RU2816944C1 - Cultural inactivated emulsion vaccine against foot-and-mouth disease serotype o from strain "o/arriah/mya-98" - Google Patents
Cultural inactivated emulsion vaccine against foot-and-mouth disease serotype o from strain "o/arriah/mya-98" Download PDFInfo
- Publication number
- RU2816944C1 RU2816944C1 RU2023123178A RU2023123178A RU2816944C1 RU 2816944 C1 RU2816944 C1 RU 2816944C1 RU 2023123178 A RU2023123178 A RU 2023123178A RU 2023123178 A RU2023123178 A RU 2023123178A RU 2816944 C1 RU2816944 C1 RU 2816944C1
- Authority
- RU
- Russia
- Prior art keywords
- foot
- mouth disease
- arriah
- mya
- strain
- Prior art date
Links
- 241000710198 Foot-and-mouth disease virus Species 0.000 title claims abstract description 193
- 229960005486 vaccine Drugs 0.000 title claims abstract description 81
- 208000007212 Foot-and-Mouth Disease Diseases 0.000 title claims description 64
- 239000000839 emulsion Substances 0.000 title claims description 29
- 239000000725 suspension Substances 0.000 claims abstract description 43
- 230000002163 immunogen Effects 0.000 claims abstract description 25
- 239000002671 adjuvant Substances 0.000 claims abstract description 21
- 239000012678 infectious agent Substances 0.000 claims abstract description 4
- 208000015181 infectious disease Diseases 0.000 claims description 20
- 230000000890 antigenic effect Effects 0.000 claims description 16
- 239000000463 material Substances 0.000 claims description 8
- 239000013543 active substance Substances 0.000 claims description 7
- 231100000676 disease causative agent Toxicity 0.000 claims description 4
- 241000710189 Aphthovirus Species 0.000 claims description 3
- 241000709664 Picornaviridae Species 0.000 claims description 3
- 244000037640 animal pathogen Species 0.000 claims description 2
- 239000000427 antigen Substances 0.000 abstract description 31
- 108091007433 antigens Proteins 0.000 abstract description 31
- 102000036639 antigens Human genes 0.000 abstract description 31
- 230000000694 effects Effects 0.000 abstract description 5
- 230000005847 immunogenicity Effects 0.000 abstract 1
- 239000000126 substance Substances 0.000 abstract 1
- 210000004027 cell Anatomy 0.000 description 59
- 241000700605 Viruses Species 0.000 description 44
- 241001465754 Metazoa Species 0.000 description 33
- 108090000623 proteins and genes Proteins 0.000 description 27
- 238000004519 manufacturing process Methods 0.000 description 19
- 102000004169 proteins and genes Human genes 0.000 description 19
- 241000282887 Suidae Species 0.000 description 16
- 230000002458 infectious effect Effects 0.000 description 16
- 239000002609 medium Substances 0.000 description 15
- 238000002255 vaccination Methods 0.000 description 14
- 238000000034 method Methods 0.000 description 11
- 241000283690 Bos taurus Species 0.000 description 10
- 201000010099 disease Diseases 0.000 description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 10
- 210000002966 serum Anatomy 0.000 description 10
- 238000010790 dilution Methods 0.000 description 9
- 239000012895 dilution Substances 0.000 description 9
- 230000002779 inactivation Effects 0.000 description 9
- 210000004369 blood Anatomy 0.000 description 8
- 239000008280 blood Substances 0.000 description 8
- 210000003734 kidney Anatomy 0.000 description 8
- 239000002356 single layer Substances 0.000 description 8
- 238000004458 analytical method Methods 0.000 description 7
- 238000004113 cell culture Methods 0.000 description 7
- 230000003053 immunization Effects 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 238000002965 ELISA Methods 0.000 description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 description 6
- 238000009825 accumulation Methods 0.000 description 6
- 238000006243 chemical reaction Methods 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 238000004264 monolayer culture Methods 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 230000009385 viral infection Effects 0.000 description 6
- 108010067390 Viral Proteins Proteins 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 238000001914 filtration Methods 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 239000000203 mixture Substances 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 239000002245 particle Substances 0.000 description 5
- 230000002265 prevention Effects 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 238000011160 research Methods 0.000 description 5
- 238000004114 suspension culture Methods 0.000 description 5
- 210000002845 virion Anatomy 0.000 description 5
- 241001250090 Capra ibex Species 0.000 description 4
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 4
- 101710172711 Structural protein Proteins 0.000 description 4
- 239000000654 additive Substances 0.000 description 4
- 230000000120 cytopathologic effect Effects 0.000 description 4
- 230000006378 damage Effects 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 244000144972 livestock Species 0.000 description 4
- 244000052769 pathogen Species 0.000 description 4
- 230000001717 pathogenic effect Effects 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- -1 polyhexamethylene guanidine hydrochloride Polymers 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- 108010017384 Blood Proteins Proteins 0.000 description 3
- 102000004506 Blood Proteins Human genes 0.000 description 3
- 241000699673 Mesocricetus auratus Species 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- 239000012980 RPMI-1640 medium Substances 0.000 description 3
- 241001493546 Suina Species 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 239000013553 cell monolayer Substances 0.000 description 3
- 238000004140 cleaning Methods 0.000 description 3
- 238000010835 comparative analysis Methods 0.000 description 3
- 210000003292 kidney cell Anatomy 0.000 description 3
- 230000003287 optical effect Effects 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- LSDGFGPIFBOTJI-UHFFFAOYSA-N 2-(aziridin-1-yl)ethanamine Chemical compound NCCN1CC1 LSDGFGPIFBOTJI-UHFFFAOYSA-N 0.000 description 2
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 2
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 2
- 208000035473 Communicable disease Diseases 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- 239000012981 Hank's balanced salt solution Substances 0.000 description 2
- 230000006978 adaptation Effects 0.000 description 2
- 230000000996 additive effect Effects 0.000 description 2
- 208000002399 aphthous stomatitis Diseases 0.000 description 2
- 230000000680 avirulence Effects 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 230000000052 comparative effect Effects 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 230000004727 humoral immunity Effects 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 239000012535 impurity Substances 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 230000000877 morphologic effect Effects 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 239000003531 protein hydrolysate Substances 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 210000000605 viral structure Anatomy 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 102100031974 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Human genes 0.000 description 1
- 101000703754 Homo sapiens CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241001144416 Picornavirales Species 0.000 description 1
- 108010009736 Protein Hydrolysates Proteins 0.000 description 1
- 241000282849 Ruminantia Species 0.000 description 1
- 101710140501 Sulfate adenylyltransferase subunit 2 1 Proteins 0.000 description 1
- 101710173681 Sulfate adenylyltransferase subunit 2 2 Proteins 0.000 description 1
- 102100030100 Sulfate anion transporter 1 Human genes 0.000 description 1
- 101710144481 Sulfate anion transporter 1 Proteins 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 125000003275 alpha amino acid group Chemical group 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 230000027645 antigenic variation Effects 0.000 description 1
- 230000037429 base substitution Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 230000009351 contact transmission Effects 0.000 description 1
- 238000011217 control strategy Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- BTWUORFYKAZQHW-UHFFFAOYSA-L disodium;2-hydroxy-3-[4-[4-[(2-hydroxy-3-sulfonatopropyl)amino]-3-methylphenyl]-2-methylanilino]propane-1-sulfonate Chemical compound [Na+].[Na+].C1=C(NCC(O)CS([O-])(=O)=O)C(C)=CC(C=2C=C(C)C(NCC(O)CS([O-])(=O)=O)=CC=2)=C1 BTWUORFYKAZQHW-UHFFFAOYSA-L 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000003067 hemagglutinative effect Effects 0.000 description 1
- GPRLSGONYQIRFK-UHFFFAOYSA-N hydron Chemical compound [H+] GPRLSGONYQIRFK-UHFFFAOYSA-N 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 238000012417 linear regression Methods 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000017074 necrotic cell death Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000007918 pathogenicity Effects 0.000 description 1
- 238000010827 pathological analysis Methods 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 238000013081 phylogenetic analysis Methods 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 238000011886 postmortem examination Methods 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 230000000601 reactogenic effect Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 238000004370 retrospective diagnosis Methods 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 230000000405 serological effect Effects 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 1
- 230000017613 viral reproduction Effects 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
Abstract
Description
Изобретение относится к области ветеринарной вирусологии и биотехнологии, а именно к разработке вакцины против ящура серотипа О из штамма «O/ARRIAH/Mya-98» культуральная инактивированная эмульсионная.The invention relates to the field of veterinary virology and biotechnology, namely to the development of a cultural inactivated emulsion vaccine against foot-and-mouth disease serotype O from the strain “O/ARRIAH/Mya-98”.
Ящур - острая высококонтагиозная везикулярная болезнь домашних и диких парнокопытных жвачных животных, которая вызывается РНК-содержащим афтовирусом семейства Picornaviridae. Данное заболевание влечёт за собой значительные экономические потери, связанные с негативным влиянием на производство животноводческой продукции, и является препятствием для региональной и международной торговли животными и продуктами животного происхождения. По оценкам WOAH (Всемирная организация здравоохранения животных, основана как OIE), болезнь циркулирует у 77% мирового поголовья домашнего скота в Африке, на Ближнем Востоке и в Азии, а также на ограниченной территории Южной Америки [1]. В связи с чем существует риск заноса инфекции в страны, свободные от ящура без вакцинации. Борьба с ящуром заключается в проведении своевременных профилактических мероприятий, таких как эффективный эпидемиологический контроль за болезнью; вакцинирование против ящура домашних и сельскохозяйственных животных; надзор за передвижением диких парнокопытных животных в приграничных районах, подверженных риску проникновения возбудителя из стран, неблагополучных по ящуру; мониторинговые исследования по оценке иммунного статуса сельскохозяйственного и домашнего скота, включая ретроспективную диагностику ящура [2].Foot and mouth disease is an acute, highly contagious vesicular disease of domestic and wild artiodactyl ruminants, which is caused by an RNA-containing aphthovirus of the family Picornaviridae . This disease entails significant economic losses associated with a negative impact on livestock production, and is an obstacle to regional and international trade in animals and animal products. The WOAH (World Organization for Animal Health, founded as OIE) estimates that the disease circulates in 77% of the world's livestock in Africa, the Middle East and Asia, as well as a limited area of South America [1]. Therefore, there is a risk of introducing the infection into countries free from foot-and-mouth disease without vaccination. The fight against foot-and-mouth disease consists of carrying out timely preventive measures, such as effective epidemiological control of the disease; vaccination against foot and mouth disease of domestic and farm animals; supervision of the movement of wild artiodactyl animals in border areas at risk of pathogen penetration from countries affected by foot-and-mouth disease; monitoring studies to assess the immune status of agricultural and livestock, including retrospective diagnosis of foot and mouth disease [2].
В настоящее время выделяют 7 серотипов вируса ящура, а именно, O, A, C, SAT-1, SAT-2, SAT-3 и Азия-1, при этом вирус серотипа О является очень распространенным и изученным, что определяет актуальность изготовления вакцин против ящура данного серотипа.Currently, there are 7 serotypes of foot-and-mouth disease virus, namely O, A, C, SAT-1, SAT-2, SAT-3 and Asia-1, while the serotype O virus is very common and studied, which determines the relevance of vaccine production against foot and mouth disease of this serotype.
Серотипы генетически разделены на топотипы, а иногда на отдельные генетические линии и даже сублинии [3, 4]. Серотип О вируса ящура разделен на 11 топотипов: EAST AFRICA 1 - 4 (Восточная Африка) (EA-1-4), SOUTHEAST ASIA (Юго-Восточная Азия) (SEA), EUROPE-SOUTH AMERICA (Европа-Южная Америка) (EURO-SA), INDONESIA-1 и 2 (Индонезия-1 и 2) (ISA-1 and -2), CATHAY (Китай), MIDDLE EAST-SOUTH ASIA (ME-SA) (Ближний Восток-Южная Азия) и WEST AFRICA (Западная Африка) (WA). Такое высокое генетическое и антигенное разнообразие приводит к проблемам в специфической профилактики ящура при применении культуральных инактивированных противоящурных вакцин. В результате возникает необходимость создания новых средств специфической иммунопрофилактики в отношении вируса ящура серотипа О [5-11].Serotypes are genetically divided into topotypes, and sometimes into separate genetic lineages and even sublines [3, 4]. Foot and mouth disease virus serotype O is divided into 11 topotypes: EAST AFRICA 1 - 4 (East Africa) (EA-1-4), SOUTHEAST ASIA (Southeast Asia) (SEA), EUROPE-SOUTH AMERICA (Europe-South America) (EURO -SA), INDONESIA-1 and 2 (ISA-1 and -2), CATHAY (China), MIDDLE EAST-SOUTH ASIA (ME-SA) and WEST AFRICA (West Africa) (WA). This high genetic and antigenic diversity leads to problems in the specific prevention of FMD when using culture-inactivated FMD vaccines. As a result, there is a need to create new means of specific immunoprophylaxis against foot-and-mouth disease virus serotype O [5-11].
По причине быстрого распространения возбудителя ящура данное заболевание может приобретать размах эпизоотий [12]. С целью недопущения возникновения болезни в хозяйствах Российской Федерации применяется система мероприятий по борьбе и профилактике ящура, которая направлена на предупреждение заноса вируса в страну, систематическую иммунизацию крупного и мелкого рогатого скота в буферной зоне, а также проведение мониторинга иммунного статуса привитых животных.Due to the rapid spread of the foot-and-mouth disease pathogen, this disease can acquire the scope of an epizootic [12]. In order to prevent the occurrence of the disease, farms in the Russian Federation apply a system of measures to combat and prevent foot-and-mouth disease, which is aimed at preventing the introduction of the virus into the country, systematic immunization of large and small livestock in the buffer zone, as well as monitoring the immune status of vaccinated animals.
Для иммунизации животных должна применяться вакцина, изготовленная из вируса, гомологичного полевым изолятам [6-13]. С целью проведения эффективной кампании по вакцинации нужно наличие эффективной, безопасной вакцины, содержащей в качестве иммуногенной части антиген вируса, соответствующий эпизоотическому распространяющемуся вирусу определенного генотипа [14, 15]. Создание подобных вакцин является актуальной задачей. Достижение данной цели позволит эффективно применять вакцинный препарат в неблагополучном пункте и окружающей угрожаемой зоне для формирования иммунитета против конкретного генотипа вируса ящура.To immunize animals, a vaccine made from a virus homologous to field isolates should be used [6-13]. In order to conduct an effective vaccination campaign, it is necessary to have an effective, safe vaccine containing, as an immunogenic part, a viral antigen corresponding to the epizootic spreading virus of a certain genotype [14, 15]. The creation of such vaccines is an urgent task. Achieving this goal will make it possible to effectively use the vaccine drug in a disadvantaged area and the surrounding threatened area to build immunity against a specific genotype of the foot-and-mouth disease virus.
