан/2018» культуральной инактивированной сорбированной. Данная вакцина предполагает высокое содержание 146S полноценного иммуногенного компонента в дозе препарата.To solve this problem, the present invention was created, which included the development of a culturally inactivated sorbed vaccine against foot and mouth disease genotype O/ME-SA/PanAsia2 ANT-10 from the strain “O No. 2356/Pakistan/2018”. This vaccine assumes a high content of 146S full-fledged immunogenic component in the dose of the drug.
Технический результат от использования предлагаемого изобретения заключается в расширении арсенала инактивированных культуральных сорбированных вакцин для защиты животных против изолятов и штаммов вируса ящура серотипа О и, в частности, генотипа О/ME-SA/PanAsia2ANT-10.The technical result from the use of the proposed invention is to expand the arsenal of inactivated culture-sorbed vaccines to protect animals against isolates and strains of foot-and-mouth disease virus serotype O and, in particular, genotype O/ME-SA/PanAsia2 ANT-10 .
Указанный технический результат достигнут созданием вакцины против ящура генотипа О/ME-SA/PanAsia2ANT-10 из штамма «О №2356/Пакистан/2018» культуральной инактивированной сорбированной, охарактеризованной следующей совокупностью признаков, отраженных ниже.The specified technical result was achieved by creating a vaccine against foot-and-mouth disease genotype O/ME-SA/PanAsia2 ANT-10 from the strain “O No. 2356/Pakistan/2018”, a culture-inactivated sorbed vaccine, characterized by the following set of characteristics reflected below.
Разработанная вакцина в 1,0 см3 препарата содержит следующие основные компоненты: 1) активное вещество в виде авирулентного и очищенного антигенного материала из гомологичного возбудителю инфекции штамма «О №2356/Пакистан/2018» (генотип О/ME-SA/PanAsia2ANT-10) вируса ящура, репродуцированного предпочтительно в перевиваемой суспензионной клеточной линии ВНК-21/SUSP/ARRIAH, в количестве не менее 4,0 мкг; 2) гидроксид алюминия 10%-ный коллоидный раствор с содержанием 47% по объему (4,7% в пересчете на сухое вещество), 3) сапонин в количестве 1,8 мг, 4) поддерживающая среда - до 1,0 см3.The developed vaccine in 1.0 cm 3 of the drug contains the following main components: 1) the active substance in the form of avirulent and purified antigenic material from the strain “O No. 2356/Pakistan/2018” homologous to the infectious agent (genotype O/ME-SA/PanAsia2 ANT- 10 ) foot and mouth disease virus, preferably reproduced in the continuous suspension cell line BHK-21/SUSP/ARRIAH, in an amount of at least 4.0 μg; 2) aluminum hydroxide 10% colloidal solution containing 47% by volume (4.7% in terms of dry matter), 3) saponin in the amount of 1.8 mg, 4) supporting medium - up to 1.0 cm 3 .
Штамм «О №2356/Пакистан/2018», который получен путем адаптации изолята «О РК18/12», депонирован во Всероссийской государственной коллекции экзотических типов вируса ящура и других патогенов животных (ГКШМ) Федерального государственного бюджетного учреждения «Федеральный центр охраны здоровья животных» (ФГБУ «ВНИИЗЖ»), под регистрационным номером: №415 - деп / 22-49 - ГКШМ ФГБУ «ВНИИЗЖ».Strain “O No. 2356/Pakistan/2018”, which was obtained by adapting the isolate “O RK18/12”, was deposited in the All-Russian State Collection of Exotic Types of Foot and Mouth Disease Virus and other Animal Pathogens (FMD) of the Federal State Budgetary Institution “Federal Center for Animal Health Protection” (FGBU "ARRIAH"), under registration number: No. 415 - dep / 22-49 - GKShM FGBU "ARRIAH".
Штамм адаптирован к первично-трипсинизированным монослойным клеткам линии свиной почки (СП) и перевиваемым клеточным линиям из почки новорожденного сирийского хомячка (ВНК-21/SUSP/ARRIAH), почки свиньи (IB-RS-2) и почки сибирского горного козерога (ПСГК-30).The strain is adapted to primary trypsinized monolayer cells of the porcine kidney line (SP) and continuous cell lines from the kidney of a newborn Syrian hamster (BNK-21/SUSP/ARRIAH), pig kidney (IB-RS-2) and Siberian mountain ibex kidney (PSGK- thirty).
Для изготовления вакцины в качестве чувствительной биологической системы предпочтительно используют перевиваемую суспензионную культуру клеток ВНК-21/SUSP/ARRIAH, а в качестве поддерживающей среды применяют среду Игла DMEM без внесения сыворотки, но с добавлением гидролизата белков крови в количестве 7% от общего объема при рН среды 7,46-7,66. Инактивацию вируса проводят с использованием аминоэтилэтиленимина (АЭЭИ) с концентрацией 0,025% от объема вируссодержащей суспензии. Инактивированный вирус очищают от балластных примесей с помощью полигексаметиленгуанидина (ПГМГ), который вносят в суспензию до концентрации 0,015% от общего объема.To produce a vaccine, a continuous suspension culture of BHK-21/SUSP/ARRIAH cells is preferably used as a sensitive biological system, and Eagle's DMEM medium is used as a supporting medium without adding serum, but with the addition of blood protein hydrolyzate in an amount of 7% of the total volume at pH Wednesday 7.46-7.66. Virus inactivation is carried out using aminoethylethylenimine (AEEI) with a concentration of 0.025% of the volume of the virus-containing suspension. The inactivated virus is purified from ballast impurities using polyhexamethylene guanidine (PHMG), which is added to the suspension to a concentration of 0.015% of the total volume.
Авирулентный и очищенный антиген штамма «О №2356/Пакистан/2018» вируса ящура представляет собой суспензию, содержащую инактивированный 146S иммуногенный компонент вируса ящура. Концентрацию компонента в продукте оценивают с помощью количественного варианта реакции связывания комплемента (РСК) [18]. Для создания вакцины используют вирусный материал, содержащий в 1,0 см3 не менее 4,0 мкг инактивированных иммуногенных 146S частиц вируса ящура. Необходимую концентрацию иммуногенного компонента в вакцинном препарате обеспечивают благодаря концентрированию антигена с помощью сорбирования на поверхности коллоидных частиц гидроксида алюминия (Al(ОН)3).The avirulent and purified antigen of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” is a suspension containing the inactivated 146S immunogenic component of the foot-and-mouth disease virus. The concentration of the component in the product is assessed using a quantitative version of the complement fixation reaction (CRR) [18]. To create a vaccine, viral material is used that contains at least 4.0 μg of inactivated immunogenic 146S particles of foot-and-mouth disease virus per 1.0 cm 3 . The required concentration of the immunogenic component in the vaccine preparation is ensured by concentrating the antigen through sorption on the surface of colloidal particles of aluminum hydroxide (Al(OH) 3 ).
Вакцину против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральную инактивированную сорбированную получают путем смешивания очищенного антигена и 10%-ной суспензии гидроксида алюминия в соотношении 53% на 47% по объему, соответственно. Для усиления иммунного ответа используют сапонин в концентрации 1,8 мг/см3. Полученная вакцина представляет собой суспензию, содержащую частицы не растворимого в воде гидроокиси алюминия, несущие на своей поверхности инактивированные вирионы вируса ящура (146S компонент), которые обеспечивают формирование иммунитета.The vaccine against foot-and-mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10, a culture-inactivated sorbed vaccine, is prepared by mixing the purified antigen and a 10% suspension of aluminum hydroxide in a ratio of 53% to 47% by volume , respectively. To enhance the immune response, saponin is used at a concentration of 1.8 mg/cm 3 . The resulting vaccine is a suspension containing particles of water-insoluble aluminum hydroxide, carrying on their surface inactivated virions of the foot-and-mouth disease virus (146S component), which ensure the formation of immunity.
Предлагаемое изобретение включает следующую совокупность существенных признаков, обеспечивающих получение технического результата во всех случаях, на которые спрашивается правовая охрана:The proposed invention includes the following set of essential features that ensure obtaining a technical result in all cases for which legal protection is sought:
1. Вакцина против ящура генотипа О/ME-SA/PanAsia2ANT-10 из штамма «О №2356/Пакистан/2018» культуральная инактивированная сорбированная.1. Vaccine against foot and mouth disease genotype O/ME-SA/PanAsia2 ANT-10 from strain “O No. 2356/Pakistan/2018”, culture inactivated, sorbed.
2. Активное вещество в виде авирулентного и очищенного антигенного материала из гомологичного возбудителю заболевания штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура в эффективном количестве.2. The active substance in the form of avirulent and purified antigenic material from the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 homologous to the causative agent of the disease in an effective amount.
3. Целевые добавки.3. Targeted supplements.
Существенные отличительные признаки предлагаемой вакцины заключаются в том, что в качестве активного вещества она содержит авирулентный очищенный антиген штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура в эффективном количестве.The significant distinctive features of the proposed vaccine are that as an active substance it contains an avirulent purified antigen of the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 of the foot-and-mouth disease virus in an effective amount.
Предлагаемое изобретение характеризуется также другими отличительными признаками, выражающими конкретные формы выполнения или особые условия его использования:The present invention is also characterized by other distinctive features that express specific forms of implementation or special conditions for its use:
1. Авирулентный и очищенный антиген штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура, полученный предпочтительно в суспензионной перевиваемой клеточной линии BHK-21/SUSP/ARRIAH и представляющий собой суспензию, содержащую 146S иммуногенный компонент вируса ящура в эффективном количестве.1. Avirulent and purified antigen of the strain “O No. 2356/Pakistan/2018” of the genotype O/ME-SA/PanAsia2 ANT-10 of the foot-and-mouth disease virus, obtained preferably in the suspension continuous cell line BHK-21/SUSP/ARRIAH and representing a suspension containing 146S immunogenic component of foot and mouth disease virus in an effective amount.
2. Авирулентный и очищенный антиген штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура, полученный предпочтительно в суспензионной перевиваемой культуре клеток BHK-21/SUSP/ARRIAH и представляющий собой суспензию, содержащую преимущественно 146S иммуногенный компонент вируса ящура в количестве не менее 4,0 мкг в 1,0 см3 готового вакцинного препарата.2. Avirulent and purified antigen of the strain “O No. 2356/Pakistan/2018” of the genotype O/ME-SA/PanAsia2 ANT-10 of the foot-and-mouth disease virus, obtained preferably in a suspension continuous cell culture BHK-21/SUSP/ARRIAH and representing a suspension containing predominantly the 146S immunogenic component of the foot and mouth disease virus in an amount of at least 4.0 μg per 1.0 cm 3 of the finished vaccine preparation.
3. Из целевых добавок вакцина содержит адъювант.3. Among the targeted additives, the vaccine contains an adjuvant.
4. Из целевых добавок вакцина содержит адъювант - гидроксид алюминия в комплексе с сапонином.4. Of the targeted additives, the vaccine contains an adjuvant - aluminum hydroxide in combination with saponin.
5. Вакцина содержит адъювант - гидроокись алюминия 4,7% в пересчете на сухой остаток в комплексе с сапонином в концентрации 1,8 мг в 1,0 см3 готового препарата.5. The vaccine contains an adjuvant - aluminum hydroxide 4.7% in terms of dry residue in combination with saponin at a concentration of 1.8 mg per 1.0 cm 3 of the finished product.