Высокое генетическое и антигенное разнообразие приводит к проблемам в специфической профилактике ящура при применении культуральных инактивированных противоящурных вакцин, а также затрудняет штаммоспецифическую диагностику выделенных изолятов вируса ящура. В результате возникает необходимость создания новых средств специфической иммунопрофилактики в отношении вируса ящура серотипа О и, в частности, штамма «O/ARRIAH/Mya-98», представители которого распространены на территории Южной Америки и за ее пределами, где вспышки данного представителя вируса ящура имеют спорадический характер. Следует отметить, что в последние годы усилились торгово-экономические связи со странами этого региона, в частности, Бразилией, Аргентиной, Чили, Венесуэлой и др. Имеются риски заноса возбудителя, имеющих высокую степень генетического родства с представленным штаммом на территорию Российской Федерации. Это обстоятельство является угрожающим фактором в отношении распространения данного представителя вируса ящура на территории нашей страны и требует исследования свойств появляющихся штаммов вируса ящура и изготовления на его основе вакцинных препаратов.High genetic and antigenic diversity leads to problems in the specific prevention of foot-and-mouth disease when using culture-inactivated foot-and-mouth disease vaccines, and also complicates the strain-specific diagnosis of isolated foot-and-mouth disease virus isolates. As a result, there is a need to create new means of specific immunoprophylaxis against foot-and-mouth disease virus serotype O and, in particular, the “O/ARRIAH/Mya-98” strain, representatives of which are distributed in South America and beyond, where outbreaks of this representative of the foot-and-mouth disease virus occur sporadic. It should be noted that in recent years, trade and economic ties with the countries of this region have intensified, in particular, Brazil, Argentina, Chile, Venezuela, etc. There are risks of introducing pathogens that have a high degree of genetic relationship with the presented strain into the territory of the Russian Federation. This circumstance is a threatening factor regarding the spread of this representative of the foot-and-mouth disease virus in our country and requires research into the properties of emerging strains of foot-and-mouth disease virus and the production of vaccine preparations based on it.
Известны производственные штаммы вируса ящура серотипа О, которые применяются для производства средств специфической профилактики ящура:There are known production strains of foot-and-mouth disease virus serotype O, which are used for the production of specific foot-and-mouth disease prevention products:
- штамм «О №1715/Тайвань/1997» (генотип O/CATHAY/CAM 94),- strain “O No. 1715/Taiwan/1997” (genotype O/CATHAY/CAM 94),
- штамм «О №2212/Приморский/2014» (генотип O/SEA/Mya-98), - strain “O No. 2212/Primorsky/2014” (genotype O/SEA/Mya-98),
- штамм «О №2147/Приморский/2012» (генотип O/ME-SA/PanAsia), - strain “O No. 2147/Primorsky/2012” (genotype O/ME-SA/PanAsia),
- штамм «О №2008/Саудовская Аравия/2008» (генотип O/ME-SA/PanAsia2), - strain “O No. 2008/Saudi Arabia/2008” (genotype O/ME-SA/PanAsia2),
- штамм «О №2311/Забайкальский/2016» (генотип O/ME-SA/Ind-2001e).- strain “O No. 2311/Zabaikalsky/2016” (genotype O/ME-SA/Ind-2001e).
Изолят вируса ящура был выделен в результате лабораторно-диагностических исследований в ФГБУ «ВНИИЗЖ» из патологического материала, отобранного от крупного рогатого скота на территории Федеративной Республики Бразилия в 1994 году. При проведении научных исследований в ФГБУ «ВНИИЗЖ» данный изолят был охарактеризован и получил название - штамм «О/ARRIAH/Mya-98» [9].The foot-and-mouth disease virus isolate was isolated as a result of laboratory diagnostic tests at the Federal State Budgetary Institution "ARRIAH" from pathological material taken from cattle in the Federative Republic of Brazil in 1994. During scientific research at the Federal State Budgetary Institution "ARRIAH" this isolate was characterized and received the name - strain "O/ARRIAH/Mya-98" [9].
По результатам сравнительного анализа нуклеотидных последовательностей выделенный штамм принадлежит к генотипу O/SEA/Mya-98 вируса ящура (фиг. 1) и значительно отличается от производственных штаммов вируса ящура серотипа О, в частности, штамма «О №2212/Приморский/2014».According to the results of a comparative analysis of nucleotide sequences, the isolated strain belongs to the O/SEA/Mya-98 genotype of the foot-and-mouth disease virus (Fig. 1) and is significantly different from the production strains of the foot-and-mouth disease virus serotype O, in particular, the strain “O No. 2212/Primorsky/2014”.
Учитывая увеличение торгово-экономических взаимоотношений между Россией и странами Южной Америки возникает опасность проникновение вируса ящура данного генотипа на территорию Российской Федерации и особое значение приобретает проблема возможной экстренной профилактики данного заболевания для формирования иммунитета у восприимчивых животных. Таким образом, возникла необходимость разработать вакцину против ящура серотипа О из штамма «O/ARRIAH/Mya-98» культуральную инактивированную эмульсионную для обеспечения биологической безопасности территории Российской Федерации и сопредельных государств.Given the increase in trade and economic relations between Russia and the countries of South America, there is a danger of the foot-and-mouth disease virus of this genotype entering the territory of the Russian Federation and the problem of possible emergency prevention of this disease to build immunity in susceptible animals is of particular importance. Thus, there was a need to develop a cultural inactivated emulsion vaccine against foot-and-mouth disease serotype O from the strain “O/ARRIAH/Mya-98” to ensure the biological safety of the territory of the Russian Federation and neighboring countries.
Наиболее близкой предлагаемому изобретению по совокупности существенных признаков является вакцина инактивированная эмульсионная против ящура серотипа О (штамм «О №2212/Приморский/2014», генотип O/SEA/Mya-98) [16], содержащая активное вещество в виде авирулентного и очищенного культурального антигенного материала из гомологичного возбудителю ящура штамма «О №2212/Приморский/2014», полученного в чувствительной биологической системе, и целевые добавки в виде масляного адъюванта Montanide ISA-206 VG («Seppic», Р. Франция): концентрация антигена (инактивированные 146S+75S компоненты вируса ящура) не менее 3,0 мкг/см3, содержание масляного адъюванта Montanide ISA-206 VG - 50% по массе, добавка в виде поддерживающей среды - до 1,0 см3 (прототип).The closest to the proposed invention in terms of the totality of essential features is the inactivated emulsion vaccine against foot-and-mouth disease serotype O (strain “O No. 2212/Primorsky/2014”, genotype O/SEA/Mya-98) [16], containing the active substance in the form of an avirulent and purified cultural antigenic material from the strain “O No. 2212/Primorsky/2014” homologous to the causative agent of foot-and-mouth disease, obtained in a sensitive biological system, and targeted additives in the form of oil adjuvant Montanide ISA-206 VG (Seppic, R. France): antigen concentration (inactivated 146S +75S components of the foot and mouth disease virus) not less than 3.0 μg/cm 3 , the content of the oil adjuvant Montanide ISA-206 VG is 50% by weight, the additive in the form of a supporting medium is up to 1.0 cm 3 ( prototype ).
В качестве чувствительной биологической системы для репродукции вируса ящура используют перевиваемую клеточную линию почки новорожденного сирийского хомячка ВНК-21/2-17, в качестве поддерживающей среды применяют среду Игла DMEM без внесения сыворотки, с добавлением ферментативного гидролизата мышц сухого, гидролизата белков крови сухого при рН среды 7,45-7,65.As a sensitive biological system for the reproduction of the foot-and-mouth disease virus, a continuous cell line of the kidney of a newborn Syrian hamster BNK-21/2-17 is used; as a supporting medium, Eagle's DMEM medium is used without adding serum, with the addition of enzymatic hydrolyzate of dry muscle, hydrolyzate of dry blood proteins at pH Wednesdays 7.45-7.65.
Для инактивации вируса используют аминоэтилэтиленимин (АЭЭИ). При изготовлении эмульсионной вакцины в качестве адъюванта служит масляный адъювант Montanide ISA-206 VG («Seppic», Р. Франция). Очистку вируссодержащей суспензии от балластных примесей осуществляют с применением полигексаметиленгуанидин гидрохлорида (ПГМГ).Aminoethylethylenimine (AEEI) is used to inactivate the virus. When producing an emulsion vaccine, Montanide ISA-206 VG oil adjuvant (Seppic, R. France) is used as an adjuvant. Purification of the virus-containing suspension from ballast impurities is carried out using polyhexamethylene guanidine hydrochloride (PHMG).
Существенный недостаток вакцины-прототипа состоит в его низкой иммуногенной активности относительно штамма «O/ARRIAH/Mya-98» и близкородственных ему штаммов и изолятов вируса ящура. A significant drawback of the prototype vaccine is its low immunogenic activity against the “O/ARRIAH/Mya-98” strain and closely related strains and isolates of the foot-and-mouth disease virus.
Для решения указанной проблемы было создано настоящее изобретение, в которое входила разработка вакцины против ящура серотипа О из штамма «O/ARRIAH/Mya-98» культуральной инактивированной эмульсионной. Данная вакцина предполагает высокое содержание 146S иммуногенного компонента в дозе препарата [17, 18, 19].To solve this problem, the present invention was created, which included the development of a culture-inactivated emulsion vaccine against foot-and-mouth disease serotype O from the “O/ARRIAH/Mya-98” strain. This vaccine assumes a high content of the 146S immunogenic component in the dose of the drug [17, 18, 19].
Технический результат от использования предлагаемого изобретения заключается в расширении арсенала противоящурных инактивированных культуральных эмульсионных вакцин для защиты животных против вируса ящура серотипа О, в частности, изолятов и штаммов, близкородственных штамму «O/ARRIAH/Mya-98».The technical result from the use of the proposed invention is to expand the arsenal of anti-foot-and-mouth disease inactivated cultural emulsion vaccines to protect animals against foot-and-mouth disease virus serotype O, in particular, isolates and strains closely related to the “O/ARRIAH/Mya-98” strain.
Указанный технический результат достигнут созданием вакцины против ящура серотипа О из штамма «O/ARRIAH/Mya-98» культуральной инактивированной эмульсионной, охарактеризованной следующей совокупностью признаков, отраженных ниже.The specified technical result was achieved by creating a cultural inactivated emulsion vaccine against foot-and-mouth disease serotype O from the strain “O/ARRIAH/Mya-98”, characterized by the following set of features reflected below.
Разработанная вакцина в 1,0 см3 препарата содержит следующие основные компоненты: 1) активное вещество в виде авирулентного и очищенного антигенного материала из гомологичного возбудителю инфекции штамма «O/ARRIAH/Mya-98» вируса ящура, репродуцированного в перевиваемой суспензионной клеточной линии ВНК-21/SUSP/ARRIAH, в количестве не менее 5,0 мкг; 2) масляный адъювант Montanide ISA-71 R VG с содержанием 70% по массе, обеспечивающий усиление иммунного ответа у животных; 3) поддерживающая среда - до 1,0 см3.The developed vaccine in 1.0 cm 3 of the drug contains the following main components: 1) the active substance in the form of avirulent and purified antigenic material from the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” homologous to the infectious agent, reproduced in the continuous suspension cell line BNK- 21/SUSP/ARRIAH, in an amount of at least 5.0 mcg; 2) oil adjuvant Montanide ISA-71 R VG containing 70% by weight, which enhances the immune response in animals; 3) supporting medium - up to 1.0 cm 3 .
Штамм «O/ARRIAH/Mya-98» вируса ящура депонирован во Всероссийской государственной коллекции экзотических типов вирусов ящура и других патогенов животных (ГКШМ) ФГБУ «ВНИИЗЖ», под регистрационным номером: №488 - деп / 23-38 - ГКШМ ФГБУ «ВНИИЗЖ». The strain “O/ARRIAH/Mya-98” of the foot-and-mouth disease virus has been deposited in the All-Russian State Collection of Exotic Types of Foot and Mouth Disease Viruses and Other Animal Pathogens (GKSHM) of the Federal State Budgetary Institution “ARRIAH”, under registration number: No. 488 - dep / 23-38 - GKSHM FSBI "ARRIAH".
Штамм адаптирован к первично-трипсинизированным монослойным клеткам линии свиной почки (СП) и перевиваемым клеточным линиям из почки новорожденного сирийского хомячка (ВНК-21/SUSP/ARRIAH), почки свиньи (IB-RS-2) и почки сибирского горного козерога (ПСГК-30).The strain is adapted to primary trypsinized monolayer cells of the porcine kidney line (SP) and continuous cell lines from newborn Syrian hamster kidney (BNK-21/SUSP/ARRIAH), pig kidney (IB-RS-2) and Siberian mountain ibex kidney (PSGK- thirty).
Для изготовления вакцины в качестве чувствительной биологической системы предпочтительно используют перевиваемую суспензионную культуру клеток ВНК-21/SUSP/ARRIAH, а в качестве поддерживающей среды применяют среду Хэнкса без внесения сыворотки, но с добавлением гидролизата белков крови в количестве 5,0% от общего объема при рН среды 7,50-7,70. Инактивацию вируса проводят с использованием аминоэтилэтиленимина (АЭЭИ) с концентрацией 0,024% от объема вируссодержащей суспензии. Инактивированный вирус очищают от балластных примесей с помощью полигексаметиленгуанидина (ПГМГ), который вносят в суспензию до концентрации 0,025% от общего объема.To produce a vaccine, a continuous suspension culture of BHK-21/SUSP/ARRIAH cells is preferably used as a sensitive biological system, and Hanks’ medium is used as a supporting medium without adding serum, but with the addition of blood protein hydrolysate in an amount of 5.0% of the total volume at pH of the medium is 7.50-7.70. Virus inactivation is carried out using aminoethylethylenimine (AEEI) with a concentration of 0.024% of the volume of the virus-containing suspension. The inactivated virus is purified from ballast impurities using polyhexamethylene guanidine (PHMG), which is added to the suspension to a concentration of 0.025% of the total volume.
Авирулентный и очищенный антиген штамма «O/ARRIAH/Mya-98» вируса ящура представляет собой суспензию, содержащую инактивированный 146S иммуногенный компонент вируса ящура. Концентрацию компонента в продукте оценивают с помощью количественного варианта реакции связывания комплемента (РСК) [19, 20]. The avirulent and purified antigen of the foot-and-mouth disease virus strain "O/ARRIAH/Mya-98" is a suspension containing the inactivated 146S immunogenic component of the foot-and-mouth disease virus. The concentration of the component in the product is assessed using a quantitative version of the complement fixation reaction (CRR) [19, 20].
Для создания вакцины используют вирусный материал, содержащий в 1,0 см3 не менее 5,0 мкг инактивированных иммуногенных 146S частиц вируса ящура. Заявленную концентрацию иммуногенного компонента в вакцинном препарате обеспечивают благодаря концентрированию антигена с помощью установки тангенциальной фильтрации Centramate 500S Pall.To create a vaccine, viral material is used that contains at least 5.0 μg of inactivated immunogenic 146S particles of foot-and-mouth disease virus per 1.0 cm 3 . The declared concentration of the immunogenic component in the vaccine preparation is ensured by concentrating the antigen using a Centramate 500S Pall tangential filtration unit.
Вакцину против ящура из штамма «O/ARRIAH/Mya-98» культуральную инактивированную эмульсионную получают путем смешивания очищенного антигена и масляного адъюванта Montanide ISA-71 R VG в соотношении 30% на 70% по массе, соответственно. Полученная вакцина представляет собой стабильную эмульсию белого или бледно-желтого цвета, содержащую инактивированный 146S компонент вируса ящура, который обеспечивают формирование специфического иммунного ответа.The cultural inactivated emulsion vaccine against foot and mouth disease from the strain “O/ARRIAH/Mya-98” is prepared by mixing the purified antigen and the oil adjuvant Montanide ISA-71 R VG in a ratio of 30% to 70% by weight, respectively. The resulting vaccine is a stable white or pale yellow emulsion containing an inactivated 146S component of the foot and mouth disease virus, which ensures the formation of a specific immune response.
Предлагаемое изобретение включает следующую совокупность существенных признаков, обеспечивающих получение технического результата во всех случаях, на которые спрашивается правовая охрана:The proposed invention includes the following set of essential features that ensure obtaining a technical result in all cases for which legal protection is sought:
1. Вакцина против ящура из штамма «O/ARRIAH/Mya-98» культуральная инактивированная эмульсионная.1. Vaccine against foot and mouth disease from the strain “O/ARRIAH/Mya-98”, cultural inactivated emulsion.
2. Активное вещество в виде авирулентного и очищенного антигенного материала из гомологичного возбудителю заболевания штамма «O/ARRIAH/Mya-98» вируса ящура в эффективном количестве.2. The active substance in the form of avirulent and purified antigenic material from the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” homologous to the causative agent of the disease in an effective amount.
3. Целевые добавки.3. Targeted supplements.
Существенные отличительные признаки предлагаемой вакцины заключаются в том, что в качестве активного вещества она содержит авирулентный очищенный антиген штамма «O/ARRIAH/Mya-98» вируса ящура в эффективном количестве.The essential distinguishing features of the proposed vaccine are that as an active substance it contains an avirulent purified antigen of the “O/ARRIAH/Mya-98” strain of foot-and-mouth disease virus in an effective amount.
Предлагаемое изобретение характеризуется также другими отличительными признаками, выражающими конкретные формы выполнения или особые условия его использования:The present invention is also characterized by other distinctive features that express specific forms of implementation or special conditions for its use:
1. Авирулентный и очищенный антиген штамма «O/ARRIAH/Mya-98» вируса ящура, полученный предпочтительно в суспензионной перевиваемой клеточной линии BHK-21/SUSP/ARRIAH и представляющий собой суспензию, содержащую преимущественно 146S иммуногенный компонент вируса ящура в эффективном количестве.1. Avirulent and purified antigen of the foot-and-mouth disease virus strain "O/ARRIAH/Mya-98", obtained preferably in the suspension continuous cell line BHK-21/SUSP/ARRIAH and representing a suspension containing predominantly the 146S immunogenic component of the foot-and-mouth disease virus in an effective amount.
2. Авирулентный и очищенный антиген штамма «O/ARRIAH/Mya-98» вируса ящура, полученный предпочтительно в суспензионной перевиваемой культуре клеток BHK-21/SUSP/ARRIAH и представляющий собой суспензию, содержащую преимущественно 146S иммуногенный компонент вируса ящура в количестве не менее 5,0 мкг в 1,0 см3 готового вакцинного препарата.2. Avirulent and purified antigen of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98”, obtained preferably in a suspension continuous culture of BHK-21/SUSP/ARRIAH cells and representing a suspension containing predominantly the 146S immunogenic component of the foot-and-mouth disease virus in an amount of at least 5 .0 mcg in 1.0 cm 3 of the finished vaccine preparation.
3. Из целевых добавок вакцина содержит масляный адъювант Montanide ISA-71 R VG.3. Among the targeted additives, the vaccine contains the oil adjuvant Montanide ISA-71 R VG.
4. Вакцина содержит масляный адъювант Montanide ISA-71 R VG в количестве 70% (по массе) в 1,0 см3 готового препарата.4. The vaccine contains the oil adjuvant Montanide ISA-71 R VG in an amount of 70% (by weight) per 1.0 cm 3 of the finished product.
5. Авирулентный и очищенный антиген штамма «O/ARRIAH/Mya-98» вируса ящура, полученный предпочтительно в перевиваемой суспензионной клеточной линии BHK-21/SUSP/ARRIAH, масляный адъювант Montanide ISA-71 R VG, добавка в готовом препарате в виде поддерживающей среды в следующих количествах:5. Avirulent and purified antigen of the strain “O/ARRIAH/Mya-98” of the foot-and-mouth disease virus, obtained preferably in the continuous suspension cell line BHK-21/SUSP/ARRIAH, oil adjuvant Montanide ISA-71 R VG, additive in the finished preparation in the form of a supporting medium in the following quantities:
Предлагаемая вакцина против ящура из штамма «O/ARRIAH/Mya-98» культуральная инактивированная эмульсионная обладает высокой иммуногенной активностью и обеспечивает надежную защиту против вируса ящура штамма «O/ARRIAH/Mya-98» и близкородственных ему изолятов и штаммов.The proposed cultural inactivated emulsion vaccine against foot-and-mouth disease from the strain "O/ARRIAH/Mya-98" has high immunogenic activity and provides reliable protection against the foot-and-mouth disease virus strain "O/ARRIAH/Mya-98" and closely related isolates and strains.
Достижение технического результата от использования изобретения обеспечивается тем, что в состав предлагаемой противоящурной эмульсионной вакцины в качестве активного вещества введен антиген штамма «O/ARRIAH/Mya-98» вируса ящура, обладающий высокой иммуногенной активностью, создающий эффективную защиту восприимчивых животных против вируса ящура штамма «O/ARRIAH/Mya-98» и близкородственных ему изолятов и штаммов, которые в последние годы вызывают вспышки заболевания ящуром в мире.Achieving a technical result from the use of the invention is ensured by the fact that the composition of the proposed anti-foot-and-mouth disease emulsion vaccine contains as an active substance the antigen of the strain "O/ARRIAH/Mya-98" of the foot-and-mouth disease virus, which has high immunogenic activity, creating effective protection of susceptible animals against the foot-and-mouth disease virus strain " O/ARRIAH/Mya-98" and closely related isolates and strains that have caused outbreaks of foot-and-mouth disease in the world in recent years.
Сущность изобретения отражена на графическом изображении:The essence of the invention is reflected in the graphic image:
Фиг. 1. - Дендрограмма, отражающая филогенетическое взаимоотношение штамма «O/ARRIAH/Mya-98» вируса ящура с эпизоотическими штаммами серологического типа О. Дендрограмма основана на сравнении полных нуклеотидных последовательностей 1D-гена (соответствует белку VP1).Fig. 1. - Dendrogram reflecting the phylogenetic relationship of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” with epizootic strains of serological type O. The dendrogram is based on a comparison of the complete nucleotide sequences of the 1D gene (corresponds to the VP protein1).
Сущность изобретения пояснена следующими перечнями последовательностей:The essence of the invention is illustrated by the following sequence lists:
SEQ ID NO:1 представляет последовательность нуклеотидов гена, кодирующего белок VP1 штамма «O/ARRIAH/Mya-98» вируса ящура;SEQ ID NO:1 represents the nucleotide sequence of the gene encoding the VP 1 protein of the foot and mouth disease virus strain "O/ARRIAH/Mya-98";
SEQ ID NO:2 представляет последовательность аминокислот белка VP1 штамма «O/ARRIAH/Mya-98» вируса ящура.SEQ ID NO:2 represents the amino acid sequence of the VP 1 protein of the foot and mouth disease virus strain "O/ARRIAH/Mya-98".
Штамм «O/ARRIAH/Mya-98» вируса ящура характеризуется следующими признаками и свойствами.The foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” is characterized by the following characteristics and properties.
Морфологические признакиMorphological characteristics
Штамм «O/ARRIAH/Mya-98» вируса ящура имеет следующую таксономию: сфера Riboviria, царство Orthornavirae, тип Pisuviricota, класс Pisoniviricetes, отряд Picornavirales, семейство Picornaviridae, род Aphthovirus, вид Foot-and-mouth disease virus, серотип О, генотип O/SEA/Mya-98. The foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” has the following taxonomy: sphere Riboviria , kingdom Orthornavirae , phylum Pisuviricota , class Pisoniviricetes , order Picornavirales , family Picornaviridae , genus Aphthovirus , species Foot-and-mouth disease virus , serotype O , genotype O/SEA/Mya-98.
Штамм обладает морфологическими признаками, характерными для возбудителя ящура: форма вириона иксаэдрическая, размер 24 нм. Вирион состоит из молекулы одноцепочечной положительно заряженной молекулы РНК и 60 копий полипептида, каждый из которых представлен белками VP4, VP2, VP3, VP1.The strain has morphological characteristics characteristic of the causative agent of foot-and-mouth disease: the shape of the virion is ixahedral, size 24 nm. The virion consists of a single-stranded positively charged RNA molecule and 60 copies of a polypeptide, each of which is represented by the proteins VP 4 , VP 2 , VP 3 , VP 1 .
Антигенные свойстваAntigenic properties
По антигенным свойствам штамм «O/ARRIAH/Mya-98» вируса ящура относится к серотипу О. Вирус стабильно нейтрализуется гомологичной антисывороткой. Вирус не проявляет гемагглютинирующей активности. У переболевших животных в сыворотке крови образуются типоспецифические антитела, выявляемые в иммуноферментном анализе (ИФА) и реакции микронейтрализации (РМН). According to its antigenic properties, the strain “O/ARRIAH/Mya-98” of the foot-and-mouth disease virus belongs to serotype O. The virus is stably neutralized by a homologous antiserum. The virus does not exhibit hemagglutinating activity. In recovered animals, type-specific antibodies are formed in the blood serum, which are detected in enzyme-linked immunosorbent assay (ELISA) and microneutralization reaction (RMN).
Методом нуклеотидного секвенирования была определена первичная структура 1D-гена белка VP1 штамма «O/ARRIAH/Mya-98» вируса ящура. Сравнительный анализ нуклеотидных последовательностей показал, что штамм «O/ARRIAH/Mya-98» вируса ящура принадлежит к генотипу O/SEA/Mya-98 (Фиг. 1).The primary structure of the VP protein 1D gene was determined using nucleotide sequencing1 strain "O/ARRIAH/Mya-98" of the foot-and-mouth disease virus. Comparative analysis of nucleotide sequences showed that the strain “O/ARRIAH/Mya-98” of the foot-and-mouth disease virus belongs to the genotype O/SEA/Mya-98 (Fig. 1).
Антигенное родство (r1) штамма «O/ARRIAH/Mya-98» вируса ящура изучено в РМН, в перекрестном исследовании штамма со специфическими сыворотками, полученными на производственные штаммы вируса ящура.The antigenic affinity (r 1 ) of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” was studied at the Russian Medical Research Institute, in a cross-study of the strain with specific sera obtained for production strains of the foot-and-mouth disease virus.
Титр референтных сывороток крови КРС, полученных путем иммунизации животных моновалентными вакцинами из производственных штаммов вируса ящура серотипа О, против 102 ТЦД50 гомологичного и гетерологичного вируса определяли в РМН при перекрестном титровании, рассчитывая значения с использованием уравнения линейной регрессии, и выражали в lg. Значение r1 определяли, как антилогарифм разности lg титров сыворотки против гетерологичного и гомологичного вируса [10-12].The titer of reference cattle blood sera obtained by immunizing animals with monovalent vaccines from production strains of foot-and-mouth disease virus serotype O against 10 2 TCD 50 of homologous and heterologous virus was determined in the RMN during cross-titration, calculating the values using a linear regression equation, and expressed in lg. The r 1 value was determined as the antilogarithm of the difference in serum lg titers against heterologous and homologous viruses [10-12].
Значение r1 в РМН интерпретировали следующим образом:The value of r 1 in the RMN was interpreted as follows:
при ≥ 0,3 - исследуемый и производственный штаммы вируса ящура являются родственными;at ≥ 0.3 - the studied and production strains of foot-and-mouth disease virus are related;
при < 0,3 - исследуемый образец штамма вируса ящура значительно отличается от производственного штамма.at <0.3 - the studied sample of the foot-and-mouth disease virus strain differs significantly from the production strain.
Максимальное родство отмечается при значении r1 в РМН, стремящимся к 1,0.Maximum relatedness is observed when the value of r 1 in the RMN tends to 1.0.
Показатели антигенного родства при изучении штамма «O/ARRIAH/Mya-98» составили r1 от 0,19 до 0,28, что свидетельствует об отсутствии явного антигенного родства с производственными штаммами вируса ящура серотипа О. Так антигенное родство штамма «O/ARRIAH/Mya-98» с производственными штаммами составляло: Indicators of antigenic relatedness when studying the strain “O/ARRIAH/Mya-98” amounted to r 1 from 0.19 to 0.28, which indicates the absence of obvious antigenic relatedness with production strains of foot-and-mouth disease virus serotype O. Thus, the antigenic relatedness of the strain “O/ARRIAH” /Mya-98" with production strains was:
«О №2212/Приморский/2014» (генотип O/SEA/Mya-98) (прототип) - 0,28,“O No. 2212/Primorsky/2014” (genotype O/SEA/Mya-98) (prototype) - 0.28,
«О №1715/Тайвань/1997» (генотип O/CATHAY/CAM 94) - 0,13, “O No. 1715/Taiwan/1997” (genotype O/CATHAY/CAM 94) - 0.13,
«О №2147/Приморский/2012» (генотип O/ME-SA/PanAsia) - 0,23,“O No. 2147/Primorsky/2012” (genotype O/ME-SA/PanAsia) - 0.23,
«О №2008/Саудовская Аравия/2008» (генотип O/ME-SA/PanAsia2) - 0,20,“O No. 2008/Saudi Arabia/2008” (genotype O/ME-SA/PanAsia2) - 0.20,
«О №2311/Забайкальский/2016» (генотип O/ME-SA/Ind-2001d) - 0,19.“O No. 2311/Zabaikalsky/2016” (genotype O/ME-SA/Ind-2001d) - 0.19.
Гено- и хемотаксономическая характеристикиGeno- and chemotaxonomic characteristics
Штамм «O/ARRIAH/Mya-98» вируса ящура является РНК(+) - содержащим вирусом с молекулярной массой 8,08×106 Д. Нуклеиновая кислота представлена одноцепочной линейной молекулой молекулярной массой 2,83×106 Д. Вирион имеет белковую оболочку, состоящую из четырех основных белков VP1, VP2, VP3 и VP4. Основным антигенным белком является VP1. В вирионе содержится приблизительно 31,5% РНК и 68,5% белка. Вирусная РНК является инфекционной и участвует в образовании белков-предшественников в инфицированных клетках. Предшественники, в свою очередь, расщепляются с образованием более стабильных структурных и неструктурных полипептидов вируса. The “O/ARRIAH/Mya-98” strain of foot-and-mouth disease virus is an RNA(+)-containing virus with a molecular weight of 8.08×10 6 D. The nucleic acid is represented by a single-chain linear molecule with a molecular weight of 2.83×10 6 D. The virion has a protein shell, consisting of four main proteins VP 1 , VP 2 , VP 3 and VP 4 . The main antigenic protein is VP 1 . The virion contains approximately 31.5% RNA and 68.5% protein. Viral RNA is infectious and is involved in the formation of precursor proteins in infected cells. The precursors, in turn, are cleaved to form more stable structural and nonstructural polypeptides of the virus.