6. Авирулентный и очищенный антиген штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура, полученного предпочтительно в перевиваемой суспензионной клеточной линии BHK-21/SUSP/ARRIAH, адъювант - гидроксид алюминия и сапонин, добавка в готовом препарате в виде поддерживающей среды в следующих количествах: Авирулентный и очищенный антиген штамма6. Avirulent and purified antigen of the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 foot-and-mouth disease virus, obtained preferably in the continuous suspension cell line BHK-21/SUSP/ARRIAH, adjuvant - aluminum hydroxide and saponin, an additive in the finished product in the form of a supporting medium in the following quantities: Avirulent and purified strain antigen
Предлагаемая вакцина против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральная инактивированная сорбированная обладает высокой иммуногенной активностью и обеспечивает надежную защиту против изолятов вируса ящура генотипа О/ME-SA/PanAsia2ANT-10, циркулирующих в странах Азии.The proposed vaccine against foot-and-mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10, culture-inactivated, sorbed, has high immunogenic activity and provides reliable protection against foot-and-mouth disease virus isolates genotype O/ME-SA/PanAsia2 ANT -10 circulating in Asian countries.
Достижение технического результата от использования изобретения обеспечивается тем, что в состав предлагаемой противоящурной вакцины в качестве активного вещества введен антиген штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура, обладающий высокой иммуногенной активностью, создающий эффективную защиту восприимчивых животных против изолятов вируса ящура представленного генотипа, которые в последние годы вызывают вспышки заболевания в странах Азии.Achieving a technical result from the use of the invention is ensured by the fact that the antigen of the strain “O No. 2356/Pakistan/2018” of the genotype O/ME-SA/PanAsia2 ANT-10 of the foot-and-mouth disease virus, which has high immunogenic activity, is introduced into the composition of the proposed foot-and-mouth disease vaccine as an active substance, creating effective protection for susceptible animals against foot-and-mouth disease virus isolates of the presented genotype, which in recent years have caused outbreaks of the disease in Asian countries.
Сущность изобретения отражена на графическом изображении:The essence of the invention is reflected in the graphic image:
Фиг. 1. - Дендрограмма, отражающая филогенетическое взаимоотношение штамма «О №2356/Пакистан/2018» вируса ящура с эпизоотическими штаммами серологического типа О. Дендрограмма основана на сравнении полных нуклеотидных последовательностей гена VP1.Fig. 1. - Dendrogram reflecting the phylogenetic relationship of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” with epizootic strains of serological type O. The dendrogram is based on a comparison of the complete nucleotide sequences of the VP 1 gene.
Сущность изобретения пояснена следующими перечнями последовательностей:The essence of the invention is illustrated by the following sequence lists:
SEQ ID NO: 1 представляет последовательность нуклеотидов гена, кодирующего белок VP1 штамма «О №2356/Пакистан/2018» вируса ящура генотипа О/ME-SA/PanAsia2ANT-10;SEQ ID NO: 1 represents the nucleotide sequence of the gene encoding the VP 1 protein of the strain “O No. 2356/Pakistan/2018” of the foot and mouth disease virus genotype O/ME-SA/PanAsia2 ANT-10 ;
SEQ ID NO: 2 представляет последовательность аминокислот белка VP1 штамма «О №2356/Пакистан/2018» вируса ящура генотипа О/ME-SA/PanAsia2ANT-10.SEQ ID NO: 2 represents the amino acid sequence of the VP 1 protein of the strain “O No. 2356/Pakistan/2018” of the foot and mouth disease virus genotype O/ME-SA/PanAsia2 ANT-10 .
Штамм «О №2356/Пакистан/2018» вируса ящура характеризуется следующими признаками и свойствами.The foot and mouth disease virus strain “O No. 2356/Pakistan/2018” is characterized by the following characteristics and properties.
Морфологические признакиMorphological characteristics
Штамм «О №2356/Пакистан/2018» вируса ящура относится к семейству Picornaviridae, роду Aphthovirus, типу О и обладает морфологическими признаками, характерными для возбудителя ящура: форма вириона иксаэдрическая, размер 23-24 нм. Вирион состоит из молекулы РНК, заключенной в белковую оболочку. Белковая оболочка состоит из 32 капсомеров, расположенных в кубической симметрии.Strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus belongs to the family Picornaviridae, genus Aphthovirus, type O and has morphological characteristics characteristic of the causative agent of foot-and-mouth disease: the shape of the virion is ixahedral, size 23-24 nm. A virion consists of an RNA molecule enclosed in a protein shell. The protein shell consists of 32 capsomeres arranged in cubic symmetry.
Антигенные свойстваAntigenic properties
По своим антигенным свойствам штамм «О №2356/Пакистан/2018» вируса ящура относится к генотипу О/ME-SA/PanAsia2ANT-10. Вирус стабильно нейтрализуется гомологичной сывороткой. Вирус не проявляет гемагглютинирующей активности. У переболевших животных в сыворотке крови образуются типоспецифические антитела, выявляемые в иммуноферментном анализе (ИФА) и реакции микронейтрализации (РМН).According to its antigenic properties, the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus belongs to the genotype O/ME-SA/PanAsia2 ANT-10 . The virus is stably neutralized by homologous serum. The virus does not exhibit hemagglutinating activity. In recovered animals, type-specific antibodies are formed in the blood serum, which are detected in enzyme-linked immunosorbent assay (ELISA) and microneutralization reaction (RMN).
Антигенное родство (r1) штамма «О №2356/Пакистан/2018» вируса ящура изучено в его перекрестном исследовании в РМН с референтными, моновалентными сыворотками, полученными на производственные штаммы вируса ящура:The antigenic affinity (r 1 ) of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus was studied in its cross-sectional study at the Russian Medical Sciences with reference, monovalent sera obtained for industrial strains of the foot-and-mouth disease virus:
- штамм вируса ящура «O1 Манисса» (генотип O/SEA/Mya-98);- foot and mouth disease virus strain “O1 Manissa” (genotype O/SEA/Mya-98);
- штамм вируса ящура «О №1734/Приморский/2000» (генотип О/МЕ-SA/PanAsia),- foot and mouth disease virus strain “O No. 1734/Primorsky/2000” (genotype O/ME-SA/PanAsia),
- штамм вируса ящура «О №2147/Приморский/12» (генотип O/ME-SA/PanAsia),- foot and mouth disease virus strain “O No. 2147/Primorsky/12” (genotype O/ME-SA/PanAsia),
- штамм вируса ящура «О №2212/Приморский/14» (генотип O/SEA/Mya-98),- foot and mouth disease virus strain “O No. 2212/Primorsky/14” (genotype O/SEA/Mya-98),
- штамм вируса ящура «О №2311/Забайкальский/2016» (генотип O/ME-SA/Ind-2001),- foot and mouth disease virus strain “O No. 2311/Zabaikalsky/2016” (genotype O/ME-SA/Ind-2001),
- штамм вируса ящура «О №2047/Саудовская Аравия/2008» (генотип О/МЕ-SA/PanAsia2).- foot and mouth disease virus strain “O No. 2047/Saudi Arabia/2008” (genotype O/ME-SA/PanAsia2).
Титр референтных сывороток крови, полученных путем иммунизации КРС моновалентными вакцинами из производственных штаммов вируса ящура типа О, против 102 ТЦД50 гомологичного и гетерологичного вируса определяли в РМН при перекрестном титровании, рассчитывая значения с использованием уравнения линейной регрессии, и выражали в lg. Значение r1 определяли, как антилогарифм разности lg титров сыворотки против гетерологичного и гомологичного вируса ящура [4].The titer of reference blood sera obtained by immunizing cattle with monovalent vaccines from production strains of foot-and-mouth disease virus type O against 10 2 TCD 50 of homologous and heterologous virus was determined in RMN with cross-titration, calculating values using a linear regression equation, and expressed in lg. The r 1 value was determined as the antilogarithm of the difference in serum lg titers against heterologous and homologous foot-and-mouth disease virus [4].
Значение r1 в РМН интерпретировали:The value of r 1 in the RMN was interpreted:
при ≥0,3 - исследуемый и производственный штаммы вируса ящура являются родственными;at ≥0.3 - the studied and production strains of foot-and-mouth disease virus are related;
при <0,3 - исследуемый образец штамма вируса ящура значительно отличается от производственного штамма.at <0.3 - the studied sample of the foot-and-mouth disease virus strain differs significantly from the production strain.
Показатели антигенного родства при изучении штамма «О №2356/Пакистан/2018» составили r1 от 0,14 до 0,26, что свидетельствует об отсутствии антигенного родства штамма «О №2356/Пакистан/2018» в отношении производственных штаммов вируса ящура (таблица 1).Indicators of antigenic relatedness when studying the strain “O No. 2356/Pakistan/2018” amounted to r 1 from 0.14 to 0.26, which indicates the absence of antigenic relatedness of the strain “O No. 2356/Pakistan/2018” in relation to industrial strains of foot-and-mouth disease virus ( Table 1).
Гено- и хемотаксономическая характеристикиGeno- and chemotaxonomic characteristics
Штамм «О №2356/Пакистан/2018» вируса ящура является РНК-содержащим вирусом с положительной цепью с молекулярной массой 8,08×106 Д. Нуклеиновая кислота представлена одноцепочной линейной молекулой молекулярной массой 2,8×106 Д. Вирион имеет белковую оболочку, состоящую из четырех основных белков VP1, VP2, VP3 и VP4. Липопротеидная оболочка отсутствует.Strain “O No. 2356/Pakistan/2018” of foot-and-mouth disease virus is an RNA-containing virus with a positive strand with a molecular weight of 8.08 × 10 6 D. Nucleic acid is represented by a single-chain linear molecule with a molecular weight of 2.8 × 10 6 D. The virion has a protein shell, consisting of four main proteins VP 1 , VP 2 , VP 3 and VP 4 . The lipoprotein membrane is absent.
Основным антигенным белком является VP1. В вирионе содержится приблизительно 31,5% РНК и 68,5% белка. Вирионная РНК является инфекционной и участвует в образовании белков-предшественников в инфицированных клетках. Предшественники, в свою очередь, расщепляются с образованием более стабильных структурных и неструктурных полипептидов вируса. Одним из 8 неструктурных полипептидов, накапливающихся в инфицированных клетках, является фермент РНК-зависимая РНК-полимераза, участвующая в репликации вирусной РНК.The main antigenic protein is VP 1 . The virion contains approximately 31.5% RNA and 68.5% protein. Virion RNA is infectious and is involved in the formation of precursor proteins in infected cells. The precursors, in turn, are cleaved to form more stable structural and nonstructural polypeptides of the virus. One of the 8 non-structural polypeptides that accumulate in infected cells is the enzyme RNA-dependent RNA polymerase, which is involved in the replication of viral RNA.
Методом нуклеотидного секвенирования по Сенгеру была определена первичная структура гена 1D и соответствующего ему белку VP1 штамма «О №2356/Пакистан/2018» вируса ящура. Сравнительный анализ нуклеотидных последовательностей показал, что штамм «О №2356/Пакистан/2018» вируса ящура принадлежит к генотипу О/ME-SA/PanAsia2ANT-10 (Фиг. 1).Using the Sanger nucleotide sequencing method, the primary structure of the 1D gene and the corresponding VP 1 protein of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” was determined. Comparative analysis of nucleotide sequences showed that the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus belongs to the genotype O/ME-SA/PanAsia2 ANT-10 (Fig. 1).
Физические свойстваPhysical properties
Масса вириона составляет 8,4×10-18 г. Коэффициент седиментации полных вирусных частиц - 146S. Плавучая плотность в градиенте сахарозы 1,45 г/см3.The mass of the virion is 8.4×10 -18 g. The sedimentation coefficient of complete viral particles is 146S. The buoyant density in the sucrose gradient is 1.45 g/cm 3 .