Физические свойстваPhysical properties
Масса вириона составляет 8,4×10-18 г. Плавучая плотность 1,42 г/см3.The mass of the virion is 8.4×10 -18 g. The buoyant density is 1.42 g/cm 3 .
Устойчивость к внешним факторамResistance to external factors
Штамм «O/ARRIAH/Mya-98» вируса ящура устойчив к эфиру, хлороформу, и ацетону. Наиболее стабилен при pH 7,45-7,70. Сдвиги pH в кислую и сильно щелочную сторону ведут к инактивации вируса. Чувствителен к формальдегиду, УФ-облучению, γ-облучению, высоким температурам (выше 38,1°С).Strain "O/ARRIAH/Mya-98" of foot and mouth disease virus is resistant to ether, chloroform, and acetone. Most stable at pH 7.45-7.70. Shifts in pH to the acidic and strongly alkaline side lead to inactivation of the virus. Sensitive to formaldehyde, UV irradiation, γ-irradiation, high temperatures (above 38.1°C).
Дополнительные признаки и свойства штамма вируса ящураAdditional characteristics and properties of the foot and mouth disease virus strain
Реактогенность - реактогенными свойствами не обладает.Reactogenicity - does not have reactogenic properties.
Патогенность - антиген не патогенен для парнокопытных животных.Pathogenicity - the antigen is not pathogenic for artiodactyl animals.
Вирулентность - антиген не вирулентен для естественно-восприимчивых животных при контактном, аэрозольном и парентеральном заражении.Virulence - the antigen is not virulent for naturally susceptible animals during contact, aerosol and parenteral infection.
Стабильность - неинактивированный вирус сохраняет исходные биологические свойства при пассировании в чувствительных биологических системах в течение 5 пассажей (срок наблюдения) на перевиваемых культурах.Stability - the non-inactivated virus retains its original biological properties when passaged in sensitive biological systems for 5 passages (observation period) on continuous cultures.
Биотехнологические характеристикиBiotechnological characteristics
Штамм «O/ARRIAH/Mya-98» вируса ящура репродуцируется в перевиваемых культурах клеток: почки сибирского горного козерога (ПСГК-30), почки свиньи (IB-RS-2), почки сирийского хомячка (ВНК-21). The foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” is reproduced in continuous cell cultures: Siberian mountain ibex kidneys (PSGK-30), pig kidneys (IB-RS-2), Syrian hamster kidneys (VNK-21).
При испытании было проведено 5 последовательных пассажей штамма «O/ARRIAH/Mya-98» вируса ящура в перевиваемых культурах клеток ПСГК-30, ВНК-21, IB-RS-2. Биологические свойства характеризовали путем определения инфекционной активности вируса каждого пассажа в перевиваемой клеточной линии IB-RS-2 и на естественно восприимчивых животных - крупном рогатом скоте (КРС) и свиньях.During the test, 5 consecutive passages of the “O/ARRIAH/Mya-98” strain of foot-and-mouth disease virus were carried out in continuous cell cultures of PSGK-30, BNK-21, IB-RS-2. Biological properties were characterized by determining the infectious activity of the virus of each passage in the continuous cell line IB-RS-2 and in naturally susceptible animals - cattle (cattle) and pigs.
Для снижения эпизоотической опасности возникновения ящура, вызванного штаммом «O/ARRIAH/Mya-98» и близкородственными ему изолятами, а также предотвращения возникновения новых очагов болезни важна своевременная вакцинопрофилактика, что требует разработки безопасной и эффективной вакцины.To reduce the epizootic risk of foot and mouth disease caused by the strain “O/ARRIAH/Mya-98” and closely related isolates, as well as to prevent the emergence of new foci of the disease, timely vaccine prevention is important, which requires the development of a safe and effective vaccine.
Получена безопасная и эффективная вакцина против ящура серотипа О из штамма «O/ARRIAH/Mya-98» культуральная инактивированная эмульсионная. A safe and effective vaccine against foot-and-mouth disease serotype O has been obtained from strain “O/ARRIAH/Mya-98” culture inactivated emulsion.
Сущность предлагаемого изобретения пояснена примерами его использования, которые не ограничивают объем изобретения.The essence of the proposed invention is illustrated by examples of its use, which do not limit the scope of the invention.
Пример 1. Генетическая характеристика штамма «O/ARRIAH/Mya-98» вируса ящура по данным ПЦР и нуклеотидного секвенированияExample 1. Genetic characteristics of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” according to PCR and nucleotide sequencing data
Проводили анализ первичной структуры гена 1D (белок VP1) штамма «O/ARRIAH/Mya-98» вируса ящура методом нуклеотидного секвенирования методом Сенгера и определении положения данного штамма на филогенетическом древе вируса ящура серотипа О. Метод основан на определении первичной структуры гена 1D (вирусный белок VP1) испытуемого изолята/штамма с последующим анализом филогенетического родства с другими изолятами/штаммами (30 представителей) вируса ящура серотипа О.The primary structure of the 1D gene (VP 1 protein) of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” was analyzed by nucleotide sequencing using the Sanger method and the position of this strain was determined on the phylogenetic tree of the foot-and-mouth disease virus serotype O. The method is based on determining the primary structure of the 1D gene ( viral protein VP 1 ) of the tested isolate/strain, followed by analysis of phylogenetic relationship with other isolates/strains (30 representatives) of foot-and-mouth disease virus serotype O.
Было необходимо провести сравнительный анализ нуклеотидных последовательностей гена 1D, кодирующего белок VP1 вируса ящура вакцинного штамма «O/ARRIAH/Mya-98» с другими изолятами и штаммами. It was necessary to conduct a comparative analysis of the nucleotide sequences of the 1D gene encoding the VP 1 protein of the foot-and-mouth disease virus vaccine strain “O/ARRIAH/Mya-98” with other isolates and strains.
Осуществлен филогенетический анализ для штамма «O/ARRIAH/Mya-98». Филогенетическое дерево выведено с использованием программы MEGA X и алгоритма Neighbor-Joining [20, 21]. Процент повторяющихся ветвей, в которых связанные таксоны сгруппированы вместе в тесте начальной загрузки (увеличили со стандартных 100 до 500 повторов для высокой степени достоверности), показан рядом с ветвями [22]. Эволюционные расстояния были рассчитаны с использованием метода Maximum Composite Likelihood и выражены в единицах количества замен оснований на сайт. Этот анализ включал 30 нуклеотидных последовательностей, в том числе последовательность 1D-гена штамма «O/ARRIAH/Mya-98» вируса ящура. Все позиции, содержащие пробелы и отсутствующие данные, были удалены (вариант полного удаления). В окончательном наборе данных было всего 666 позиций. Эволюционный анализ проводился в MEGA X.A phylogenetic analysis was carried out for the strain “O/ARRIAH/Mya-98”. The phylogenetic tree was derived using the MEGA X program and the Neighbor-Joining algorithm [20, 21]. The percentage of replicate branches in which related taxa cluster together in the bootstrap test (increased from the standard 100 to 500 replicates for high confidence) is shown next to the branches [22]. Evolutionary distances were calculated using the Maximum Composite Likelihood method and expressed in units of the number of base substitutions per site. This analysis included 30 nucleotide sequences, including the sequence of the 1D gene of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98”. All items containing spaces and missing data were removed (complete deletion option). There were a total of 666 items in the final data set. Evolutionary analysis was carried out in MEGA X.
В результате проведенной работы по сравнению полных нуклеотидных последовательностей гена 1D (белок VP1) штамма «O/ARRIAH/Mya-98» и других изолятов/штаммов вируса ящура серотипа О определено положение исследуемого штамма на филогенетическом древе (фиг. 1). Таким образом, исследуемый штамм «O/ARRIAH/Mya-98» относится к генотипу O/SEA/Mya-98, что подтверждают данные нуклеотидного и аминокислотного анализа.As a result of the work carried out by comparing the complete nucleotide sequences of the 1D gene (VP 1 protein) of the strain “O/ARRIAH/Mya-98” and other isolates/strains of foot-and-mouth disease virus serotype O, the position of the studied strain on the phylogenetic tree was determined (Fig. 1). Thus, the studied strain “O/ARRIAH/Mya-98” belongs to the O/SEA/Mya-98 genotype, which is confirmed by nucleotide and amino acid analysis data.
Пример 2. Адаптация штамма «O/ARRIAH/Mya-98» к перевиваемой монослойной культуре клеток почки сибирского горного козерога ПСГК-30Example 2. Adaptation of the strain “O/ARRIAH/Mya-98” to a continuous monolayer culture of kidney cells of the Siberian mountain ibex PSGK-30
Для заражения перевиваемой монослойной культуры клеток почки сибирского горного козерога ПСГК-30 использовали 10%-ную афтозную суспензию вируса ящура, полученную из афт свиньи (2 пассаж). Посевная концентрация клеток составляла 0,20-0,25 млн кл./см3, доза заражения вирусом - 0,001 ТЦД50/кл. По результатам исследования репродукция вируса ящура штамма «O/ARRIAH/Mya-98» проходила при специфическом разрушении монослоя на 90-100% за 22-24 ч. В течение 6 последовательных пассажей отмечали рост значений титра инфекционной активности вируса от 6,50±0,10 до 7,93±0,10 lg ТЦД50/см3.To infect a continuous monolayer cell culture of Siberian mountain ibex kidney cells PSGK-30, a 10% aphthous suspension of foot-and-mouth disease virus obtained from pig aphthae (passage 2) was used. The inoculating cell concentration was 0.20-0.25 million cells/cm 3 , the virus infection dose was 0.001 TCD 50 /cell. According to the results of the study, the reproduction of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” took place with a specific destruction of the monolayer by 90-100% in 22-24 hours. Over the course of 6 consecutive passages, an increase in the titer of infectious activity of the virus from 6.50 ± 0 was noted .10 to 7.93±0.10 lg TCD 50 /cm 3 .
Максимальное значение титра инфекционной активности вируса было достигнуто на этапе 6 пассажа (7,93±0,10 lg ТЦД50/см3). Концентрация 146S частиц с 1 по 6 пассажи изменялась с 0,44±0,02 до 1,12±0,02 мкг/см3. При этом наибольшее количество 146S компонента отмечали на этапе 6 пассажа (1,12±0,02 мкг/см3). Степень достоверности (R2) результатов исследования в количественном варианте ОТ-ПЦР-РВ колебалась от 98,11 до 100,00%. Таким образом, на протяжении 6-ти последовательных пассажей была успешно проведена адаптация штамма «O/ARRIAH/Mya-98» вируса ящура к перевиваемой монослойной клеточной линии ПСГК-30. The maximum titer of infectious activity of the virus was achieved at stage 6 of passage (7.93±0.10 lg TCD 50 /cm 3 ). The concentration of 146S particles from passages 1 to 6 changed from 0.44±0.02 to 1.12±0.02 μg/ cm3 . In this case, the largest amount of the 146S component was noted at stage 6 of passage (1.12±0.02 μg/cm 3 ). The degree of reliability (R 2 ) of the study results in the quantitative version of RT-PCR-RT ranged from 98.11 to 100.00%. Thus, over the course of 6 consecutive passages, the adaptation of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” to the continuous monolayer cell line PSGK-30 was successfully carried out.
Пример 3. Изучение условий монослойного культивирования вируса ящура штамма «O/ARRIAH/Mya-98» в промышленных масштабахExample 3. Study of conditions for monolayer cultivation of foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” on an industrial scale
В процессе промышленного культивирования штамма «O/ARRIAH/Mya-98» вируса ящура в перевиваемой монослойной культуре клеток ПСГК-30 осуществляли подбор оптимальных условий культивирования вируса по поддерживающей среде, температурному фактору и дозе заражения исследуемым вирусом клеток.In the process of industrial cultivation of the strain “O/ARRIAH/Mya-98” of the foot-and-mouth disease virus in a continuous monolayer cell culture PSGK-30, the optimal conditions for cultivating the virus were selected according to the supporting medium, temperature factor and dose of infection of the cells with the test virus.
На первом этапе исследования оценивали влияние состава поддерживающей среды на репродукцию штамма «O/ARRIAH/Mya-98» вируса ящура в монослойной культуре клеток ПСГК-30 в масштабах производства (на этапе с 5-го на 6-ой пассажи). Для сравнения применяли три среды с добавлением 2,0% фетальной сыворотки крови телят: 1) среда Игла DMEM; 2) среда RPMI-1640; 3) раствор Хэнкса. Посевная концентрация клеток составляла 0,25 млн кл./см3, доза заражения вирусом - 0,1000-0,0001 ТЦД50/кл. Культивирование вируса осуществляли при температурах 35±0,02 - 38±0,02°С до разрушения клеточного монослоя не менее 85%. At the first stage of the study, we assessed the effect of the composition of the supporting medium on the reproduction of the “O/ARRIAH/Mya-98” strain of foot-and-mouth disease virus in a monolayer culture of PSGK-30 cells on a production scale (at the stage from the 5th to the 6th passages). For comparison, three media were used with the addition of 2.0% fetal calf serum: 1) Eagle's medium DMEM; 2) RPMI-1640 environment; 3) Hanks solution. The inoculating cell concentration was 0.25 million cells/cm 3 , the dose of virus infection was 0.1000-0.0001 TCD 50 /cell. Cultivation of the virus was carried out at temperatures of 35±0.02 - 38±0.02°C until the cell monolayer was destroyed by at least 85%.
Результаты репродукции штамма «O/ARRIAH/Mya-98» вируса ящура с поддерживающими средами разного состава отражены в таблице 1, из которой видно, что при репродукции штамма «O/ARRIAH/Mya-98» вируса ящура в монослойной культуре клеток ПСГК-30 с применением поддерживающих сред разного состава, оптимальной является среда Хэнкса, позволяющая за 16-17 ч достичь специфического разрушения клеточного монослоя на 95-100% с накоплением в полученной суспензии 146S компонента в количестве 1,01±0,02 мкг/см3 и титром инфекционной активности 7,92±0,10 lg ТЦД50/см3. При использовании среды RPMI-1640 и Игла DMEM показатели репродукции вируса были ниже.The results of the reproduction of the strain “O/ARRIAH/Mya-98” of the foot-and-mouth disease virus with supporting media of different compositions are reflected in Table 1, from which it can be seen that when the strain “O/ARRIAH/Mya-98” of the foot-and-mouth disease virus is reproduced in a monolayer cell culture PSGK-30 using supporting media of different compositions, the optimal one is Hanks' medium, which allows in 16-17 hours to achieve specific destruction of the cell monolayer by 95-100% with the accumulation of the 146S component in the resulting suspension in an amount of 1.01 ± 0.02 μg/cm 3 and titer infectious activity 7.92±0.10 lg TCD 50 /cm 3 . Viral reproduction rates were lower when using RPMI-1640 and Eagle DMEM media.
На следующем этапе изучения условий монослойного культивирования штамма «O/ARRIAH/Mya-98» вируса ящура в культуре клеток ПСГК-30 в условиях производства оценивали влияние на процесс репродукции вируса температурного фактора. Для этого культивирование вируса проводили в растворе Хэнкса с 5% ГБК и 2% сыворотки крови КРС при следующих температурах: 35,0±0,02; 36,0±0,02; 37,0±0,02; 38,0±0,02°С. Доза заражения культуры клеток вирусом ящура составляла 0,010-0,001 ТЦД50/кл. Культивирование вируса осуществляли до разрушения клеточного монослоя на 85-100% в течение 16-27 ч (табл. 1). По итогам исследования выявили, что для полной репродукции штамма «O/ARRIAH/Mya-98» вируса ящура в монослойной культуре клеток ПСГК-30 оптимальной является температура среды 37,0±0,02°С, при которой за 16-17 ч развитие ЦПД достигало 95-100% с накоплением 146S частиц, равным 1,01±0,02 мкг/см3 и титром инфекционной активности вируса 7,92±0,10 lg ТЦД50/см3.At the next stage of studying the conditions for monolayer cultivation of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” in the PSGK-30 cell culture under production conditions, the influence of the temperature factor on the virus reproduction process was assessed. To do this, the virus was cultivated in Hanks' solution with 5% HBA and 2% cattle serum at the following temperatures: 35.0±0.02; 36.0±0.02; 37.0±0.02; 38.0±0.02°C. The dose of infection of the cell culture with the foot-and-mouth disease virus was 0.010-0.001 TCD 50 /cell. The virus was cultivated until the cell monolayer was destroyed by 85-100% within 16-27 hours (Table 1). Based on the results of the study, it was revealed that for complete reproduction of the “O/ARRIAH/Mya-98” strain of foot-and-mouth disease virus in a monolayer culture of PSGK-30 cells, the optimal environmental temperature is 37.0 ± 0.02 ° C, at which the development of The CPE reached 95-100% with the accumulation of 146S particles equal to 1.01±0.02 μg/cm 3 and the titer of infectious activity of the virus 7.92±0.10 lg TCD 50 /cm 3 .
Оценивали влияние дозы заражения монослоя клеток линии ПСГК-30 штаммом «O/ARRIAH/Mya-98» при культивировании в масштабах производства. Для этого использовали разные дозы вируса: 0,10-0,01; 0,010-0,001; 0,0010-0,0001 ТЦД50/кл. В качестве поддерживающей среды применяли раствор Хэнкса с 5% ГБК и 2% сыворотки крови КРС. Репродукцию вируса проводили при температуре 37,0±0,2°С в течение 17-29 ч до специфического разрушения клеток на 90-100%. По итогам культивирования определяли концентрацию 146S компонента и титр инфекционной активности вируса ящура. Как следует из данных таблицы 1, наибольшее накопление 146S компонента вируса достигалось при дозе заражения 0,01-0,001 ТЦД50/кл. и составило 1,01±0,02 мкг/см3 с титром инфекционной активности вируса 7,92±0,10 lg ТЦД50/см3.We assessed the effect of the dose of infection of a monolayer of PSGK-30 cells with the strain “O/ARRIAH/Mya-98” during cultivation on a production scale. For this, different doses of the virus were used: 0.10-0.01; 0.010-0.001; 0.0010-0.0001 TCD 50 /cl. Hanks' solution with 5% HBA and 2% cattle blood serum was used as a supporting medium. Virus reproduction was carried out at a temperature of 37.0±0.2°C for 17-29 hours until specific cell destruction was 90-100%. Based on the results of cultivation, the concentration of the 146S component and the titer of infectious activity of the foot-and-mouth disease virus were determined. As follows from the data in Table 1, the greatest accumulation of the 146S component of the virus was achieved at an infection dose of 0.01-0.001 TCD 50 /cell. and amounted to 1.01 ± 0.02 μg/cm 3 with a titer of infectious activity of the virus of 7.92 ± 0.10 lg TCD 50 / cm 3 .
Таким образом, проведено изучение условий монослойного культивирования штамма «O/ARRIAH/Mya-98» вируса ящура в культуре клеток ПСГК-30 в промышленных масштабах. В результате исследования определены следующие оптимальные параметры репродукции штамма «O/ARRIAH/Mya-98» вируса ящура в монослойной клеточной линии ПСГК-30: 1) поддерживающая среда - раствор Хэнкса с 5% ГБК и 2% сыворотки крови КРС; 2) температурный режим культивирования - 37,0±0,020С; 3) доза заражения вирусом - 0,01-0,001 ТЦД50/кл.Thus, the conditions for monolayer cultivation of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” in PSGK-30 cell culture on an industrial scale were studied. As a result of the study, the following optimal parameters for the reproduction of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” in the monolayer cell line PSGK-30 were determined: 1) maintenance medium - Hanks solution with 5% HBA and 2% cattle serum; 2) cultivation temperature - 37.0±0.02 0 C; 3) dose of virus infection - 0.01-0.001 TCD 50 / cell.
Пример 4. Изучение условий суспензионного культивирования штамма «O/ARRIAH/Mya-98» вируса ящура в промышленных масштабахExample 4. Study of conditions for suspension cultivation of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” on an industrial scale
При промышленном культивирования штамма «O/ARRIAH/Mya-98» вируса ящура в перевиваемой суспензионной культуре клеток ВНК-21/SUSP/ARRIAH проводили поиск оптимальных параметров для успешной репродукции возбудителя ящура, используя разные концентрации клеток, температурные условия и дозу заражения вирусом.During industrial cultivation of the strain “O/ARRIAH/Mya-98” foot-and-mouth disease virus in a continuous suspension culture of BHK-21/SUSP/ARRIAH cells, we searched for optimal parameters for successful reproduction of the foot-and-mouth disease pathogen, using different cell concentrations, temperature conditions and the dose of virus infection.
На первом этапе работы определяли влияние посевной концентрации клеток линии ВНК-21/SUSP/ARRIAH в суспензии на репродукцию штамма «O/ARRIAH/Mya-98» вируса ящура в промышленных масштабах. Для анализа подготовили суспензии со следующими концентрации клеток: 2,5; 3,0; 3,5; 4,0 млн кл./см3. Концентрацию катионов водорода (рН) поддерживали в диапазоне 7,50-7,70. Температура культивирования вируса составляла 37,0±0,02°С, доза заражения вирусом - 0,010-0,001 ТЦД50/кл. Репродукцию вируса проводили до специфической гибели клеток на 95-100%, которая осуществлялась в течение 9-28 ч. Результаты суспензионного культивирования штамма «O/ARRIAH/Mya-98» вируса ящура в суспензии с разными концентрациями клеток представлены в таблице 2. At the first stage of the work, the effect of the seeding concentration of cells of the BNK-21/SUSP/ARRIAH line in suspension on the reproduction of the strain “O/ARRIAH/Mya-98” was determined. foot-and-mouth disease virus on an industrial scale. Suspensions with the following cell concentrations were prepared for analysis: 2.5; 3.0; 3.5; 4.0 million cells/cm3. The hydrogen cation concentration (pH) was maintained in the range of 7.50-7.70. The virus cultivation temperature was 37.0±0.02°C, the virus infection dose was 0.010-0.001 TCD50/cl. Virus reproduction was carried out until specific cell death was 95-100%, which occurred within 9-28 hours. Results of suspension cultivation of the strain “O/ARRIAH/Mya-98” foot and mouth disease virus in suspension with different cell concentrations are presented in Table 2.
Как следует из таблицы 2, при культивировании вируса ящура штамма «O/ARRIAH/Mya-98» в суспензионной клеточной линии ВНК-21/SUSP/ARRIAH с разными концентрациями клеток, определили, что накопление 146S компонента в суспензии с концентрацией клеток 2,5 млн кл./см3 составило 0,98±0,02 мкг/см3, с концентрацией 3,0 млн кл./см3 - 1,45±0,02 мкг/см3, с концентрацией 3,5 млн кл./см3 - 2,78±0,02 мкг/см3, и с концентрацией 4,0 млн кл./см3 - 2,75±0,02 мкг/см3. Как следует из полученных данных для репродукции штамма «O/ARRIAH/Mya-98» вируса ящура достаточной является концентрация клеток ВНК-21/SUSP/ARRIAH в суспензии, равная 3,5 млн кл./см3 (при концентрации 4,0 млн кл./см3 концентрация незначительно ниже, а затраты на производство по количеству клеток выше, исходя из этого, экономически целесообразно использовать концентрацию клеток, равную 3,5 млн кл./см3). Значение титра инфекционной активности вируса при этом составило 10,14±0,10 lg ТЦД50/см3.As follows from Table 2, when cultivating the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” in the suspension cell line BNK-21/SUSP/ARRIAH with different cell concentrations, it was determined that the accumulation of the 146S component in a suspension with a cell concentration of 2.5 million cells/cm3was 0.98±0.02 μg/cm3, with a concentration of 3.0 million cells/cm3- 1.45±0.02 μg/cm3, with a concentration of 3.5 million cells/cm3 - 2.78±0.02 μg/cm3, and with a concentration of 4.0 million cells/cm3- 2.75±0.02 μg/cm3. As follows from the data obtained for the reproduction of the strain “O/ARRIAH/Mya-98” foot and mouth disease virus, a sufficient concentration of BHK-21/SUSP/ARRIAH cells in suspension is equal to 3.5 million cells/cm3 (at a concentration of 4.0 million cells/cm3the concentration is slightly lower, and the production costs for the number of cells are higher; based on this, it is economically feasible to use a cell concentration equal to 3.5 million cells/cm3). The titer of infectious activity of the virus was 10.14±0.10 lg TCD50/cm3.
На следующем этапе работы исследовали влияние температурного фактора на репродукцию штамма «O/ARRIAH/Mya-98» вируса ящура в суспензионной культуре клеток линии ВНК-21/SUSP/ARRIAH в промышленных масштабах. Для этого репродукцию вируса проводили при следующих температурных условиях: 35,0±0,02; 36,0±0,02; 37,0±0,02; 38,0±0,02°С. Доза заражения культуры клеток вирусом составляла 0,010-0,001 ТЦД50/кл. Водородный показатель рН вирусной суспензии поддерживали в диапазоне 7,50-7,70. Культивирование вируса проводили до ЦПД, равного не менее 85% (приоритет отдавали полной специфической деструкции клеток), в течение 9-28 ч. По результатам анализа определили, что для полной репродукции штамма «O/ARRIAH/Mya-98» вируса ящура в суспензионной культуре клеток ВНК-21/SUSP/ARRIAH оптимальной является температура среды 37,0±0,02°С, при которой в течение 9-10 ч наблюдается специфическая гибель клеток на 95-100% с высоким накоплением 146S компонента (2,78±0,02 мкг/см3) и титром инфекционной активности вируса 10,14±0,10 lg ТЦД50/см3.At the next stage of work, we studied the influence of the temperature factor on the reproduction of the strain “O/ARRIAH/Mya-98” foot-and-mouth disease virus in a suspension culture of cells of the BHK-21/SUSP/ARRIAH line on an industrial scale. For this purpose, virus reproduction was carried out under the following temperature conditions: 35.0±0.02; 36.0±0.02; 37.0±0.02; 38.0±0.02°C. The dose of infection of the cell culture with the virus was 0.010-0.001 TCD50/cl. The pH value of the viral suspension was maintained in the range of 7.50-7.70. Cultivation of the virus was carried out to a CPE of at least 85% (priority was given to complete specific destruction of cells) for 9-28 hours. Based on the results of the analysis, it was determined that for complete reproduction of the strain “O/ARRIAH/Mya-98” foot-and-mouth disease virus in a suspension culture of BHK-21/SUSP/ARRIAH cells, the optimal temperature is 37.0±0.02°C, at which 95-100% specific cell death is observed within 9-10 hours with a high accumulation of the 146S component ( 2.78±0.02 µg/cm3) and titer of infectious activity of the virus 10.14±0.10 lg TCD50/cm3.
В ходе работы по изучению условий суспензионного культивирования штамма «O/ARRIAH/Mya-98» вируса ящура в промышленных масштабах с применением культуры клеток ВНК-21/SUSP/ARRIAH оценивали влияние дозы заражения клеток. Для этого клеточные суспензии заражали вирусом в разных дозах: 0,10-0,01; 0,01-0,001; 0,001-0,0001 ТЦД50/кл. Репродукцию вируса осуществляли при температуре 37,0±0,2°С в течение 9-24 ч до цитопатического действия, равного не менее 90%. По итогам культивирования определяли концентрацию 146S частиц и титр инфекционной активности вируса ящура. Как видно из данных таблицы 2, наибольшее накопление 146S компонента отмечали при дозе заражения 0,010-0,001 ТЦД50/кл. (2,78±0,02 мкг/см3) с титром инфекционной активности вируса, равным 10,14±0,10 lg ТЦД50/см3.In the course of work to study the conditions for suspension cultivation of the strain “O/ARRIAH/Mya-98” foot-and-mouth disease virus on an industrial scale using the BHK-21/SUSP/ARRIAH cell culture, the effect of the dose of cell infection was assessed. To do this, cell suspensions were infected with the virus in different doses: 0.10-0.01; 0.01-0.001; 0.001-0.0001 TCD50/cl. Virus reproduction was carried out at a temperature of 37.0±0.2°C for 9-24 hours until the cytopathic effect was at least 90%. Based on the results of cultivation, the concentration of 146S particles and the titer of infectious activity of the foot-and-mouth disease virus were determined. As can be seen from the data in Table 2, the greatest accumulation of the 146S component was noted at an infection dose of 0.010-0.001 TCD50/cl. (2.78±0.02 µg/cm3) with a virus infectious activity titer equal to 10.14±0.10 lg TCD50/cm3.
Таким образом, проведено изучение трех параметров суспензионного культивирования штамма «O/ARRIAH/Mya-98» вируса ящура в суспензионной клеточной линии ВНК-21/SUSP/ARRIAH в промышленных масштабах. Выявлены оптимальные условия репродукции штамма «O/ARRIAH/Mya-98» в суспензионной культуре клеток ВНК-21/SUSP/ARRIAH: 1) концентрация клеток перед заражением - 3,5 млн кл./см3; 2) температурный режим культивирования - 37,0±0,02°С; 3) доза заражения вирусом - 0,010-0,001 ТЦД50/кл.Thus, three parameters of suspension cultivation of the strain “O/ARRIAH/Mya-98” were studied. foot-and-mouth disease virus in the suspension cell line BHK-21/SUSP/ARRIAH on an industrial scale. Optimal conditions for the reproduction of the strain “O/ARRIAH/Mya-98” in a suspension culture of BNK-21/SUSP/ARRIAH cells were identified: 1) cell concentration before infection - 3.5 million cells/cm3; 2) cultivation temperature - 37.0±0.02°C; 3) dose of virus infection - 0.010-0.001 TCD50/cl.
Пример 5. Инактивация суспензии вируса ящура штамма «O/ARRIAH/Mya-98»Example 5. Inactivation of a suspension of foot and mouth disease virus strain “O/ARRIAH/Mya-98”
По окончании цикла репродукции вируса ящура, не прекращая процесс термостатирования (37,0±0,01°С), в вируссодержащую суспензию добавляли подкисленный раствор 1,2-аминоэтилэтиленимина (1,2-АЭЭИ) с рН, равным 8,3-8,4. Конечная концентрация АЭЭИ в вируссодержащей суспензии должна быть равной 0,024%. Инактивацию инфекционной активности вируса ящура штамма «O/ARRIAH/Mya-98» проводили в течение 12 часов при температуре 37,0±0,1°С и рН 7,50-7,70 с периодическим перемешиванием.At the end of the reproduction cycle of the foot-and-mouth disease virus, without stopping the thermostatting process (37.0±0.01°C), an acidified solution of 1,2-aminoethylethyleneimine (1,2-AEEI) with a pH of 8.3-8 was added to the virus-containing suspension ,4. The final concentration of AEEI in the virus-containing suspension should be equal to 0.024%. Inactivation of the infectious activity of the foot and mouth disease virus strain "O/ARRIAH/Mya-98" was carried out for 12 hours at a temperature of 37.0±0.1°C and pH 7.50-7.70 with periodic stirring.