Устойчивость к внешним факторамResistance to external factors
Штамм «О №2356/Пакистан/2018» вируса ящура устойчив к детергентам и органическим растворителям, таким как эфир, хлороформ, фреон, ацетон. Наиболее стабилен при рН 7,46-7,66. Сдвиги рН как в кислую, так и в щелочную сторону ведут к инактивации вируса. Штамм чувствителен к формальдегиду, УФ-облучению, γ-облучению, высоким температурам (выше 38°С). Устойчив к низким температурам. Оптимальная температура хранения вируса не выше минус 70°С.Strain “O No. 2356/Pakistan/2018” of foot and mouth disease virus is resistant to detergents and organic solvents such as ether, chloroform, freon, acetone. Most stable at pH 7.46-7.66. Shifts in pH both to the acidic and alkaline sides lead to inactivation of the virus. The strain is sensitive to formaldehyde, UV irradiation, γ-irradiation, and high temperatures (above 38°C). Resistant to low temperatures. The optimal temperature for storing the virus is no higher than minus 70°C.
Дополнительные признаки и свойстваAdditional characteristics and properties
Реактогенность - реактогенными свойствами не обладает.Reactogenicity - does not have reactogenic properties.
Патогенность - патогенен для домашних и диких парнокопытных животных.Pathogenicity - pathogenic for domestic and wild artiodactyl animals.
Вирулентность - вирулентен для естественно-восприимчивых животных при контактном, аэрозольном и парентеральном заражении.Virulence - virulent for naturally susceptible animals during contact, aerosol and parenteral infection.
Стабильность - сохраняет исходные биологические свойства при пассировании в чувствительных биологических системах в течение 5 пассажей (срок наблюдения) на перевиваемых культурах.Stability - retains the original biological properties when passaging in sensitive biological systems for 5 passages (observation period) on continuous crops.
Биотехнологические характеристикиBiotechnological characteristics
Штамм «О №2356/Пакистан/2018» вируса ящура репродуцируется в следующих перевиваемых клеточных линиях: почки сибирского горного козерога (ПСГК-30), почки свиньи (IB-RS-2), почки сирийского хомяка (ВНК-21), почки новорожденного сирийского хомячка (BHK-21/SUSP/ARRIAH).The foot and mouth disease virus strain “O No. 2356/Pakistan/2018” is reproduced in the following continuous cell lines: Siberian mountain ibex kidneys (PSGK-30), pig kidneys (IB-RS-2), Syrian hamster kidneys (VNK-21), newborn kidneys Syrian hamster (BHK-21/SUSP/ARRIAH).
При испытании проведено 5 последовательных пассажей штамма «О №2356/Пакистан/2018» вируса ящура в перевиваемых культурах клеток IB-RS-2, ПСГК-30, ВНК-21. Биологические свойства характеризовали путем определения инфекционной активности возбудителя ящура каждого пассажа в перевиваемой культуре клеток IB-RS-2 и на естественно восприимчивых животных - крупном рогатом скоте (КРС) и свиньях.During the test, 5 consecutive passages of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus were carried out in continuous cell cultures IB-RS-2, PSGK-30, VNK-21. Biological properties were characterized by determining the infectious activity of the foot-and-mouth disease pathogen of each passage in a continuous culture of IB-RS-2 cells and in naturally susceptible animals - cattle (cattle) and pigs.
Для снижения эпизоотической опасности возникновения ящура, вызванного генотипом О/ME-SA/PanAsia2ANT-10, и предотвращения возникновения новых очагов болезни важна своевременная вакцинопрофилактика, что требует разработки новой безопасной и эффективной вакцины.To reduce the epizootic risk of foot and mouth disease caused by the O/ME-SA/PanAsia2 ANT-10 genotype and prevent the emergence of new foci of the disease, timely vaccine prevention is important, which requires the development of a new safe and effective vaccine.
Получена безопасная и эффективная вакцина против ящура генотипа О/ME-SA/PanAsia2ANT-10 из штамма «О №2356/Пакистан/2018» культуральная инактивированная сорбированная.A safe and effective vaccine against foot and mouth disease genotype O/ME-SA/PanAsia2 ANT-10 has been obtained from the strain “O No. 2356/Pakistan/2018”, culture inactivated sorbed.
Сущность предлагаемого изобретения пояснена примерами его использования, которые не ограничивают объем изобретения.The essence of the proposed invention is illustrated by examples of its use, which do not limit the scope of the invention.
Пример 1. Генетическая характеристика штамма «О №2356/Пакистан/2018» вируса ящура по данным ПЦР и нуклеотидного секвенирования.Example 1. Genetic characteristics of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” according to PCR and nucleotide sequencing data.
Проведенные исследования заключались в изучении первичной структуры гена 1D (белок VP1) (639 н.о.) штамма «О №2356/Пакистан/2018» вируса ящура методом нуклеотидного секвенирования методом Сенгера и определении положения данного штамма на филогенетическом древе вируса ящура серотипа О. Метод основан на определении первичной структуры гена 1D (белок VP1) испытуемого изолята/штамма с последующим анализом филогенетического родства с другими изолятами вируса ящура серотипа О.The studies carried out consisted of studying the primary structure of the 1D gene (VP 1 protein) (639 nt) of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” by nucleotide sequencing using the Sanger method and determining the position of this strain on the phylogenetic tree of foot-and-mouth disease virus serotype O The method is based on determining the primary structure of the 1D gene (VP 1 protein) of the tested isolate/strain, followed by analysis of phylogenetic relationship with other isolates of foot-and-mouth disease virus serotype O.
Провели сравнительный анализ нуклеотидных последовательностей гена 1D, кодирующего белок VP1 вируса ящура вакцинного штамма «О №2356/Пакистан/2018» с другими изолятами и штаммами. Последовательность нуклеотидов гена белка VP1 штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура представлена SEQ ID NO: 1. Последовательность аминокислот ID-гена, кодирующего белок VP1 штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура отражена на SEQ ID NO: 2.A comparative analysis of the nucleotide sequences of the 1D gene encoding the VP 1 protein of the foot-and-mouth disease virus vaccine strain “O No. 2356/Pakistan/2018” with other isolates and strains was carried out. The nucleotide sequence of the VP 1 protein gene of the strain “O No. 2356/Pakistan/2018” of the genotype O/ME-SA/PanAsia2 ANT-10 of foot-and-mouth disease virus is presented by SEQ ID NO: 1. The amino acid sequence of the ID gene encoding the VP 1 protein of the strain “O No. 2356/Pakistan/2018" genotype O/ME-SA/PanAsia2 ANT-10 foot and mouth disease virus is reflected in SEQ ID NO: 2.
Провели филогенетический анализ штамма «О №2356/Пакистан/2018». Филогенетическое дерево выведено с использованием программы MEGA6 и алгоритма Neighbor-Joining [20]. Процент повторяющихся ветвей, в которых связанные таксоны сгруппированы вместе в тесте начальной загрузки (увеличили со стандартных 100 до 500 повторов для высокой степени достоверности), показан рядом с ветвями [21, 22]. Эволюционные расстояния были рассчитаны с использованием метода Maximum Composite Likelihood [23] и выражены в единицах количества замен оснований на сайт.Этот анализ включал 28 нуклеотидных последовательностей, в том числе последовательность ID-гена штамма «О №2356/Пакистан/2018» вируса ящура. Все позиции, содержащие пробелы и отсутствующие данные, были удалены (вариант полного удаления). В окончательном наборе данных было всего 639 позиций. Эволюционный анализ проводился в MEGA 6 [24].A phylogenetic analysis of the strain “O No. 2356/Pakistan/2018” was carried out. The phylogenetic tree was derived using the MEGA6 program and the Neighbor-Joining algorithm [20]. The percentage of replicate branches in which related taxa cluster together in the bootstrap test (increased from the standard 100 to 500 replicates for high confidence) is shown next to the branches [21, 22]. Evolutionary distances were calculated using the Maximum Composite Likelihood method [23] and expressed in units of the number of base substitutions per site. This analysis included 28 nucleotide sequences, including the sequence of the ID gene of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018”. All items containing spaces and missing data were removed (complete deletion option). There were a total of 639 items in the final data set. Evolutionary analysis was carried out in MEGA 6 [24].
В результате проведенной работы по сравнению полных нуклеотидных последовательностей гена 1D (белок VP1) штамма «О №2356/Пакистан/2018» и других изолятов/штаммов вируса ящура серотипа О определено положение исследуемого штамма на филогенетическом древе (фиг. 1).As a result of the work carried out by comparing the complete nucleotide sequences of the 1D gene (VP 1 protein) of the strain “O No. 2356/Pakistan/2018” and other isolates/strains of foot-and-mouth disease virus serotype O, the position of the studied strain on the phylogenetic tree was determined (Fig. 1).
Таким образом, исследуемый штамм «О №2356/Пакистан/2018» относится к генотипу О/ME-SA/PanAsia2ANT-10, что подтверждают данные нуклеотидного и аминокислотного анализа.Thus, the studied strain “O No. 2356/Pakistan/2018” belongs to the genotype O/ME-SA/PanAsia2 ANT-10 , which is confirmed by nucleotide and amino acid analysis data.
Пример 2. Адаптация штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 к перевиваемой монослойной культуре клеток почки сибирского горного козерога ПСГК-30.Example 2. Adaptation of the strain “O No. 2356/Pakistan/2018” of genotype O/ME-SA/PanAsia2 ANT-10 to a continuous monolayer culture of Siberian mountain ibex kidney cells PSGK-30.
Для заражения перевиваемой монослойной культуры клеток почки сибирского горного козерога ПСГК-30 использовали 10%-ную афтозную суспензию вируса ящура, полученную из афт КРС (2 пассаж). Посевная концентрация клеток составляла 0,18-0,20 млн кл./см3, доза заражения вирусом - 0,001 ТЦД50/кл. По результатам исследования репродукция вируса ящура штамма «О №2356/Пакистан/2018» проходила при специфическом разрушении монослоя на 90-100% за 12-13 ч. В течение 6 последовательных пассажей отмечали рост значений титра инфекционной активности вируса от 5,65±0,10 до 7,52±0,10 lg ТЦД50/см3.To infect a continuous monolayer culture of Siberian mountain ibex kidney cells PSGK-30, a 10% aphthous suspension of foot-and-mouth disease virus obtained from bovine aphthae (passage 2) was used. The inoculating cell concentration was 0.18-0.20 million cells/cm 3 , the virus infection dose was 0.001 TCD 50 /cell. According to the results of the study, the reproduction of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” took place with a specific destruction of the monolayer by 90-100% in 12-13 hours. Over the course of 6 consecutive passages, an increase in the titer of infectious activity of the virus from 5.65 ± 0 was noted ,10 to 7.52±0.10 lg TCD 50 /cm 3 .
Максимальное значение титра инфекционной активности вируса было достигнуто на этапе 6 пассажа (7,52±0,10 lg ТЦД50/см3). Концентрация 146S частиц с 1-го по 6-й пассажи изменялась с 0,41±0,02 до 1,05±0,04 мкг/см3. При этом наибольшее количество 146S компонента отмечали на этапе 6 пассажа (1,05±0,04 мкг/см3). Степень достоверности (R2) результатов исследования в количественном варианте ОТ-ПЦР-РВ колебалась от 98,69 до 99,97%. Таким образом, на протяжении 6-и последовательных пассажей была успешно проведена адаптация штамма «О №2356/Пакистан/2018» вируса ящура к перевиваемой монослойной клеточной линии ПСГК-30.The maximum titer of infectious activity of the virus was achieved at stage 6 of passage (7.52±0.10 lg TCD 50 /cm 3 ). The concentration of 146S particles from the 1st to the 6th passages changed from 0.41±0.02 to 1.05±0.04 μg/ cm3 . In this case, the largest amount of the 146S component was noted at stage 6 of passage (1.05±0.04 μg/cm 3 ). The degree of reliability (R 2 ) of the study results in the quantitative version of RT-PCR-RT ranged from 98.69 to 99.97%. Thus, over the course of 6 consecutive passages, the adaptation of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” to the continuous monolayer cell line PSGK-30 was successfully carried out.