Для определения времени полной инактивации после добавления 1,2-АЭЭИ каждый час производили отбор проб. Полученные образцы проверяли на наличие инфекционной активности вируса ящура в первичной культуре клеток почки свиньи СП. Результаты представлены в таблице 3, из данных которой видно, что полная инактивация вируса ящура штамма «O/ARRIAH/Mya-98», репродуцированного в культиваторах, произошла через 6 часов после внесения инактиванта.To determine the time of complete inactivation after the addition of 1,2-AEEI, samples were taken every hour. The obtained samples were tested for the presence of infectious activity of the foot-and-mouth disease virus in the primary culture of pig kidney cells SP. The results are presented in Table 3, from which it can be seen that complete inactivation of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” reproduced in cultivators occurred 6 hours after the addition of the inactivant.
Готовые вирусные инактивированные суспензии исследовали в РСК для оценки содержания в них компонентов вируса. Концентрация 146S компонента составила 2,73±0,02 мкг/см3 (73%), а 146S+75S компонента - 3,61±0,02 мкг/см3 (96,5%).The prepared inactivated viral suspensions were examined at the RSC to assess the content of virus components in them. The concentration of the 146S component was 2.73±0.02 μg/cm 3 (73%), and the 146S+75S component was 3.61±0.02 μg/cm 3 (96.5%).
Пример 6. Подбор условий очистки суспензии вируса ящура штамма «O/ARRIAH/Mya-98»Example 6. Selection of conditions for purification of a suspension of foot-and-mouth disease virus strain “O/ARRIAH/Mya-98”
Суспензию вируса ящура штамма «O/ARRIAH/Mya-98», полученную при репродукции в суспензионной клеточной линии ВНК-21/SUSP/ARRIAH, подвергали инактивации и очистке. Для получения очищенного антигена вируса ящура использовали полигексаметиленгуанидин (ПГМГ) с концентрациями 0,020, 0,025 и 0,030%. До и после процесса очистки антигена вируса ящура штамма «O/ARRIAH/Mya-98» в количественном варианте РСК определяли концентрацию общего вирусного белка и иммуногенных компонентов. Результаты анализа отражены в таблице 4, из которой следует, что в результате очистки антигена вируса ящура штамма «O/ARRIAH/Mya-98» с помощью ПГМГ в концентрации 0,020% отмечали снижение концентрации балластного белка на 8%, иммуногенных компонентов - на 2%. При использовании ПГМГ в концентрации 0,025% наблюдали снижение количества балластного белка на 22%, 146S компонента - на 2,5%. Применяя ПГМГ в концентрации 0,030% содержание балластного белка уменьшалось на 36%, а иммуногенных компонентов - на 18%. A suspension of foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” obtained during reproduction in the suspension cell line BHK-21/SUSP/ARRIAH was subjected to inactivation and purification. To obtain purified foot-and-mouth disease virus antigen, polyhexamethylene guanidine (PHMG) was used with concentrations of 0.020, 0.025 and 0.030%. Before and after the antigen purification process of foot and mouth disease virus strain “O/ARRIAH/Mya-98” in the quantitative version of RSC, the concentration of total viral protein and immunogenic components was determined. The results of the analysis are reflected in table 4, from which it follows that as a result of purification of the antigen of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” Using PHMG at a concentration of 0.020%, a decrease in the concentration of ballast protein by 8% and immunogenic components by 2% was noted. When using PHMG at a concentration of 0.025%, a decrease in the amount of ballast protein by 22% and the 146S component by 2.5% was observed. Using PHMG at a concentration of 0.030%, the content of ballast protein decreased by 36%, and immunogenic components by 18%.
Таким образом, исследуя условия очистки антигена штамма «O/ARRIAH/Mya-98», пришли к выводу о том, что, с точки зрения экономической целесообразности, для получения очищенного продукта оптимально использовать ПГМГ с концентрацией 0,025%.Thus, by studying the conditions for purifying the antigen of the “O/ARRIAH/Mya-98” strain, we came to the conclusion that, from the point of view of economic feasibility, it is optimal to use PHMG with a concentration of 0.025% to obtain a purified product.
Пример 7. Подбор условий концентрирования суспензии антигена штамма «O/ARRIAH/Mya-98» вируса ящураExample 7. Selection of conditions for concentrating an antigen suspension of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98”
Культуральную инактивированною суспензию штамма «O/ARRIAH/Mya-98», полученную с применением суспензионной клеточной линии ВНК-21/SUSP/ARRIAH, подвергали концентрированию в 6 раз по объему. Для увеличения концентрации иммуногенных компонентов антигена вируса ящура использовали следующие приемы: 1) добавление полиэтиленгликоля (ПЭГ-6000) с концентрацией 50% к антигену в соотношении 1:4, с экспозицией 4 ч; 2) добавление полиэтиленгликоля с молекулярным весом 6000 Да (ПЭГ-6000) с концентрацией 50% к антигену в соотношении 1:4, с экспозицией 12 ч; 3) концентрирование с помощью установки тангенциальной фильтрации Centramate 500S Pall в течение 4 ч при рабочем давлении на фильтр 2,2-2,3 атм.A cultural inactivated suspension of the strain “O/ARRIAH/Mya-98”, obtained using the suspension cell line BNK-21/SUSP/ARRIAH, was concentrated 6 times by volume. To increase the concentration of immunogenic components of the foot-and-mouth disease virus antigen, the following methods were used: 1) adding polyethylene glycol (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 4 hours; 2) adding polyethylene glycol with a molecular weight of 6000 Da (PEG-6000) with a concentration of 50% to the antigen in a ratio of 1:4, with an exposure of 12 hours; 3) concentration using a tangential filtration unit Centramate 500S Pall for 4 hours at an operating pressure on the filter of 2.2-2.3 atm.
До и после процесса концентрирования суспензии антигена вируса ящура штамма «O/ARRIAH/Mya-98» определяли концентрацию общего вирусного белка и иммуногенных компонентов в количественном варианте РСК. Результаты исследований представлены в таблице 5, из которой видно, что при концентрировании антигена штамма «O/ARRIAH/Mya-98» вируса ящура с помощью ПЭГ-6000 в течение 4 ч отмечали увеличение содержания компонентов по сравнению с исходными значениями (до концентрирования) в 4,4 раз. Используя тот же полимер, но повышая время воздействия до 12 ч, увеличили концентрацию компонентов вируса в 5,1 раза. Применяя метод концентрирования с помощью тангенциальной фильтрации, удалось увеличить количество иммуногенных компонентов антигена штамма «O/ARRIAH/Mya-98» вируса ящура в суспензии в 5,9 раз. Таким образом, технология танценциальной фильтрации позволила получить антиген штамма «O/ARRIAH/Mya-98» с высокой концентрацией структурных вирусных белков.Before and after the process of concentrating the antigen suspension of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” The concentration of total viral protein and immunogenic components in the quantitative version of CSC was determined. The research results are presented in Table 5, from which it can be seen that when concentrating the antigen of the strain “O/ARRIAH/Mya-98” foot-and-mouth disease virus using PEG-6000 for 4 hours, an increase in the content of components was noted compared to the initial values (before concentration) by 4.4 times. Using the same polymer, but increasing the exposure time to 12 hours, we increased the concentration of virus components by 5.1 times. Using the concentration method using tangential filtration, it was possible to increase the amount of immunogenic components of the O/ARRIAH/Mya-98 strain antigen. foot and mouth disease virus in suspension by 5.9 times. Thus, dance filtration technology made it possible to obtain the antigen of the “O/ARRIAH/Mya-98” strain with a high concentration of structural viral proteins.
Пример 8. Подбор адъюванта и соотношения антиген-адъювантExample 8. Selection of adjuvant and antigen-adjuvant ratio
Для изготовления противоящурной моновалентной эмульсионной вакцины из антигена штамма «O/ARRIAH/Mya-98» в качестве адъюванта была выбран масляный адъювант Montanide ISA-71 R VG. При изготовлении данного вакцинного препарата использовали масляный адъювант Montanide ISA-71 R VG в количестве 70% по массе.For the production of foot-and-mouth disease monovalent emulsion vaccine from the antigen of the strain “O/ARRIAH/Mya-98” Montanide ISA-71 R VG oil adjuvant was chosen as an adjuvant. In the manufacture of this vaccine preparation, the oil adjuvant Montanide ISA-71 R VG was used in an amount of 70% by weight.
Пример 9. Компоновка вакцины против ящура из штамма «O/ARRIAH/Mya-98» культуральной инактивированной эмульсионнойExample 9. Composition of a vaccine against foot-and-mouth disease from the strain “O/ARRIAH/Mya-98” in a culture-inactivated emulsion
Из полученного концентрата антигена вируса ящура штамма «O/ARRIAH/Mya-98» изготовили вакцину против ящура культуральную инактивированную эмульсионную с применением в качестве адъюванта - масляный адъювант Montanide ISA-71 R VG. Количество 146S иммуногенного компонента в 1,0 см3 антигена составило 15,69±0,02 мкг/см3 (таблица 5).From the resulting concentrate of the antigen of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98”, a cultural inactivated emulsion vaccine against foot-and-mouth disease was prepared using Montanide ISA-71 R VG oil adjuvant as an adjuvant. The amount of 146S immunogenic component per 1.0 cm 3 of antigen was 15.69 ± 0.02 μg/cm 3 (Table 5).
Пример 10. Иммунизация животных вакциной против ящура из штамма «O/ARRIAH/Mya-98» культуральной инактивированной эмульсионнойExample 10. Immunization of animals with a vaccine against foot and mouth disease from the strain "O/ARRIAH/Mya-98" cultural inactivated emulsion
Из полученной вакцины против ящура из штамма «O/ARRIAH/Mya-98» культуральной инактивированной эмульсионной (предлагаемое изобретение) был приготовлен ряд разведений для свиней с 5-ти кратным шагом. Свиней разделили на 3 группы по 5 голов в каждой и 2 головы оставили без вакцинации в качестве контроля вируса. Иммунизирующая доза составляла 2,0 см3. Первую группу животных (№№ 1-5) иммунизировали вакциной без разведения, вторую группу свиней (№№ 6-10) привили вакциной, разведенной 1/5, третья группа животных (№№ 11-15) - вакциной, разведенной 1/25. Препарат вводили внутримышечно в среднюю треть шеи.From the resulting vaccine against foot and mouth disease from the strain “O/ARRIAH/Mya-98”, a cultural inactivated emulsion (the proposed invention), a series of dilutions for pigs were prepared in 5-fold increments. The pigs were divided into 3 groups of 5 heads each and 2 heads were left without vaccination as a virus control. The immunizing dose was 2.0 cm 3 . The first group of animals (No. 1-5) were immunized with the vaccine without dilution, the second group of pigs (No. 6-10) were vaccinated with the vaccine diluted 1/5, the third group of animals (No. 11-15) - with the vaccine diluted 1/25 . The drug was administered intramuscularly into the middle third of the neck.
Пример 11. Исследование сывороток крови вакцинированных животных на наличие антител к неструктурным белкам вируса ящураExample 11. Study of blood sera of vaccinated animals for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus
Сыворотки крови от свиней, полученные до иммунизации и через 14 суток после иммунизации, исследовали на наличие антител к неструктурным белкам вируса ящура с помощью блокирующего варианта иммуноферментного анализа (ИФА) в соответствии с рекомендациями OIE (МЭБ) [3]. Тестирование полученных сывороток проводили с использованием тест-системы для ИФА «Prio CHECK®FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs» (Prionics Lelystad B.V., Нидерланды). Полученные результаты исследований отражены в таблице 6, из которой видно, что сыворотки крови животных не содержали антител к неструктурным белкам вируса ящура (значения PI для сывороток крови свиней < 50%).Blood sera from pigs obtained before immunization and 14 days after immunization were examined for the presence of antibodies to non-structural proteins of the foot-and-mouth disease virus using a blocking enzyme-linked immunosorbent assay (ELISA) in accordance with OIE recommendations [3]. The obtained sera were tested using the ELISA test system “Prio CHECK ® FMDV NSP ELISA for in vitro detection of antibodies against Foot and Mouth Disease Virus in serum of cattle, sheep and pigs” (Prionics Lelystad BV, the Netherlands). The research results obtained are reflected in Table 6, from which it can be seen that the animal blood sera did not contain antibodies to non-structural proteins of the foot-and-mouth disease virus (PI values for pig blood sera < 50%).
Пример 12. Оценка авирулентности и безвредности вакцины против ящура из штамма «O/ARRIAH/Mya-98» культуральной инактивированной эмульсионной (предлагаемое изобретение)Example 12. Assessment of the avirulence and safety of the vaccine against foot-and-mouth disease from the strain "O/ARRIAH/Mya-98" cultural inactivated emulsion (the proposed invention)
Для определения авирулентности вакцины для свиней отобранную пробу вакцинного препарата вводили внутрикожно по 0,1 см3. В исследовании использовали свиней массой 30-40 кг. В течение 10 суток наблюдения животные остались клинически здоровыми, и при патологоанатомическом исследовании не было обнаружено изменений, характерных для ящура. Это свидетельствовало об отсутствии вирулентных свойств разработанной вакцины.To determine the avirulence of the vaccine for pigs, a selected sample of the vaccine preparation was injected intradermally at 0.1 cm 3 . The study used pigs weighing 30-40 kg. During 10 days of observation, the animals remained clinically healthy, and the pathological examination did not reveal any changes characteristic of foot-and-mouth disease. This indicated the absence of virulent properties of the developed vaccine.
Контроль безвредности продукта на животных проводили путём внутримышечного введения вакцины в дозе 6,0 см3 (тройная доза по 2,0 см3). Срок наблюдения также составлял 10 суток. Следует отметить, что после иммунизации температура тела животного может повышаться до 41,8°С и удерживаться на этом уровне в течение 1-2 суток, что не выходит за рамки нормы после введения вакцинного препарата.Control of the safety of the product in animals was carried out by intramuscular injection of the vaccine at a dose of 6.0 cm 3 (triple dose of 2.0 cm 3 ). The observation period was also 10 days. It should be noted that after immunization, the animal’s body temperature can rise to 41.8°C and remain at this level for 1-2 days, which does not go beyond the norm after administration of the vaccine preparation.
По результатам исследований вакцина против ящура из штамма «O/ARRIAH/Mya-98» культуральная инактивированная эмульсионная (предлагаемое изобретение) была признана безвредной, все животные в период наблюдения оставались клинически здоровыми, при патологоанатомическом анализе некроза тканей на месте введения вакцины не обнаружено.According to the results of the study, the cultural inactivated emulsion vaccine against foot-and-mouth disease from the strain “O/ARRIAH/Mya-98” (the proposed invention) was found to be harmless, all animals remained clinically healthy during the observation period, and no tissue necrosis was detected at the site of vaccine administration during the pathological analysis.