Пример 3. Изучение условий монослойного культивирования вируса ящура штамма «О №2356/Пакистан/2018» генотипа O/ME-SA/PanAsia2ANT-10 в промышленных масштабах.Example 3. Study of the conditions for monolayer cultivation of foot and mouth disease virus strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 on an industrial scale.
В процессе промышленного культивирования штамма «О №2356/Пакистан/2018» генотипа O/ME-SA/PanAsia2ANT-10 вируса ящура в перевиваемой монослойной культуре клеток ПСГК-30 осуществляли подбор оптимальных условий культивирования вируса по поддерживающей среде, температурному фактору и дозе заражения исследуемым вирусом клеток.In the process of industrial cultivation of the strain “O No. 2356/Pakistan/2018” of the genotype O/ME-SA/PanAsia2 ANT-10 of foot-and-mouth disease virus in a continuous monolayer cell culture PSGK-30, the optimal conditions for cultivating the virus were selected according to the supporting medium, temperature factor and infection dose the cell virus being studied.
На первом этапе исследования оценивали влияние состава поддерживающей среды на репродукцию штамма «О №2356/Пакистан/2018» вируса ящура в монослойной культуре клеток ПСГК-30 в масштабах производства (на этапе с 5-го на 6-ой пассажи). Для сравнения применяли три среды с добавлением 2,0% фетальной сыворотки крови телят: 1) среда Игла DMEM; 2) среда RPMI-1640; 3) раствор Хэнкса. Посевная концентрация клеток составляла 0,18-0,20 млн кл./см3, доза заражения вирусом - 0,1000-0,0001 ТЦД50/кл. Культивирование вируса осуществляли при температурах 35±0,2 - 38±0,2°С до разрушения клеточного монослоя на 95-100% в течение 12-18 ч. Результаты репродукции штамма «О №2356/Пакистан/2018» вируса ящура с поддерживающими средами разного состава отражены в таблице 2.At the first stage of the study, the effect of the composition of the supporting medium on the reproduction of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” in a monolayer cell culture PSGK-30 was assessed on a production scale (at the stage from the 5th to the 6th passage). For comparison, three media were used with the addition of 2.0% fetal calf serum: 1) Eagle's medium DMEM; 2) RPMI-1640 environment; 3) Hanks solution. The seed cell concentration was 0.18-0.20 million cells/cm 3 , the dose of virus infection was 0.1000-0.0001 TCD 50 /cell. Cultivation of the virus was carried out at temperatures of 35±0.2 - 38±0.2°C until the cell monolayer was destroyed by 95-100% within 12-18 hours. Results of reproduction of the foot-and-mouth disease virus strain "O No. 2356/Pakistan/2018" with supporting media of different compositions are shown in Table 2.
Из данных таблицы видно, что при репродукции штамма «О №2356/Пакистан/2018» вируса ящура в монослойной культуре клеток ПСГК-30 с применением поддерживающих сред разного состава, оптимальной является среда Игла DMEM, позволяющая за 12-13 ч достичь специфического разрушения клеточного монослоя на 95-100% с накоплением в полученной суспензии 146S компонента в количестве 1,05±0,04 мкг/см3 и титром инфекционной активности 7,52±0,10 lg ТЦД50/см3. При использовании среды RPMI-1640 и раствора Хэнкса показатели репродукции вируса были ниже.The table data shows that when reproducing the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus in a monolayer culture of PSGK-30 cells using supporting media of different compositions, the optimal medium is Eagle DMEM, which allows achieving specific destruction of the cell within 12-13 hours. monolayer by 95-100% with accumulation of the 146S component in the resulting suspension in an amount of 1.05±0.04 μg/cm 3 and an infectious activity titer of 7.52±0.10 lg TCD 50 /cm 3 . Viral reproduction rates were lower when using RPMI-1640 medium and Hanks' solution.
На следующем этапе изучения условий монослойного культивирования штамма «О №2356/Пакистан/2018» вируса ящура в культуре клеток ПСГК-30 в условиях производства оценивали влияние на процесс репродукции вируса температурного фактора. Для этого культивирование вируса проводили в среде Игла DMEM с 2% сыворотки КРС при следующих температурах: 35,0±0,2; 36,0±0,2; 37,0±0,2; 38,0±0,2°С. Доза заражения культуры клеток вирусом ящура составляла 0,010-0,001 ТЦД50/кл. Культивирование вируса осуществляли до разрушения клеточного монослоя на 80-100% в течение 12-27 ч (таблица 2). По итогам исследования выявили, что для полной репродукции штамма «О №2356/Пакистан/2018» вируса ящура в монослойной культуре клеток ПСГК-30 оптимальной является температура среды 37,0±0,02°С, при которой за 12-13 ч развитие ЦПД достигало 95-100% с накоплением 146S частиц, равным 1,05±0,04 мкг/см3 и титром инфекционной активности вируса 7,52±0,10 lg ТЦД50/см3.At the next stage of studying the conditions for monolayer cultivation of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus in the PSGK-30 cell culture under production conditions, the influence of the temperature factor on the virus reproduction process was assessed. To do this, the virus was cultivated in Eagle's medium DMEM with 2% bovine serum at the following temperatures: 35.0±0.2; 36.0±0.2; 37.0±0.2; 38.0±0.2°C. The dose of infection of the cell culture with the foot-and-mouth disease virus was 0.010-0.001 TCD 50 /cell. The virus was cultivated until the cell monolayer was destroyed by 80-100% within 12-27 hours (Table 2). Based on the results of the study, it was revealed that for complete reproduction of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus in a monolayer culture of PSGK-30 cells, the optimal temperature is 37.0 ± 0.02 ° C, at which the development of The CPE reached 95-100% with the accumulation of 146S particles equal to 1.05±0.04 μg/cm 3 and the titer of infectious activity of the virus 7.52±0.10 lg TCD 50 /cm 3 .
Оценивали влияние дозы заражения монослоя клеток линии ПСГК-30 штаммом «О №2356/Пакистан/2018» при культивировании в масштабах производства. Для этого использовали разные дозы вируса: 0,10-0,01; 0,010-0,001; 0,0010-0,0001 ТЦД50/кл. В качестве поддерживающей среды применяли среду Игла MEM с 2% сыворотки крови КРС. Репродукцию вируса проводили при температуре 37,0±0,2°С в течение 12-27 ч до специфического разрушения клеток на 90-100%. По итогам культивирования определяли концентрацию 146S компонента и титр инфекционной активности вируса ящура. Как следует из данных таблицы 2, наибольшее накопление 146S компонента вируса достигалось при дозе заражения 0,1-0,01 ТЦД50/кл. и составило 1,05±0,04 мкг/см3 с титром инфекционной активности вируса 7,52±0,10 lg ТЦД50/см3.We assessed the effect of the dose of infection of a monolayer of cells of the PSGK-30 line with the strain “O No. 2356/Pakistan/2018” during cultivation on a production scale. For this, different doses of the virus were used: 0.10-0.01; 0.010-0.001; 0.0010-0.0001 TCD 50 /cl. Eagle's MEM medium with 2% cattle blood serum was used as a supporting medium. Virus reproduction was carried out at a temperature of 37.0±0.2°C for 12-27 hours until specific cell destruction was 90-100%. Based on the results of cultivation, the concentration of the 146S component and the titer of infectious activity of the foot-and-mouth disease virus were determined. As follows from the data in Table 2, the greatest accumulation of the 146S component of the virus was achieved at an infection dose of 0.1-0.01 TCD 50 /cell. and amounted to 1.05 ± 0.04 μg/cm 3 with a titer of infectious activity of the virus of 7.52 ± 0.10 lg TCD 50 / cm 3 .
Таким образом, проведено изучение условий монослойного культивирования штамма «О №2356/Пакистан/2018» вируса ящура в культуре клеток ПСГК-30 в промышленных масштабах. В результате исследования определены следующие оптимальные параметры репродукции штамма «О №2356/Пакистан/2018» вируса ящура в монослойной клеточной линии ПСГК-30: 1) поддерживающая среда - среда Игла DMEM; 2) температурный режим культивирования - 37,0±0,02°С; 3) доза заражения вирусом - 0,01-0,001 ТЦД50/кл.Thus, the conditions for monolayer cultivation of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” in PSGK-30 cell culture on an industrial scale were studied. As a result of the study, the following optimal parameters for the reproduction of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus in the monolayer cell line PSGK-30 were determined: 1) maintenance medium - Eagle medium DMEM; 2) cultivation temperature - 37.0±0.02°C; 3) dose of virus infection - 0.01-0.001 TCD 50 / cell.
Пример 4. Изучение условий суспензионного культивирования штамма «О №2356/Пакистан/2018» генотипа O/ME-SA/PanAsia2ANT-10 вируса ящура в промышленных масштабах.Example 4. Study of the conditions for suspension cultivation of the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 foot-and-mouth disease virus on an industrial scale.
При промышленном культивирования штамма «О №2356/Пакистан/2018» генотипа O/ME-SA/PanAsia2ANT-10 вируса ящура в перевиваемой суспензионной культуре клеток ВНК-21/SUSP/ARRIAH проводили поиск оптимальных параметров для успешной репродукции возбудителя ящура, используя разные концентрации клеток, температурные условия и дозу заражения вирусом.During the industrial cultivation of the strain “O No. 2356/Pakistan/2018” of the genotype O/ME-SA/PanAsia2 ANT-10 of the foot-and-mouth disease virus in a continuous suspension cell culture BNK-21/SUSP/ARRIAH, a search was made for optimal parameters for the successful reproduction of the foot-and-mouth disease pathogen, using different cell concentrations, temperature conditions and virus infection dose.
На первом этапе работы определяли влияние посевной концентрации клеток линии ВНК-21/SUSP/ARRIAH в суспензии на репродукцию штамма «О №2356/Пакистан/2018» вируса ящура в промышленных масштабах. Для анализа подготовили суспензии со следующими концентрации клеток: 2,5; 3,0; 3,5; 4,0 млн кл./см3. Водородный показатель рН поддерживали в диапазоне 7,46-7,66. Температура культивирования вируса составляла 37,0±0,02°С, доза заражения вирусом - 0,10-0,01 ТЦД50/кл. Репродукцию вируса проводили до специфической гибели клеток на 95-100%, которая осуществлялась в течение 9-11 ч. Результаты суспензионного культивирования штамма «О №2356/Пакистан/2018» вируса ящура в суспензии с разными концентрациями клеток представлены в таблице 3.At the first stage of the work, the effect of the seed concentration of cells of the BHK-21/SUSP/ARRIAH line in suspension on the reproduction of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus on an industrial scale was determined. Suspensions with the following cell concentrations were prepared for analysis: 2.5; 3.0; 3.5; 4.0 million cells/ cm3 . The pH value was maintained in the range of 7.46-7.66. The virus cultivation temperature was 37.0±0.02°C, the virus infection dose was 0.10-0.01 TCD 50 /cell. Virus reproduction was carried out until specific cell death was 95-100%, which was carried out for 9-11 hours. The results of suspension cultivation of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” in suspension with different cell concentrations are presented in Table 3.
Как следует из таблицы 3, при культивировании вируса ящура штамма «О №2356/Пакистан/2018» в суспензионной клеточной линии ВНК-21/SUSP/ARRIAH с разными концентрациями клеток, определили, что накопление 146S компонента в суспензии с концентрацией клеток 2,5 млн кл./см3 составило 1,41±0,02 мкг/см3, с концентрацией 3,0 млн кл./см3 - 1,79±0,02 мкг/см3, с концентрацией 3,5 млн кл./см3 - 2,02±0,03 мкг/см3, и с концентрацией 4,0 млн кл./см3 - 2,32±0,02 мкг/см3. Как следует из полученных данных для репродукции штамма «О №2356/Пакистан/2018» вируса ящура оптимальной является концентрация клеток ВНК-21/SUSP/ARRIAH в суспензии, равная 4,0 млн кл./см3. Значение титра инфекционной активности вируса при этом составило 10,05±0,10 lg ТЦД50/см3. Большая концентрация клеток позволяла получить такой же выход продукта с небольшим увеличением. С экономической точки зрения, таким образом, для репродукции штамма «О №2356/Пакистан/2018» вируса ящура оптимально использовать суспензию клеток линии ВНК-21/SUSP/ARRIAH с концентрацией 4,0 млн кл./см3.As follows from Table 3, when cultivating the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” in the suspension cell line BNK-21/SUSP/ARRIAH with different cell concentrations, it was determined that the accumulation of the 146S component in the suspension with a cell concentration of 2.5 million cells/cm 3 was 1.41±0.02 μg/cm 3 , with a concentration of 3.0 million cells/cm 3 - 1.79±0.02 μg/cm 3 , with a concentration of 3.5 million cells ./cm 3 - 2.02±0.03 μg/cm 3 , and with a concentration of 4.0 million cells/cm 3 - 2.32±0.02 μg/cm 3 . As follows from the data obtained, for the reproduction of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus, the optimal concentration of BHK-21/SUSP/ARRIAH cells in the suspension is equal to 4.0 million cells/cm 3 . The titer of infectious activity of the virus was 10.05±0.10 lg TCD 50 /cm 3 . A higher concentration of cells made it possible to obtain the same product yield with a slight increase. From an economic point of view, therefore, for the reproduction of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus, it is optimal to use a cell suspension of the BNK-21/SUSP/ARRIAH line with a concentration of 4.0 million cells/cm 3 .
На следующем этапе работы исследовали влияние температурного фактора на репродукцию штамма «О №2356/Пакистан/2018» вируса ящура в суспензионной культуре клеток линии ВНК-21/SUSP/ARRIAH в промышленных масштабах. Для этого репродукцию вируса проводили при следующих температурных условиях: 35,0±0,2; 36,0±0,2; 37,0±0,2; 38,0±0,2°С. Доза заражения культуры клеток вирусом составляла 0,10-0,01 ТЦД50/кл. Водородный показатель рН вирусной суспензии поддерживали в диапазоне 7,46-7,66. Культивирование вируса проводили до ЦПД, равного не менее 80% (приоритет отдавали полной специфической деструкции клеток), в течение 9-22 ч. По результатам анализа определили, что для полной репродукции штамма «О №2356/Пакистан/2018» вируса ящура в суспензионной культуре клеток ВНК-21/SUSP/ARRIAH оптимальной является температура среды 37,0±0,02°С, при которой в течение 9-11 ч наблюдается специфическая гибель клеток на 95-100% с высоким накоплением 146S компонента (2,32±0,02 мкг/см3) и титром инфекционной активности вируса 10,05±0,10 lg ТЦД50/см3.At the next stage of the work, we studied the influence of the temperature factor on the reproduction of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus in a suspension culture of cells of the BNK-21/SUSP/ARRIAH line on an industrial scale. For this purpose, virus reproduction was carried out under the following temperature conditions: 35.0±0.2; 36.0±0.2; 37.0±0.2; 38.0±0.2°C. The dose of infection of the cell culture with the virus was 0.10-0.01 TCD 50 /cell. The pH value of the viral suspension was maintained in the range of 7.46-7.66. Cultivation of the virus was carried out to a CPE of at least 80% (priority was given to complete specific destruction of cells), for 9-22 hours. Based on the results of the analysis, it was determined that for complete reproduction of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus in suspension For the BNK-21/SUSP/ARRIAH cell culture, the optimal temperature is 37.0±0.02°C, at which 95-100% specific cell death is observed within 9-11 hours with a high accumulation of the 146S component (2.32± 0.02 μg/cm 3 ) and the titer of infectious activity of the virus is 10.05 ± 0.10 lg TCD 50 / cm 3 .
В ходе работы по изучению условий суспензионного культивирования штамма «О №2356/Пакистан/2018» вируса ящура в промышленных масштабах с применением культуры клеток ВНК-21/SUSP/ARRIAH оценивали влияние дозы заражения клеток. Для этого клеточные суспензии заражали вирусом в разных дозах: 0,10-0,01; 0,01-0,001; 0,001-0,0001 ТЦД50/кл. Репродукцию вируса осуществляли при температуре 37,0±0,2°С в течение 9-26 ч до цитопатического действия, равного не менее 90%. По итогам культивирования определяли концентрацию 146S частиц и титр инфекционной активности вируса ящура. Как видно из данных таблицы 3, наибольшее накопление 146S компонента отмечали при дозе заражения 0,010-0,001 ТЦД50/кл. (2,32±0,02 мкг/см3) с титром инфекционной активности вируса, равным 10,05±0,10 lg ТЦД50/см3.In the course of work to study the conditions for suspension cultivation of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” on an industrial scale using cell culture BHK-21/SUSP/ARRIAH, the effect of the dose of cell infection was assessed. To do this, cell suspensions were infected with the virus in different doses: 0.10-0.01; 0.01-0.001; 0.001-0.0001 TCD 50 /cl. Virus reproduction was carried out at a temperature of 37.0±0.2°C for 9-26 hours until the cytopathic effect was at least 90%. Based on the results of cultivation, the concentration of 146S particles and the titer of infectious activity of the foot-and-mouth disease virus were determined. As can be seen from the data in Table 3, the greatest accumulation of the 146S component was observed at an infection dose of 0.010-0.001 TCD 50 /cell. (2.32±0.02 μg/cm 3 ) with a titer of infectious activity of the virus equal to 10.05±0.10 lg TCD 50 /cm 3 .
Таким образом, проведено изучение трех параметров суспензионного культивирования штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура в суспензионной клеточной линии ВНК-21/SUSP/ARRIAH в промышленных масштабах. Выявлены оптимальные условия репродукции штамма «О №2356/Пакистан/2018» в суспензионной культуре клеток ВНК-21: 1) концентрация клеток перед заражением - 4,0 млн кл./см3; 2) температурный режим культивирования - 37,0±0,02°С; 3) доза заражения вирусом - 0,010-0,001 ТЦД50/кл.Thus, we studied three parameters of suspension cultivation of the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 foot-and-mouth disease virus in the suspension cell line BNK-21/SUSP/ARRIAH on an industrial scale. The optimal conditions for the reproduction of the strain “O No. 2356/Pakistan/2018” in the suspension culture of BNK-21 cells were identified: 1) cell concentration before infection - 4.0 million cells/cm 3 ; 2) cultivation temperature - 37.0±0.02°C; 3) dose of virus infection - 0.010-0.001 TCD 50 / cell.
Пример 5. Инактивация суспензии вируса ящура штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10.Example 5. Inactivation of a suspension of foot and mouth disease virus strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 .
По окончании цикла репродукции вируса ящура, не прекращая процесс термостатирования (37,0±0,02°С), в вируссодержащую суспензию добавляли подкисленный раствор аминоэтилэтиленимина (АЭЭИ) с рН, равным 8,3-8,4. Конечная концентрация АЭЭИ в вируссодержащей суспензии должна быть равной 0,025%. Инактивацию инфекционной активности вируса ящура штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 проводили в течение 12 часов при температуре 37,0±0,1°С и рН 7,46-7,66 с периодическим перемешиванием.At the end of the reproduction cycle of the foot-and-mouth disease virus, without stopping the thermostatting process (37.0±0.02°C), an acidified solution of aminoethylethylenimine (AEEI) with a pH of 8.3-8.4 was added to the virus-containing suspension. The final concentration of AEEI in the virus-containing suspension should be equal to 0.025%. Inactivation of the infectious activity of the foot and mouth disease virus strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 was carried out for 12 hours at a temperature of 37.0±0.1°C and pH 7.46-7, 66 with periodic stirring.
Для определения времени полной инактивации после добавления 1,2-АЭЭИ каждый час производили отбор проб. Полученные образцы проверяли на наличие инфекционной активности вируса ящура в первичной культуре клеток почки свиньи СП. Результаты представлены в таблице 4, из данных которой видно, что полная инактивация вируса ящура штамма «О №2356/Пакистан/2018», репродуцированного в культиваторах, произошла через 6 часов после внесения 1,2-АЭЭИ.To determine the time of complete inactivation after the addition of 1,2-AEEI, samples were taken every hour. The obtained samples were tested for the presence of infectious activity of the foot-and-mouth disease virus in the primary culture of pig kidney cells SP. The results are presented in Table 4, from which it can be seen that complete inactivation of the foot and mouth disease virus strain “O No. 2356/Pakistan/2018”, reproduced in cultivators, occurred 6 hours after the addition of 1,2-AEEI.
Готовые вирусные инактивированные суспензии исследовали в РСК для оценки содержания в них компонентов вируса. Концентрация 146S компонента составила 2,24±0,02 мкг/см3, a 146S+75S компонента -3,06±0,02 мкг/см3.The prepared inactivated viral suspensions were examined in the RSC to assess the content of virus components in them. The concentration of the 146S component was 2.24±0.02 μg/cm 3 , and the 146S+75S component -3.06±0.02 μg/cm 3 .
Пример 6. Подбор условий очистки суспензии вируса ящура штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10.Example 6. Selection of conditions for the purification of a suspension of foot and mouth disease virus strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 .
Суспензию вируса ящура штамма «О №2356/Пакистан/2018» генотипа O/ME-SA/PanAsia 2ANT-10, полученную при репродукции в суспензионной клеточной линии BHK-21/SUSP/ARRIAH, подвергали инактивации и очистке. Для получения очищенного антигена вируса ящура использовали полигексаметиленгуанидин (ПГМГ) с концентрациями 0,010, 0,015 и 0,020%. До и после процесса очистки антигена вируса ящура штамма «О №2356/Пакистан/2018» в количественном варианте РСК определяли концентрацию общего вирусного белка и иммуногенных компонентов. Результаты анализа отражены в таблице 5, из которой следует, что в результате очистки антигена вируса ящура штамма «О №2356/Пакистан/2018» с помощью ПГМГ в концентрации 0,010% отмечали снижение концентрации балластного белка на 10%, иммуногенных компонентов - на 2%. При использовании ПГМГ в концентрации 0,015% наблюдали снижение количества балластного белка на 40%, 146S компонента - на 3,6%. Применяя ПГМГ в концентрации 0,020% содержание балластного белка уменьшалось на 60%, а иммуногенных компонентов - на 23%. Таким образом, исследуя условия очистки антигена штамма «О №2356/Пакистан/2018», пришли к выводу о том, что для получения очищенного продукта оптимально использовать ПГМГ с концентрацией 0,015%.A suspension of foot and mouth disease virus strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia 2 ANT-10 , obtained by reproduction in the suspension cell line BHK-21/SUSP/ARRIAH, was subjected to inactivation and purification. To obtain purified foot-and-mouth disease virus antigen, polyhexamethylene guanidine (PHMG) was used with concentrations of 0.010, 0.015 and 0.020%. Before and after the process of purifying the antigen of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” in the quantitative version of the RSC, the concentration of the total viral protein and immunogenic components was determined. The results of the analysis are reflected in Table 5, from which it follows that as a result of purification of the antigen of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” using PHMG at a concentration of 0.010%, a decrease in the concentration of ballast protein by 10% and immunogenic components by 2% was noted . When using PHMG at a concentration of 0.015%, a decrease in the amount of ballast protein by 40% and the 146S component by 3.6% was observed. Using PHMG at a concentration of 0.020%, the content of ballast protein decreased by 60%, and immunogenic components by 23%. Thus, having studied the conditions for purifying the antigen of the strain “O No. 2356/Pakistan/2018”, we came to the conclusion that to obtain a purified product it is optimal to use PHMG with a concentration of 0.015%.
Пример 7. Подбор условий концентрирования суспензии антигена штамма «О №2356/Пакистан/2018» вируса ящура генотипа О/ME-SA/PanAsia2ANT-10.Example 7. Selection of conditions for concentrating the antigen suspension of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus genotype O/ME-SA/PanAsia2 ANT-10 .