Пример 13. Изучение иммуногенных свойств вакцины против ящура из штамма «O/ARRIAH/Mya-98» культуральной инактивированной эмульсионной (предлагаемое изобретение) по способности индуцирования вируснейтрализующих антител у естественно восприимчивых животныхExample 13. Study of the immunogenic properties of the vaccine against foot-and-mouth disease from the strain "O/ARRIAH/Mya-98" cultural inactivated emulsion (the proposed invention) by the ability to induce virus-neutralizing antibodies in naturally susceptible animals
На 21 сутки после введения вакцины против ящура из штамма «O/ARRIAH/Mya-98» генотипа O/SEA/Mya-98 культуральной инактивированной эмульсионной (предлагаемое изобретение) у свиней отбирали кровь и проводили исследование полученных сывороток крови в реакции микронейтрализации [3]. Выявлено, что у свиней, иммунизированных вакциной в цельной дозе (5 голов), средние значения титра антител составили 8,05±0,11 log2 SN50, с разведением 1/5 (5 голов) - 4,85±0,14 log2 SN50, с разведением 1/25 (5 голов) - 3,10±0,34 log2 SN50 (таблица 7). Полученные данные РМН свидетельствуют о том, что после введения вакцины в цельном виде обеспечивается формирование гуморального иммунитета с защитными титрами штаммоспецифических антител (5,5 и более log2 SN50), что соответствует требованиям международных стандартов [3].On the 21st day after the administration of the vaccine against foot and mouth disease from the strain “O/ARRIAH/Mya-98” genotype O/SEA/Mya-98 cultural inactivated emulsion (the proposed invention), blood was taken from pigs and the resulting blood sera were studied in a microneutralization reaction [3] . It was revealed that in pigs immunized with the vaccine in a whole dose (5 heads), the average antibody titer was 8.05±0.11 log 2 SN 50 , with a dilution of 1/5 (5 heads) - 4.85±0.14 log 2 SN 50 , with dilution 1/25 (5 heads) - 3.10±0.34 log 2 SN 50 (Table 7). The RMN data obtained indicate that after administration of the vaccine in its entirety, the formation of humoral immunity with protective titers of strain-specific antibodies (5.5 or more log 2 SN 50 ) is ensured, which meets the requirements of international standards [3].
Пример 14. Контрольное заражение естественно восприимчивых животныхExample 14: Challenge of Naturally Susceptible Animals
Свиньи, иммунизированные в количестве 15 голов, вакциной в цельном виде и в разведениях, заражали контрольным штаммом «O/ARRIAH/Mya-98» вируса ящура, адаптированного к этим животным в дозе 104,0 ИД50/0,20 см3 (в две точки по 0,10±0,05 см3). Спустя 7 суток после заражения всех животных подвергли эвтаназии и провели патологоанатомический осмотр. Защищенными от ящура считали животных, у которых на конечностях отсутствовали поражения. Первичные афты не учитывали.Pigs immunized in the amount of 15 heads with the vaccine in whole form and in dilutions were infected with the control strain “O/ARRIAH/Mya-98” of the foot-and-mouth disease virus adapted to these animals at a dose of 10 4.0 ID 50 /0.20 cm 3 ( in two points of 0.10±0.05 cm 3 ). 7 days after infection, all animals were euthanized and a postmortem examination was performed. Animals that had no lesions on their limbs were considered protected from foot and mouth disease. Primary aphthae were not taken into account.
Результаты контрольного заражения представлены в таблице 7, из которой следует, что вакцина против ящура из штамма «O/ARRIAH/Mya-98» культуральная инактивированная эмульсионная (предлагаемое изобретение) в цельном виде, а также в разведении 1/5, введенная в однократной дозе (2,0 см3) защищает свиней от заражения гомологичным штаммом всех животных (5 из 5 голов). После заражения свиней, инокулированных вакциной в разведении 1/25, из 5 голов заболела 1 свинья (здоровых 4 из 5).The results of the control infection are presented in Table 7, from which it follows that the vaccine against foot and mouth disease from the strain “O/ARRIAH/Mya-98” is a cultural inactivated emulsion (the proposed invention) in whole form, as well as in a 1/5 dilution, administered in a single dose (2.0 cm3) protects pigs from infection with a homologous strain of all animals (5 out of 5 heads). After infection of pigs inoculated with the vaccine at a dilution of 1/25, 1 pig out of 5 got sick (4 out of 5 were healthy).
По результатам контрольного заражения было установлено, что в прививном объеме данной вакцины содержится 40,52 ПД50 и 0,05 ИмД50 для свиней.Based on the results of the control infection, it was found that the vaccination volume of this vaccine contains 40.52 PD 50 and 0.05 ImD 50 for pigs.
Таким образом, приведенная выше информация свидетельствует о том, что вакцина против ящура серотипа О из штамма «O/ARRIAH/Mya-98» культуральная инактивированная эмульсионная, воплощающая предлагаемое изобретение, предназначена как резервная для использования в сельском хозяйстве, а именно в ветеринарной вирусологии и биотехнологии; подтверждена возможность осуществления представленного; вакцина, изготовленная из штамма «O/ARRIAH/Mya-98» в соответствии с предлагаемым изобретением, обладает высокой иммуногенной активностью и способна обеспечить эффективную защиту восприимчивых животных против эпизоотического штамма вируса ящура серотипа О.Thus, the above information indicates that the vaccine against foot-and-mouth disease serotype O from the strain “O/ARRIAH/Mya-98”, a cultural inactivated emulsion embodying the invention, is intended as a reserve for use in agriculture, namely in veterinary virology and biotechnology; the possibility of implementing the presented has been confirmed; vaccine made from the O/ARRIAH/Mya-98 strain in accordance with the proposed invention, has high immunogenic activity and is capable of providing effective protection of susceptible animals against the epizootic strain of foot-and-mouth disease virus serotype O.
Источники информацииInformation sources
1. Ящур. Меры профилактики. URL: http://89.rospotrebnadzor.ru /directions/epid_nadzor/146902 (Дата обращения: 14.07.2023).1. Foot and mouth disease. Prevention measures. URL: http://89.rospotrebnadzor.ru /directions/epid_nadzor/146902 (Date of access: 07/14/2023).
2. Опасность болезни ящура. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Дата обращения: 04.08.2023).2. The danger of foot and mouth disease. URL: https://vet.astrobl.ru/press-release/opasnost-bolezni-yashchura (Date of access: 08/04/2023).
3. OIE. Manual of diagnostic tests and vaccines for terrestrial animals - 24th Ed. - Paris, 2022 - Vol. 1, Chapter 2.1.5.3. OIE. Manual of diagnostic tests and vaccines for terrestrial animals - 24th Ed. - Paris, 2022 - Vol. 1, Chapter 2.1.5.
4. Бурдов А.Н., Дудников А.И., Малярец П.В. и др. Ящур. - М.: Агропромиздат, 1990. - 320 с.4. Burdov A.N., Dudnikov A.I., Malyarets P.V. and others. Foot and mouth disease. - M.: Agropromizdat, 1990. - 320 p.
5. Пономарев А.П., Узюмов В.Л., Груздев К.Н. Вирус ящура: структура, биологические и физико-химические свойства. - Владимир: Фолиант, 2006. - 250 с.5. Ponomarev A.P., Uzyumov V.L., Gruzdev K.N. Foot and mouth disease virus: structure, biological and physicochemical properties. - Vladimir: Folio, 2006. - 250 p.
6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.6. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.
7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strateies: Proc. Jnt. Symp. 2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.7. Brown F. A brief history of FMD and its casual agent. FMD: Control Strategies: Proc. Jnt. Symp. 2-5. June 2002, Lyons, France. - Paris, 2003. - p. 13-21.
8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J. M. Pachecoa, Т. Doel [et.al.] // Vaccine. - December 2005. - V. 23. - P. 5775-5782.8. Vaccination against foot-and-mouth disease virus confers complete clinical protection in 7 days and partial protection in 4 days: Use in emergency outbreak response / T.G. William, J. M. Pachecoa, T. Doel [et.al.] // Vaccine. - December 2005. - V. 23. - P. 5775-5782.
9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M/ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.9. Aspects of emergency vaccination against foot-and-mouth disease / P. Barnett, J.M./ Garland, R.P. Kitching [et.al.] // Comparative Immunology, Microbiology and Infectious Diseases. - October 2002. - V. 25. - P. 345-364.
10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.10. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.
11. Официальный сайт The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wrlfmd.org/ref_labs/fmd_ref_lab_
reports.htm (Дата обращения 15.07.2023).11. Official website of The FAO World Reference Laboratory for Foot-and-Mouth Disease - URL: http://www.wrlfmd.org/ref_labs/fmd_ref_lab_
reports.htm (Date of access: 07/15/2023).
12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - Р. 746-754.12. Salt I.S. Emergency vaccination of pigs against foot-and-mouth disease: protection against disease and reduction in contact transmission / Vaccine. - April 1998. - V. 16. - R. 746-754.
13. Рахманов А.М. Современная эпизоотическая ситуация в мире по ящуру и меры ее контроля //Ветеринарная медицина мiжвiд. тем. наук. Харкiв, 2013. - С. 37-38.13. Rakhmanov A.M. Current epizootic situation in the world regarding foot and mouth disease and measures for its control // Veterinary medicine of the interspecies. topics Sci. Kharkiv, 2013. - pp. 37-38.
14. Longjam N., Tayo T. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol. 4(10). - P. 475-479.14. Longjam N., Tayo T. Antigenic variation of Foot and Mouth Disease Virus // Vet. World. - 2011. - Vol. 4(10). - P. 475-479.
15. Paton D.J., Sumption K.J., Charleston B. Options for control of foot-and-mouth disease: knowledge, capability and policy/ Phil. Trans. R. Soc. B (2009) 364. - P. 2657-2667.15. Paton D.J., Sumption K.J., Charleston B. Options for control of foot-and-mouth disease: knowledge, capability and policy/ Phil. Trans. R. Soc. B (2009) 364. - pp. 2657-2667.
16. Патент № 2 665 849 Вакцина инактивированная эмульсионная против ящура типа О / Заявка: 2017144155, 2017.12.15. Опубликовано: 2018.09.04.16. Patent No. 2 665 849 Inactivated emulsion vaccine against foot and mouth disease type O / Application: 2017144155, 2017.12.15. Published: 2018.09.04.
17. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.17. Barnett P.V. A review of emergency foot-and-mouth disease (FMD) vaccines / Vaccine. - February 2002. - V. 20. - P. 1505-1514.
18. Методические рекомендации по определению концентрации 146S, 75S, 12S компонентов вакцинных штаммов культурального вируса ящура в реакции связывания комплемента (РСК) / ФГБУ «ВНИИЗЖ». - Утв. 21.09.17.18. Methodological recommendations for determining the concentration of 146S, 75S, 12S components of vaccine strains of cultural foot-and-mouth disease virus in the complement fixation reaction (FRR) / Federal State Budgetary Institution "ARRIAH". - Approved 09.21.17.
19. Методические указания по определению антигенного соответствия между эпизоотическими изолятами и производственными штаммами вируса ящура в перекрестной реакции микронейтрализации: утв. Россельхознадзором 13.09.2017 / ФГБУ «ВНИИЗЖ». - Владимир: 2017. - 24 с.19. Guidelines for determining antigenic correspondence between epizootic isolates and production strains of foot-and-mouth disease virus in a cross-microneutralization reaction: approved. Rosselkhoznadzor 09/13/2017 / FSBI "ARRIAH". - Vladimir: 2017. - 24 p.
20. Saitou N. and Nei M. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4:406-42.20. Saitou N. and Nei M. (1987). The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4:406–42.
21. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap. Evolution 39:783-791.21. Felsenstein J. (1985). Confidence limits on phylogenies: An approach using the bootstrap. Evolution 39:783–791.
22. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101:11030-11035.22. Tamura K., Nei M., and Kumar S. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proceedings of the National Academy of Sciences (USA) 101:11030–11035.
Результаты адаптации штамма «O/ARRIAH/Mya-98» вируса ящура при культивировании в перевиваемой монослойной культуре клеток ПСГК-30 при разных условиях
(n=3, M±m, p<0,01) Table 1
Results of adaptation of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” when cultivated in a continuous monolayer culture of PSGK-30 cells under different conditions
(n=3, M±m, p<0.01)
Примечание: SКРС - сыворотка крови крупного рогатого скота, Note: S cattle - blood serum of cattle,
ГБК - гидролизат белков крови, GBK - blood protein hydrolysate,
DMEM - название среды Игла,DMEM is the name of Eagle's medium.
RPMI-1640 - название культуральной среды, RPMI-1640 is the name of the culture medium,
ЦПД - цитопатическое действие.CPD - cytopathic effect.
Результаты репродукции штамма «O/ARRIAH/Mya-98» вируса ящура в перевиваемой суспензионной клеточной линии ВНК-21/SUSP/ARRIAH с разной концентрацией клеток
(n=3, M±m, p<0,01) table 2
Results of reproduction of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” in the continuous suspension cell line BNK-21/SUSP/ARRIAH with different cell concentrations
(n=3, M ± m, p<0.01)
Примечание: ОТ-ПЦР-РВ - обратная транскрипция и полимеразная цепная реакция, Note: RT-PCR-RT - reverse transcription and polymerase chain reaction,
ТЦД - тканевая цитопатическая доза,TCD - tissue cytopathic dose,
ЦПД - цитопатическое действие.CPD - cytopathic effect.
Исследование кинетики инактивации суспензии вируса ящура штамма «O/ARRIAH/Mya-98»
(n=3, M±m, p<0,05) Table 3
Study of the inactivation kinetics of a suspension of foot and mouth disease virus strain “O/ARRIAH/Mya-98”
(n=3, M ± m, p<0.05)
Содержание компонентов штамма «O/ARRIAH/Mya-98» вируса ящура в суспензиях до и после очистки
(n=3, M±m, p<0,005) Table 4
Content of components of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” in suspensions before and after purification
(n=3, M±m, p<0.005)
0,030%PGMG,
0.030%
Примечание: концентрацию балластного белка определяли по формуле Калькара: Note: the concentration of ballast protein was determined using the Kalkar formula:
С=1,45 × А280-0,74 × А260,C=1.45 × A 280 -0.74 × A 260 ,
где А280 - значение оптической плотности при длине волны 280 нм, where A 280 is the optical density value at a wavelength of 280 nm,
А260 - значение оптической плотности при длине волны 260 нм, A 260 - optical density value at a wavelength of 260 nm,
ПГМГ - полигексаметиленгуанидин (флокулянт).PHMG - polyhexamethylene guanidine (flocculant).
Содержание компонентов антигена штамма «O/ARRIAH/Mya-98» вируса ящура в суспензиях до и после концентрирования
(n=3, M±m, p<0,01) Table 5
Content of antigen components of the foot-and-mouth disease virus strain “O/ARRIAH/Mya-98” in suspensions before and after concentration
(n=3, M ± m, p<0.01)
(в 6 раз)Concentration methods
(6 times)
4 чPEG-6000,
4 hours
12 чPEG-6000,
12 h
4 чTangential filtration,
4 hours
Примечание: ПЭГ - полиэтиленгликоль, Note: PEG - polyethylene glycol,
ОВБ - общий вирусный белок.TBV - common viral protein.