Культуральную инактивированною суспензию штамма «О №2356/Пакистан/2018», полученную с применением суспензионной клеточной линии ВНК-21/SUSP/ARRIAH, подвергали концентрированию в 5 раз по объему. Для увеличения концентрации иммуногенных компонентов антигена вируса ящура использовали следующие приемы: 1) добавление полиэтиленгликоля (ПЭГ-6000) с концентрацией 50% к антигену в соотношении 1:4, с экспозицией 4 ч; 2) добавление полиэтиленгликоля (ПЭГ-6000) с концентрацией 50% к антигену в соотношении 1:4, с экспозицией 12 ч; 3) концентрирование с помощью установки тангенциальной фильтрации Centramate 500S Pall в течение 6 ч при рабочем давлении на фильтр 2,2-2,6 атм.A cultural inactivated suspension of the strain “O No. 2356/Pakistan/2018”, obtained using the suspension cell line BNK-21/SUSP/ARRIAH, was concentrated 5 times by volume. To increase the concentration of immunogenic components of the foot-and-mouth disease virus antigen, the following methods were used: 1) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 4 hours; 2) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 12 hours; 3) concentration using a tangential filtration unit Centramate 500S Pall for 6 hours at an operating pressure on the filter of 2.2-2.6 atm.
До и после процесса концентрирования суспензии антигена вируса ящура штамма «О №2356/Пакистан/2018» определяли концентрацию общего вирусного белка и иммуногенных компонентов в количественном варианте РСК. Результаты исследований представлены в таблице 6, из которой видно, что при концентрировании антигена штамма «О №2356/Пакистан/2018» вируса ящура с помощью ПЭГ-6000 в течение 4 ч отмечали увеличение содержания компонентов по сравнению с исходными значениями (до концентрирования) в 3,8 раз. Используя тот же полимер, но повышая время воздействия до 12 ч, увеличили концентрацию компонентов вируса в 4,2 раз. Применяя метод сорбирования с помощью тангенциальной фильтрации, удалось увеличить количество иммуногенных компонентов антигена штамма «О №2356/Пакистан/2018» вируса ящура в суспензии в 4,95 раз. Таким образом, технология тангенциальной фильтрации позволила получить антиген штамма «О №2356/Пакистан/2018» с высокой концентрацией вирусных белков.Before and after the process of concentrating the antigen suspension of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018,” the concentration of the total viral protein and immunogenic components was determined in the quantitative version of the RSC. The research results are presented in Table 6, from which it can be seen that when concentrating the antigen of the strain “O No. 2356/Pakistan/2018” of the foot-and-mouth disease virus using PEG-6000 for 4 hours, an increase in the content of components was noted compared to the initial values (before concentration) in 3.8 times. Using the same polymer, but increasing the exposure time to 12 hours, we increased the concentration of virus components by 4.2 times. Using the sorption method using tangential filtration, it was possible to increase the amount of immunogenic components of the antigen of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018” in suspension by 4.95 times. Thus, tangential filtration technology made it possible to obtain the antigen of the strain “O No. 2356/Pakistan/2018” with a high concentration of viral proteins.
Пример 8. Подбор адъюванта и соотношения антиген-адъювант.Example 8. Selection of adjuvant and antigen-adjuvant ratio.
Для изготовления противоящурной моновалентной сорбированной вакцины из антигена штамма «О №2356/Пакистан/2018» в качестве адъюванта была выбран гидроксид алюминия в комплексе с сапонином. При изготовлении данного вакцинного препарата использовали 4,7% гидроокиси алюминия в пересчете на сухое вещество и сапонин в количестве 1,8 мг.Соотношение антигена штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура с адъювантом гидроксид алюминия в комплексе с сапонином составляет 53% на 47%, соответственно.To produce an anti-foot-and-mouth disease monovalent sorbed vaccine from the antigen of the strain “O No. 2356/Pakistan/2018”, aluminum hydroxide in combination with saponin was chosen as an adjuvant. In the manufacture of this vaccine preparation, 4.7% aluminum hydroxide was used in terms of dry matter and saponin in an amount of 1.8 mg. Antigen ratio of the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 virus foot and mouth disease with adjuvant aluminum hydroxide in combination with saponin is 53% to 47%, respectively.
Пример 9. Компоновка вакцины против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральной инактивированной сорбированной.Example 9. Composition of a vaccine against foot and mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 culture inactivated sorbed.
Из полученного концентрата антигена вируса ящура штамма «О №2356/Пакистан/2018» изготовили вакцину против ящура генотипа О/ME-SA/PanAsia2ANT-10 культуральную инактивированную сорбированную с применением в качестве адъювантов гидроксида алюминия и сапонина. Количество 146S иммуногенного компонента в 1,0 см3 антигена составило 10,69±0,07 мкг/см3 (таблица 6).From the resulting concentrate of the antigen of the foot-and-mouth disease virus strain “O No. 2356/Pakistan/2018”, a culturally inactivated sorbed vaccine against foot-and-mouth disease genotype O/ME-SA/PanAsia2 ANT-10 was prepared using aluminum hydroxide and saponin as adjuvants. The amount of 146S immunogenic component per 1.0 cm 3 of antigen was 10.69 ± 0.07 μg/cm 3 (Table 6).
Пример 10. Иммунизация животных вакциной против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральной инактивированной сорбированной.Example 10. Immunization of animals with a vaccine against foot and mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 culture inactivated sorbed.
Из полученной вакцины против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральной инактивированной сорбированной (предлагаемое изобретение) был приготовлен ряд разведений для КРС с 4-х кратным шагом. 15 голов КРС разделили на 3 группы по 5 голов в каждой, 2 головы без вакцинации оставили для контроля вируса. Иммунизирующая доза составляла 2,0 см3. Первую группу КРС (№№1-5) иммунизировали вакциной без разведения, вторую группу КРС (№№6-10) привили вакциной, разведенной 1/4, третья группа КРС (№№11-15) - вакциной, разведенной 1/16. Препарат вводили внутримышечно в среднюю треть шеи.From the resulting vaccine against foot and mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 culture inactivated sorbed (the proposed invention), a series of dilutions for cattle were prepared in 4-fold increments. 15 heads of cattle were divided into 3 groups of 5 heads each, 2 heads without vaccination were left for virus control. The immunizing dose was 2.0 cm 3 . The first group of cattle (No. 1-5) was immunized with the vaccine without dilution, the second group of cattle (No. 6-10) was vaccinated with the vaccine diluted 1/4, the third group of cattle (No. 11-15) with the vaccine diluted 1/16 . The drug was administered intramuscularly into the middle third of the neck.
Пример 11. Исследование сывороток крови вакцинированных животных на наличие антител к неструктурным белкам вируса ящура.Example 11. Study of blood sera of vaccinated animals for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus.
Сыворотки крови от КРС, полученные до иммунизации животных, через 14 суток после иммунизации, исследовали на наличие антител к неструктурным белкам вируса ящура с помощью блокирующего варианта иммуноферментного анализа (ИФА) в соответствии с рекомендациями OIE (МЭБ) [3]. Тестирование полученных сывороток проводили с использованием тест-системы для ИФА «Prio CHECK®FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs» (Prionics Lelystad B.V., Нидерланды). Полученные результаты исследований отражены в таблице 7, из которой видно, что сыворотки крови животных не содержали антител к неструктурным белкам вируса ящура (значения PI для сывороток крови КРС<50%).Blood sera from cattle obtained before immunization of animals, 14 days after immunization, were examined for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus using a blocking enzyme-linked immunosorbent assay (ELISA) in accordance with OIE recommendations [3]. The obtained sera were tested using the ELISA test system “Prio CHECK ® FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs” (Prionics Lelystad BV, the Netherlands). The research results obtained are reflected in Table 7, from which it can be seen that the animal blood sera did not contain antibodies to non-structural proteins of the foot-and-mouth disease virus (PI values for cattle blood sera <50%).
Пример 12. Оценка авирулентности и безвредности вакцины против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральной инактивированной сорбированной.Example 12. Assessment of the avirulence and safety of the vaccine against foot and mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 culture inactivated sorbed.
Для определения авирулентности вакцины (предлагаемое изобретение) на КРС отобранную пробу вакцинного препарата вводили внутрикожно по 0,1 см3. В исследовании использовали КРС массой 250-300 кг. В течение 10 суток наблюдения животные остались клинически здоровыми, и при патологоанатомическом исследовании не было обнаружено изменений, характерных для ящура. Это свидетельствовало об отсутствии вирулентных свойств разработанной вакцины.To determine the avirulence of the vaccine (the proposed invention) on cattle, a selected sample of the vaccine preparation was injected intradermally at 0.1 cm 3 . The study used cattle weighing 250-300 kg. During 10 days of observation, the animals remained clinically healthy, and the pathological examination did not reveal any changes characteristic of foot-and-mouth disease. This indicated the absence of virulent properties of the developed vaccine.
Контроль безвредности продукта (предлагаемое изобретение) на КРС проводили путем внутримышечного введения вакцины в дозе 6,0 см3 (тройная доза по 2,0 см3). Срок наблюдения также составлял 10 суток. Следует отметить, что после иммунизации температура тела животного может повышаться до 41,4°С и удерживаться на этом уровне в течение 1-2 суток, что не выходит за рамки нормы после введения вакцинного препарата.Control of the safety of the product (the proposed invention) on cattle was carried out by intramuscular administration of the vaccine at a dose of 6.0 cm 3 (triple dose of 2.0 cm 3 ). The observation period was also 10 days. It should be noted that after immunization, the animal’s body temperature can rise to 41.4°C and remain at this level for 1-2 days, which does not go beyond the normal range after administration of the vaccine preparation.
По результатам исследований вакцина против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральная инактивированная сорбированная (предлагаемое изобретение) была признана безвредной, все животные в период наблюдения оставались клинически здоровыми, при патологоанатомическом анализе некроза тканей на месте введения вакцины не обнаружено.According to the results of studies, the vaccine against foot and mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10, cultural inactivated sorbed (the proposed invention) was found to be harmless, all animals during the observation period remained clinically healthy, with pathological examination Analysis of tissue necrosis at the site of vaccine administration did not reveal any tissue necrosis.
Пример 13. Изучение иммуногенных свойств вакцины против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральной инактивированной сорбированной по способности индуцирования вируснейтрализующих антител у естественно восприимчивых животных.Example 13. Study of the immunogenic properties of the vaccine against foot and mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10, a culture-inactivated sorbed vaccine for the ability to induce virus-neutralizing antibodies in naturally susceptible animals.
На 21 сутки после введения вакцины (предлагаемое изобретение) против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральной инактивированной сорбированной у КРС отбирали кровь и проводили исследование полученных сывороток крови в реакции микронейтрализации [3]. Выявлено, что у КРС, иммунизированных вакциной в цельной дозе (5 голов), средние значения титра антител составили 9,31±0,21 log2 SN50, с разведением 1/4 (5 голов) - 5,50±0,33 log2 SN50, с разведением 1/16 (5 голов) - 3,81±0,22 log2 SN50. (таблица 8). Полученные данные реакции микронейтрализации свидетельствуют о том, что после введения вакцины в цельном виде обеспечивается формирование гуморального иммунитета с защитными титрами штаммоспецифических антител (5,5 и более log2 SN50), что соответствует требованиям международных стандартов [3].On the 21st day after the introduction of the vaccine (proposed invention) against foot and mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 , culture inactivated sorbed from cattle, blood was taken and the resulting blood sera were examined in a microneutralization reaction [3]. It was revealed that in cattle immunized with the vaccine in a whole dose (5 heads), the average antibody titer values were 9.31±0.21 log 2 SN 50 , with a 1/4 dilution (5 heads) - 5.50±0.33 log 2 SN 50 , with breeding 1/16 (5 heads) - 3.81±0.22 log 2 SN 50 . (Table 8). The data obtained from the microneutralization reaction indicate that after administration of the vaccine in its entirety, the formation of humoral immunity with protective titers of strain-specific antibodies (5.5 or more log 2 SN 50 ) is ensured, which meets the requirements of international standards [3].