Результаты исследования сывороток крови свиней на антитела к неструктурным белкам вируса ящура до и после вакцинации препаратом (предлагаемое изобретение), изготовленным с применением антигена вируса ящура штамма «O/ARRIAH/Mya-98»Table 6
Results of a study of pig blood sera for antibodies to non-structural proteins of the foot-and-mouth disease virus before and after vaccination with a drug (the proposed invention) made using the antigen of the foot-and-mouth disease virus strain "O/ARRIAH/Mya-98"
Примечание: СПК - слабоположительный контроль, Note: SPC is a weak positive control,
ПК - положительный контроль, PC - positive control,
ОК - отрицательный контроль, сыворотка отрицательная при PI, меньшим 50%.OK - negative control, serum negative at PI less than 50%.
Исследование гуморального иммунитета и иммуногенной активности вакцины против ящура из штамма «O/ARRIAH/Mya-98» культуральной инактивированной эмульсионной на свиньях
(n=5, M±m) Table 7
Study of humoral immunity and immunogenic activity of the vaccine against foot and mouth disease from the strain "O/ARRIAH/Mya-98" culture inactivated emulsion in pigs
(n=5, M ± m)
Примечание: «-» отсутствие генерализации процесса ящура, Note: “-” lack of generalization of the FMD process,
РМН - реакция микронейтрализации, RMN - microneutralization reaction,
ИмД50 - иммуногенная доза, ImD 50 - immunogenic dose,
ПД50 - протективная доза.PD 50 is a protective dose.
--->--->
Перечень последовательностейList of sequences
<ST26SequenceListing dtdVersion="V1_3" fileName="FMDV O Vaccine.xml" <ST26SequenceListing dtdVersion="V1_3" fileName="FMDV O Vaccine.xml"
softwareName="WIPO Sequence" softwareVersion="2.1.2" softwareName="WIPO Sequence" softwareVersion="2.1.2"
productionDate="2023-08-23">productionDate="2023-08-23">
<ApplicationIdentification><ApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode><IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText><ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-08-23</FilingDate><FilingDate>2023-08-23</FilingDate>
</ApplicationIdentification></ApplicationIdentification>
<ApplicantFileReference>536</ApplicantFileReference><ApplicantFileReference>536</ApplicantFileReference>
<EarliestPriorityApplicationIdentification><EarliestPriorityApplicationIdentification>
<IPOfficeCode>RU</IPOfficeCode><IPOfficeCode>RU</IPOfficeCode>
<ApplicationNumberText>0</ApplicationNumberText><ApplicationNumberText>0</ApplicationNumberText>
<FilingDate>2023-08-23</FilingDate><FilingDate>2023-08-23</FilingDate>
</EarliestPriorityApplicationIdentification></EarliestPriorityApplicationIdentification>
<ApplicantName languageCode="ru">ФГБУ "Федеральный центр охраны <ApplicantName languageCode="ru">Federal Security Center
здоровья животных" (ФГБУ "ВНИИЗЖ")</ApplicantName>animal health" (FSBI "ARRIAH")</ApplicantName>
<ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin><ApplicantNameLatin>FGBI "ARRIAH"</ApplicantNameLatin>
<InventorName languageCode="ru">Доронин Максим <InventorName languageCode="ru">Doronin Maxim
Игоревич</InventorName>Igorevich</InventorName>
<InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin><InventorNameLatin>Doronin Maksim Igorevich </InventorNameLatin>
<InventionTitle languageCode="ru">Вакцина против ящура серотипа О из <InventionTitle languageCode="en">Vaccine against foot and mouth disease serotype O from
штамма «O/ARRIAH/Mya-98» культуральная инактивированная strain "O/ARRIAH/Mya-98" culture inactivated
эмульсионная</InventionTitle>emulsion</InventionTitle>
<SequenceTotalQuantity>2</SequenceTotalQuantity><SequenceTotalQuantity>2</SequenceTotalQuantity>
<SequenceData sequenceIDNumber="1"><SequenceData sequenceIDNumber="1">
<INSDSeq><INSDSeq>
<INSDSeq_length>666</INSDSeq_length><INSDSeq_length>666</INSDSeq_length>
<INSDSeq_moltype>DNA</INSDSeq_moltype><INSDSeq_moltype>DNA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division><INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table><INSDSeq_feature-table>
<INSDFeature><INSDFeature>
<INSDFeature_key>source</INSDFeature_key><INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..666</INSDFeature_location><INSDFeature_location>1..666</INSDFeature_location>
<INSDFeature_quals><INSDFeature_quals>
<INSDQualifier><INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name><INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>genomic DNA</INSDQualifier_value><INSDQualifier_value>genomic DNA</INSDQualifier_value>
</INSDQualifier></INSDQualifier>
<INSDQualifier id="q1"><INSDQualifier id="q1">
<INSDQualifier_name>organism</INSDQualifier_name><INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value><INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier></INSDQualifier>
</INSDFeature_quals></INSDFeature_quals>
</INSDFeature></INSDFeature>
</INSDSeq_feature-table></INSDSeq_feature-table>
<INSDSeq_sequence>accacttctgcgggcgagtcagcggatcctgtcaccgccactgttgaaaact<INSDSeq_sequence>accacttctgcgggcgagtcagcggatcctgtcaccgccactgttgaaaact
acggtggcgaaacacagatccagaggcgccaacacacggacgtctcgttcatcatggacagatttgtgaaacggtggcgaaacacagatccagaggcgccaacacacggacgtctcgttcatcatggacagatttgtgaa
agtgacaccgcaaaaccaaattaacattttggacctcatgcagattccatcacacactttggtgggagcgagtgacaccgcaaaaccaaattaacattttggacctcatgcagattccatcacacactttggtgggagcg
ctcctacgcgcgtccacttactacttctctgacttggagatagcagtaaaacacgagggagacctcacctctcctacgcgcgtccacttactacttctctgacttggagatagcagtaaaacacgagggagacctcacct
gggttccaaatggagcgcctgaaaaggcgttggacaacaccaccaacccaactgcttaccacaaggcaccgggttccaaatggagcgcctgaaaaggcgttggacaacaccaccaacccaactgcttaccacaaggcacc
actcacccggcttgccctgccctacaccgcgccccaccgcgtgttggcaaccgtgtacaacggtgagtgcactcacccggcttgccctgccctacaccgcgccccaccgcgtgttggcaaccgtgtacaacggtgagtgc
aggtacagcagaaatgctgtgcccaacgtgagaggtgaccttcaggtgttggctcaaaaggtggcacggaaggtacagcagaaatgctgtgcccaacgtgagaggtgaccttcaggtgttggctcaaaaggtggcacgga
cgctgcctacctccttcaactacggtgccatcaaagcgacccgggtcaccgagttgctttaccggatgaacgctgcctacctccttcaactacggtgccatcaaagcgacccgggtcaccgagttgctttaccggatgaa
gagggccgaaacatactgtccaaggcccttgctggcaatccacccaactgaagccagacacaaacagaaagagggccgaaacatactgtccaaggcccttgctggcaatccacccaactgaagccagacacaaacagaaa
attgtggcaccggtgaaacagactttgaattttgaccttctcaagttgcccccc</INSDSeq_sequenattgtggcaccggtgaaacagactttgaattttgaccttctcaagttgcccccc</INSDSeq_sequen
ce>ce>
</INSDSeq></INSDSeq>
</SequenceData></SequenceData>
<SequenceData sequenceIDNumber="2"><SequenceData sequenceIDNumber="2">
<INSDSeq><INSDSeq>
<INSDSeq_length>222</INSDSeq_length><INSDSeq_length>222</INSDSeq_length>
<INSDSeq_moltype>AA</INSDSeq_moltype><INSDSeq_moltype>AA</INSDSeq_moltype>
<INSDSeq_division>PAT</INSDSeq_division><INSDSeq_division>PAT</INSDSeq_division>
<INSDSeq_feature-table><INSDSeq_feature-table>
<INSDFeature><INSDFeature>
<INSDFeature_key>source</INSDFeature_key><INSDFeature_key>source</INSDFeature_key>
<INSDFeature_location>1..222</INSDFeature_location><INSDFeature_location>1..222</INSDFeature_location>
<INSDFeature_quals><INSDFeature_quals>
<INSDQualifier><INSDQualifier>
<INSDQualifier_name>mol_type</INSDQualifier_name><INSDQualifier_name>mol_type</INSDQualifier_name>
<INSDQualifier_value>protein</INSDQualifier_value><INSDQualifier_value>protein</INSDQualifier_value>
</INSDQualifier></INSDQualifier>
<INSDQualifier id="q2"><INSDQualifier id="q2">
<INSDQualifier_name>organism</INSDQualifier_name><INSDQualifier_name>organism</INSDQualifier_name>
<INSDQualifier_value>FMDV</INSDQualifier_value><INSDQualifier_value>FMDV</INSDQualifier_value>
</INSDQualifier></INSDQualifier>
</INSDFeature_quals></INSDFeature_quals>
</INSDFeature></INSDFeature>
</INSDSeq_feature-table></INSDSeq_feature-table>
<INSDSeq_sequence>TTSAGESADPVTATVENYGGETQIQRRQHTDVSFIMDRFVKVTPQNQINILD<INSDSeq_sequence>TTSAGESADPVTATVENYGGETQIQRRQHTDVSFIMDRFVKVTPQNQINILD
LMQIPSHTLVGALLRASTYYFSDLEIAVKHEGDLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYTAPLMQIPSHTLVGALLRASTYYFSDLEIAVKHEGDLTWVPNGAPEKALDNTTNPTAYHKAPLTRLALPYTAP
HRVLATVYNGECRYSRNAVPNVRGDLQVLAQKVARTLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLHRVLATVYNGECRYSRNAVPNVRGDLQVLAQKVARTLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLL
AIHPTEARHKQKIVAPVKQTLNFDLLKLAP</INSDSeq_sequence>AIHPTEARHKQKIVAPVKQTLNFDLLKLAP</INSDSeq_sequence>
</INSDSeq></INSDSeq>
</SequenceData></SequenceData>
</ST26SequenceListing></ST26SequenceListing>
<---<---
Claims (3)
Publications (1)
| Publication Number | Publication Date |
|---|---|
| RU2816944C1 true RU2816944C1 (en) | 2024-04-08 |
Family
ID=
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2798293C1 (en) * | 2022-10-18 | 2023-06-21 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Fmd culture inactivated sorbed vaccine from a/afghanistan/2017 strain of a/asia/iran-05far-11 new genotype |
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2798293C1 (en) * | 2022-10-18 | 2023-06-21 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | Fmd culture inactivated sorbed vaccine from a/afghanistan/2017 strain of a/asia/iran-05far-11 new genotype |
| RU2799605C1 (en) * | 2022-11-23 | 2023-07-07 | Федеральное государственное бюджетное учреждение "Федеральный центр охраны здоровья животных" (ФГБУ "ВНИИЗЖ") | FMD CULTURE INACTIVATED SORBED VACCINE FROM A/Iran/2018 STRAIN OF A/ASIA/Iran-05SIS-13 NEW GENOTYPE |
Non-Patent Citations (1)
| Title |
|---|
| P. Barnett, J.M. Garland, R.P. Kitching. et.al. Aspects of emergency vaccination against foot-and-mouth disease Comparative Immunology, Microbiology and Infectious Diseases, October 2002, V. 25, P. 345-364. * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN101514334B (en) | Chicken infectivity bronchitis virus attenuated vaccine strain and application thereof | |
| DK2331682T3 (en) | INFECTIOUS BRONKITIS VACCINES DERIVED FROM IB-QX SIMILAR TREASURES | |
| AU2017201526C1 (en) | Equine Rhinitis vaccine | |
| RU2603003C1 (en) | Inactivated sorptive vaccine to fmd types a, o, asia-1 | |
| CN111961654B (en) | Heat-resistant phenotype-stable genetic recombinant foot-and-mouth disease virus (FMDV) avirulent strain carrying negative marker and O/A type FMDV bivalent inactivated vaccine | |
| RU2816944C1 (en) | Cultural inactivated emulsion vaccine against foot-and-mouth disease serotype o from strain "o/arriah/mya-98" | |
| RU2816264C1 (en) | Cultural inactivated emulsion vaccine against o/ea-3 genotype foot-and-mouth disease of o n2241/ethiopia/2011 strain | |
| RU2810131C1 (en) | CULTURE INACTIVATED SORBED VACCINE AGAINST FOOT AND MOUTH DISEASE OF O/ME-SA/PanAsia2ANT-10 GENOTYPE FROM O N2356/PAKISTAN/2018 STRAIN | |
| RU2815537C1 (en) | Cultural inactivated emulsion vaccine against foot and mouth disease from o no. 2620/orenburgsky/2021 strain of o/me-sa/ind-2001e genotype | |
| RU2804803C1 (en) | Culture inactivated emulsion vaccine against fmd of o/sea/mya-98 genotype from o n2383/primorsky/2019 strain | |
| RU2799605C1 (en) | FMD CULTURE INACTIVATED SORBED VACCINE FROM A/Iran/2018 STRAIN OF A/ASIA/Iran-05SIS-13 NEW GENOTYPE | |
| RU2817381C1 (en) | Cultural inactivated sorbed vaccine against foot-and-mouth disease from the strain "a/egypt/euro-sa/2022" | |
| RU2804875C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-2/vii genotype from sat-2/eritrea/1998 strain | |
| RU2815534C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-1/i genotype from sat-1/tanzania/2012 strain | |
| RU2809219C1 (en) | Culturally inactivated sorbed vaccine against foot and mouth disease of sat-1/nwz genotype | |
| RU2802192C1 (en) | Inactivated sorbed vaccine against fmd of o/ea-2 genotype from o/kenya/2017 strain culture | |
| AU2016203333B2 (en) | Infectious bronchitis vaccines derived from IB-QX-like strains | |
| RU2815536C1 (en) | Culture inactivated sorbed vaccine against foot and mouth disease from a/tanzania/2013 strain of a/africa/g-i genotype | |
| RU2815541C1 (en) | Culturally inactivated sorbed vaccine against foot and mouth disease of sat-2/iv genotype | |
| RU2810132C1 (en) | Culture inactivated adsorbed vaccine against fmd of sat-1/x genotype from sat-1/nigeria/2015 strain | |
| RU2798293C1 (en) | Fmd culture inactivated sorbed vaccine from a/afghanistan/2017 strain of a/asia/iran-05far-11 new genotype | |
| RU2772713C1 (en) | Vaccine for early protection against foot-and-mouth disease from strain a 2205/g iv cultural inactivated emulsion | |
| CN112279912A (en) | Novel coronavirus poultry egg antibody SARS-CoV-2-IgY preparation and its preparation method and application | |
| RU2806602C1 (en) | Sat-2/kenya/19/2017 strain of aphtae epizooticae foot and mouth disease virus for the manufacture of diagnostic tools and specific prevention of foot and mouth disease virus of sat-2/iv genotype | |
| RU2741639C1 (en) | Vaccine for early protection against foot-and-mouth disease of type asia-1 inactivated emulsion |