Пример 14. Изучение защитной способности вакцины против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральной инактивированной сорбированной на естественно восприимчивых видах животных методом контрольного заражения.Example 14. Study of the protective ability of the vaccine against foot and mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 , culture-inactivated, sorbed on naturally susceptible animal species using the challenge method.
Крупный рогатый скот, иммунизированный в количестве 15 голов, вакциной в цельном виде и в разведениях, заражали контрольным штаммом «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 вируса ящура, адаптированного к этим животным в слизистую оболочку языка в дозе 104,0 ИД50/0,20 см3 (в две точки по 0,10±0,05 см3). Спустя 7 суток после заражения всех животных подвергли эвтаназии и провели патологоанатомический осмотр. Защищенными от ящура считали животных, у которых на конечностях отсутствовали поражения. Первичные афты не учитывали.Cattle, immunized in the amount of 15 heads, with the vaccine in whole form and in dilutions, were infected with the control strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 foot and mouth disease virus, adapted to these animals in the mucosa the membrane of the tongue in a dose of 10 4.0 ID 50 /0.20 cm 3 (at two points of 0.10 ± 0.05 cm 3 ). 7 days after infection, all animals were euthanized and a postmortem examination was performed. Animals that had no lesions on their limbs were considered protected from foot and mouth disease. Primary aphthae were not taken into account.
Результаты контрольного заражения представлены в таблице 8, из которой следует, что вакцина (предлагаемое изобретение) против ящура из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 культуральная инактивированная сорбированная в цельном виде, а также в разведениях 1/4 и 1/16, введенная в однократной дозе (2,0 см3) защищает КРС от заражения гомологичным штаммом всех животных (5 из 5 голов).The results of the control infection are presented in Table 8, from which it follows that the vaccine (the proposed invention) against foot-and-mouth disease from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 is culturally inactivated, sorbed in whole form, and also in dilutions of 1/4 and 1/16, administered in a single dose (2.0 cm 3 ), protects cattle from infection with a homologous strain of all animals (5 out of 5 heads).
По результатам контрольного заражения было установлено, что в прививном объеме данной вакцины содержится 32 ПД50 и 0,0625 ИмД50 для КРС.Based on the results of the control infection, it was found that the vaccination volume of this vaccine contains 32 PD 50 and 0.0625 ImD 50 for cattle.
Таким образом, приведенная выше информация свидетельствует о том, что вакцина против ящура генотипа О/ME-SA/PanAsia2ANT-10 из штамма «О №2356/Пакистан/2018» культуральная инактивированная сорбированная, воплощающая предлагаемое изобретение, предназначена как экспериментальная резервная для использования в сельском хозяйстве, а именно в ветеринарной вирусологии и биотехнологии; подтверждена возможность осуществления представленного; вакцина, изготовленная из штамма «О №2356/Пакистан/2018» генотипа О/ME-SA/PanAsia2ANT-10 в соответствии с предлагаемым изобретением, обладает высокой иммуногенной активностью и способна обеспечить эффективную защиту восприимчивых животных против эпизоотического штамма вируса ящура серотипа О, генотипа О/ME-SA/PanAsia2ANT-10, циркулирующего в странах Азии.Thus, the above information indicates that the vaccine against foot-and-mouth disease genotype O/ME-SA/PanAsia2 ANT-10 from the strain “O No. 2356/Pakistan/2018”, a culture-inactivated sorbed vaccine embodying the proposed invention, is intended as an experimental reserve for use in agriculture, namely in veterinary virology and biotechnology; the possibility of implementing the presented has been confirmed; a vaccine made from the strain “O No. 2356/Pakistan/2018” genotype O/ME-SA/PanAsia2 ANT-10 in accordance with the invention has high immunogenic activity and is capable of providing effective protection of susceptible animals against the epizootic strain of foot-and-mouth disease virus serotype O, genotype O/ME-SA/PanAsia2 ANT-10 , circulating in Asian countries.
Источники информации, принятые во внимание при составлении описания изобретения к заявке на выдачу патента РФ на изобретение «Вакцина против ящура генотипа О/ME-SA/PanAsia2ANT-10 из штамма «О №2356/Пакистан/2018» культуральная инактивированная сорбированная»:Sources of information taken into account when compiling a description of the invention for the application for a RF patent for the invention “Vaccine against foot and mouth disease genotype O/ME-SA/PanAsia2 ANT-10 from strain “O No. 2356/Pakistan/2018”, culture inactivated sorbed”:
1. Ящур. Меры профилактики. URL: http://89.rospotrebnadzor.ru/directions/epid_nadzor/146902 (Дата обращения: 08.10.2022).1. Foot and mouth disease. Prevention measures. URL: http://89.rospotrebnadzor.ru/directions/epid_nadzor/146902 (Access date: 10/08/2022).
2. Опасность болезни ящура. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Дата обращения: 18.10.2022).2. The danger of foot and mouth disease. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Access date: 10/18/2022).
3. OIE. Manual of diagnostic tests and vaccines for terrestrial animals - 24th Ed. - Paris, 2015 - Vol. 1, Chapter 2.1.5. - P. 166-169.3. OIE. Manual of diagnostic tests and vaccines for terrestrial animals - 24th Ed. - Paris, 2015 - Vol. 1, Chapter 2.1.5. - P. 166-169.
4. Бурдов A.H., Дудников А.И., Малярец П.В. и др. Ящур. - М.: Агропромиздат, 1990. - 320 с.4. Burdov A.N., Dudnikov A.I., Malyarets P.V. and others. Foot and mouth disease. - M.: Agropromizdat, 1990. - 320 p.
5. Пономарев А.П., Узюмов В.Л., Груздев К.Н. Вирус ящура: структура, биологические и физико-химические свойства. - Владимир: Фолиант, 2006. - 250 с.5. Ponomarev A.P., Uzyumov V.L., Gruzdev K.N. Foot and mouth disease virus: structure, biological and physicochemical properties. - Vladimir: Folio, 2006. - 250 p.
6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et. al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et. al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.
7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strateies: Proc. Jnt. Symp.2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strategies: Proc. Jnt. Symp.2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.
8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J.M. Pachecoa, T. Doel [et. al.] // Vaccine. - December 2005. - V. 23. - P. 5775-5782.8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J.M. Pachecoa, T. Doel [et. al.] // Vaccine. - December 2005. - V. 23. - P. 5775-5782.
9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et. al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et. al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.
10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.
11. Официальный сайт The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wrlfmd.org/ref_labs/fmd_ref_lab_reports.htm (Дата обращения 12.11.2022).11. Official website of The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wrlfmd.org/ref_labs/fmd_ref_lab_reports.htm (Date accessed 11/12/2022).
12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - P. 746-754.12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - P. 746-754.
13. Рахманов A.M. Современная эпизоотическая ситуация в мире по ящуру и меры ее контроля // Ветеринарная медицина мiжвiд. тем. наук. Харкiв, 2013. - С. 37-38.13. Rakhmanov A.M. Current epizootic situation in the world regarding foot and mouth disease and measures for its control // Veterinary medicine of the interspecies. topics Sci. Kharkiv, 2013. - pp. 37-38.
14. Longjam N., Тауо Т. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol. 4(10). - P. 475-479.14. Longjam N., Tauo T. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol. 4(10). - P. 475-479.
15. Мельник P.H., Хаустова H.B., Мельник H.B., Самуйленко А.Я., Гринь С.А., Святенко М.С., Литенкова И.Ю. Антигенная вариабельность вируса ящура серотипа А и обоснование необходимости получения новых актуальных производственных штаммов / Ветеринария и кормление. - 2019. - №3. - С. 29-31.15. Melnik R.H., Khaustova H.B., Melnik H.B., Samuylenko A.Ya., Grin S.A., Svyatenko M.S., Litenkova I.Yu. Antigenic variability of foot and mouth disease virus serotype A and justification for the need to obtain new current production strains / Veterinary medicine and feeding. - 2019. - No. 3. - pp. 29-31.
16. Paton D.J., Sumption K.J., Charleston В. Options for control of foot-and-mouth disease: knowledge, capability and policy / Phil. Trans. R. Soc. В (2009) 364. - P. 2657-2667.16. Paton D.J., Sumption K.J., Charleston B. Options for control of foot-and-mouth disease: knowledge, capability and policy / Phil. Trans. R. Soc. In (2009) 364. - P. 2657-2667.
17. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.17. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.
18. Методические рекомендации по определению концентрации 146S, 75S, 12S компонентов вакцинных штаммов культурального вируса ящура в реакции связывания комплемента (РСК) / ФГБУ «ВНИИЗЖ». - Утв. 21.09.17.18. Methodological recommendations for determining the concentration of 146S, 75S, 12S components of vaccine strains of cultural foot-and-mouth disease virus in the complement fixation reaction (FRR) / Federal State Budgetary Institution "ARRIAH". - Approved 09.21.17.
19. Методические указания по определению антигенного соответствия между эпизоотическими изолятами и производственными штаммами вируса ящура в перекрестной реакции микронейтрализации: утв. Россельхознадзором 13.09.2017 / ФГБУ «ВНИИЗЖ». - Владимир: 2017. - 24 с.19. Guidelines for determining antigenic correspondence between epizootic isolates and production strains of foot-and-mouth disease virus in a cross-microneutralization reaction: approved. Rosselkhoznadzor 09/13/2017 / FSBI "ARRIAH". - Vladimir: 2017. - 24 p.
20. Saitou N. and Nei М. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4: 406-42.20. Saitou N. and Nei M. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4: 406-42.
21. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap. Evolution 39: 783-791.21. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap. Evolution 39: 783–791.
22. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101: 11030-11035.22. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101: 11030–11035.
23. Kumar S., Stecher G., Li M., Knyaz C., and Tamura K. (2018). MEGA 6: Molecular Evolutionary Genetics Analysis across computing platforms. Molecular Biology and Evolution 35: 1547-1549.23. Kumar S., Stecher G., Li M., Knyaz C., and Tamura K. (2018). MEGA 6: Molecular Evolutionary Genetics Analysis across computing platforms. Molecular Biology and Evolution 35: 1547–1549.
24. Barnett P. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et. al.] // Comparative Immunology, Microbiology and Infectious Diseases. - 2002. - V. 25. - P. 345-364.24. Barnett P. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et. al.] // Comparative Immunology, Microbiology and Infectious Diseases. - 2002. - V. 25. - P. 345-364.
--->--->
<?xml version="1.0" encoding="UTF-8"?><?xml version="1.0" encoding="UTF-8"?>
<!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing <!DOCTYPE ST26SequenceListing PUBLIC "-//WIPO//DTD Sequence Listing
1.3//EN" "ST26SequenceListing_V1_3.dtd">1.3//EN" "ST26SequenceListing_V1_3.dtd">
<ST26SequenceListing dtdVersion="V1_3" fileName="Vaccine FMDV <ST26SequenceListing dtdVersion="V1_3" fileName="Vaccine FMDV
genotype O ME-SA PanAsia2 ANT-10 xml.xml" softwareName="WIPO genotype O ME-SA PanAsia2 ANT-10 xml.xml" softwareName="WIPO
Sequence" softwareVersion="2.1.2" productionDate="2023-01-04">Sequence" softwareVersion="2.1.2" productionDate="2023-01-04">
<ApplicationIdentification> <ApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-01-04</FilingDate> <FilingDate>2023-01-04</FilingDate>
</ApplicationIdentification> </ApplicationIdentification>
<ApplicantFileReference>480</ApplicantFileReference> <ApplicantFileReference>480</ApplicantFileReference>
<EarliestPriorityApplicationIdentification> <EarliestPriorityApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode> <IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText> <ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-01-04</FilingDate> <FilingDate>2023-01-04</FilingDate>
</EarliestPriorityApplicationIdentification> </EarliestPriorityApplicationIdentification>
<ApplicantName languageCode="ru">ФГБУ "Федеральный центр охраны <ApplicantName languageCode="ru">FSBI "Federal Security Center"
здоровья животных" (ФГБУ "ВНИИЗЖ")</ApplicantName>animal health" (FSBI "ARRIAH")</ApplicantName>
<ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin> <ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin>
<InventorName languageCode="ru">Доронин Максим <InventorName languageCode="ru">Doronin Maxim
Игоревич</InventorName>Igorevich</InventorName>
<InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin> <InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin>
<InventionTitle languageCode="ru">Вакцина против ящура генотипа <InventionTitle languageCode="en">Vaccine against foot and mouth disease genotype
O/ME-SA/PanAsia2ANT-10 из штамма «О №2356/Пакистан/2018» O/ME-SA/PanAsia2ANT-10 from strain “O No. 2356/Pakistan/2018”
культуральная инактивированная сорбированная</InventionTitle>cultural inactivated sorbed</InventionTitle>
<SequenceTotalQuantity>2</SequenceTotalQuantity> <SequenceTotalQuantity>2</SequenceTotalQuantity>
<SequenceData sequenceIDNumber="1"> <SequenceData sequenceIDNumber="1">
<INSDSeq> <INSDSeq>
<INSDSeq_length>639</INSDSeq_length> <INSDSeq_length>639</INSDSeq_length>
<INSDSeq_moltype>DNA</INSDSeq_moltype> <INSDSeq_moltype>DNA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..639</INSDFeature_location> <INSDFeature_location>1..639</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>genomic DNA</INSDQualifier_value> <INSDQualifier_value>genomic DNA</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q1"> <INSDQualifier id="q1">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>accacctccgcaggtgagtcggctgaccccgtgactgccactgttgaga <INSDSeq_sequence>accacctccgcaggtgagtcggctgaccccgtgactgccactgttgaga
actacggtggcaaaacacaggtccagagacgccagcacacggacgtctcgttcatattggacagatttgtactacggtggcaaaacacaggtccagagacgccagcacacggacgtctcgttcatattggacagatttgt
gaaagtaacaccaaaagaccaaattaatgtgttggatctgatgcaaacccctgcccacactttggtgggtgaaagtaacaccaaaagaccaaattaatgtgttggatctgatgcaaacccctgcccacactttggtgggt
gcactcctccgcaccgccacctactacttcgctgatttagaggtggcagtgaaacacgaggggaacctcagcactcctccgcaccgccacctactacttcgctgatttagaggtggcagtgaaacacgaggggaacctca
cttgggtcccgaatggggcacccgaggcagcgttggacaacaccaccaatccaacggcttaccacaaggccttgggtcccgaatggggcacccgaggcagcgttggacaacaccaccaatccaacggcttaccacaaggc
accgctcactcgtctcgcactgccctacacggcaccacaccgtgttttggctaccgtttacaacgggaacaccgctcactcgtctcgcactgccctacacggcaccacaccgtgttttggctaccgtttacaacgggaac
tgcaagtacggcgagagccacgtaaccaatgtgagaggtgatctgcaagtgttggcccaaaaggcagcgatgcaagtacggcgagagccacgtaaccaatgtgagaggtgatctgcaagtgttggcccaaaaggcagcga
gggcgttgcctacgtccttcaactacggtgccatcaaagctacccgggtgaccgagttgctttaccgcatgggcgttgcctacgtccttcaactacggtgccatcaaagctacccgggtgaccgagttgctttaccgcat
gaagagggctgaaacatactgcccccgacctcttctggccatccacccgggtgaagcaagacacaaacaagaagaggctgaaacatactgcccccgacctcttctggccatccacccgggtgaagcaagacacaaacaa
aagatagtggcacctgtaaaacaactcctg</INSDSeq_sequence>aagatagtggcacctgtaaaacaactcctg</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
<SequenceData sequenceIDNumber="2"> <SequenceData sequenceIDNumber="2">
<INSDSeq> <INSDSeq>
<INSDSeq_length>213</INSDSeq_length> <INSDSeq_length>213</INSDSeq_length>
<INSDSeq_moltype>AA</INSDSeq_moltype> <INSDSeq_moltype>AA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division> <INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table> <INSDSeq_feature-table>
<INSDFeature> <INSDFeature>
<INSDFeature_key>source</INSDFeature_key> <INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..213</INSDFeature_location> <INSDFeature_location>1..213</INSDFeature_location>
<INSDFeature_quals> <INSDFeature_quals>
<INSDQualifier> <INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name> <INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>protein</INSDQualifier_value> <INSDQualifier_value>protein</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
<INSDQualifier id="q2"> <INSDQualifier id="q2">
<INSDQualifier_name>organism</INSDQualifier_name> <INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value> <INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier> </INSDQualifier>
</INSDFeature_quals> </INSDFeature_quals>
</INSDFeature> </INSDFeature>
</INSDSeq_feature-table> </INSDSeq_feature-table>
<INSDSeq_sequence>TTSAGESADPVTATVENYGGKTQVQRRQHTDVSFILDRFVKVTPKDQIN <INSDSeq_sequence>TTSAGESADPVTATVENYGGKTQVQRRQHTDVSFILDRFVKVTPKDQIN
VLDLMQTPAHTLVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPYVLDLMQTPAHTLVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPY
TAPHRVLATVYNGNCKYGESHVTNVRGDLQVLAQKAARALPTSFNYGAIKATRVTELLYRMKRAETYCPRTAPHRVLATVYNGNCKYGESHVTNVRGDLQVLAQKAARALPTSFNYGAIKATRVTELLYRMKRAETYCPR
PLLAIHPGEARHKQKIVAPVKQLL</INSDSeq_sequence>PLLAIHPGEARHKQKIVAPVKQLL</INSDSeq_sequence>
</INSDSeq> </INSDSeq>
</SequenceData> </SequenceData>
</ST26SequenceListing></ST26SequenceListing>
<---<---
Claims (3)
Publications (1)
| Publication Number | Publication Date |
|---|---|
| RU2810131C1 true RU2810131C1 (en) | 2023-12-22 |
Family
ID=
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2563345C1 (en) * | 2014-04-16 | 2015-09-20 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Inactivated sorbed vaccine against fmd of type a |
| RU2665849C1 (en) * | 2017-12-15 | 2018-09-04 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Inactivated emulsion vaccine against foot-and-mouth disease type o |
| US10940196B2 (en) * | 2016-04-11 | 2021-03-09 | Biogenesis Bagó Hong-Kong Limited | Universal vaccine for viral diseases |
| RU2785113C1 (en) * | 2021-12-21 | 2022-12-02 | Федеральное Казенное Предприятие "Щелковский Биокомбинат" | Fmd vaccine (options) |
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2563345C1 (en) * | 2014-04-16 | 2015-09-20 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Inactivated sorbed vaccine against fmd of type a |
| US10940196B2 (en) * | 2016-04-11 | 2021-03-09 | Biogenesis Bagó Hong-Kong Limited | Universal vaccine for viral diseases |
| RU2665849C1 (en) * | 2017-12-15 | 2018-09-04 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Inactivated emulsion vaccine against foot-and-mouth disease type o |
| RU2785113C1 (en) * | 2021-12-21 | 2022-12-02 | Федеральное Казенное Предприятие "Щелковский Биокомбинат" | Fmd vaccine (options) |
Non-Patent Citations (1)
| Title |
|---|
| ЕЛЬКИНА Ю. C., Противоящурные вакцины типов О, Азия-1, А для формирования раннего иммунитета у животных, диссертация, Владимир, 2021, с. 77-80. * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| RU2593718C1 (en) | Inactivated emulsion vaccine against foot-and-mouth disease types a, o, asia-1 | |
| RU2603003C1 (en) | Inactivated sorptive vaccine to fmd types a, o, asia-1 | |
| RU2451745C2 (en) | A 2045/KYRGYZSTAN/ 2007 STRAIN OF FOOT-AND-MOUTH DISEASE VIRUS Aphtae epizooticae TYPE A FOR ANTIGENIC AND IMMUNOGENIC PERFORMANCE CONTROL OF FOOT-AND-MOUTH DISEASE VACCINES AND FOR PRODUCTION OF BIOPREPARATIONS FOR DIAGNOSIS AND SPECIFIC PREVENTION OF FOOT-AND-MOUTH DISEASE TYPE A | |
| RU2699671C1 (en) | Vaccine for early protection against foot-and-mouth disease of type o inactivated emulsion | |
| RU2665849C1 (en) | Inactivated emulsion vaccine against foot-and-mouth disease type o | |
| RU2810131C1 (en) | CULTURE INACTIVATED SORBED VACCINE AGAINST FOOT AND MOUTH DISEASE OF O/ME-SA/PanAsia2ANT-10 GENOTYPE FROM O N2356/PAKISTAN/2018 STRAIN | |
| RU2804803C1 (en) | Culture inactivated emulsion vaccine against fmd of o/sea/mya-98 genotype from o n2383/primorsky/2019 strain | |
| RU2815537C1 (en) | Cultural inactivated emulsion vaccine against foot and mouth disease from o no. 2620/orenburgsky/2021 strain of o/me-sa/ind-2001e genotype | |
| RU2817381C1 (en) | Cultural inactivated sorbed vaccine against foot-and-mouth disease from the strain "a/egypt/euro-sa/2022" | |
| RU2815536C1 (en) | Culture inactivated sorbed vaccine against foot and mouth disease from a/tanzania/2013 strain of a/africa/g-i genotype | |
| RU2816264C1 (en) | Cultural inactivated emulsion vaccine against o/ea-3 genotype foot-and-mouth disease of o n2241/ethiopia/2011 strain | |
| RU2815534C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-1/i genotype from sat-1/tanzania/2012 strain | |
| RU2810132C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-1/x genotype from sat-1/nigeria/2015 strain | |
| RU2802192C1 (en) | Inactivated sorbed vaccine against fmd of o/ea-2 genotype from o/kenya/2017 strain culture | |
| RU2804875C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-2/vii genotype from sat-2/eritrea/1998 strain | |
| RU2799605C1 (en) | FMD CULTURE INACTIVATED SORBED VACCINE FROM A/Iran/2018 STRAIN OF A/ASIA/Iran-05SIS-13 NEW GENOTYPE | |
| RU2816944C1 (en) | Cultural inactivated emulsion vaccine against foot-and-mouth disease serotype o from strain "o/arriah/mya-98" | |
| RU2809219C1 (en) | Culturally inactivated sorbed vaccine against foot and mouth disease of sat-1/nwz genotype | |
| RU2815541C1 (en) | Culturally inactivated sorbed vaccine against foot and mouth disease of sat-2/iv genotype | |
| RU2824662C1 (en) | Culture inactivated emulsion vaccine against foot-and-mouth disease of asia-1/g-v genotype from asia-1/g-v/2006 strain | |
| KR102623114B1 (en) | Method for Enhancing Purity of Foot-and-mouth Disease Vaccine Antigens | |
| CN117897170A (en) | FMDV virus-like particles with stabilizing mutations | |
| RU2340672C2 (en) | Mutant of virus infectious of bursal disease (ibdv), expressing virus-neutralised epitopes specific to classical and alternative ibdv strains | |
| RU2824660C1 (en) | Culture inactivated emulsion vaccine against foot-and-mouth disease of sat-2/xiv genotype from sat-2/xiv/2023 strain | |
| RU2798293C1 (en) | Fmd culture inactivated sorbed vaccine from a/afghanistan/2017 strain of a/asia/iran-05far-11 new genotype |