RU2532323C2 - Therapeutic agent for treating pathological syndrome and method of treating functional bowel disorders - Google Patents
Therapeutic agent for treating pathological syndrome and method of treating functional bowel disorders Download PDFInfo
- Publication number
- RU2532323C2 RU2532323C2 RU2011124809/15A RU2011124809A RU2532323C2 RU 2532323 C2 RU2532323 C2 RU 2532323C2 RU 2011124809/15 A RU2011124809/15 A RU 2011124809/15A RU 2011124809 A RU2011124809 A RU 2011124809A RU 2532323 C2 RU2532323 C2 RU 2532323C2
- Authority
- RU
- Russia
- Prior art keywords
- antibodies
- activated
- tnf
- potentiated
- histamine
- Prior art date
Links
Landscapes
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
Abstract
Description
Изобретение относится к области медицины и может быть использовано для лечения функциональных нарушений кишечника, в том числе синдрома раздраженного кишечника и нарушения моторно-эвакуаторной функции кишечника.The invention relates to medicine and can be used to treat functional bowel disorders, including irritable bowel syndrome and impaired intestinal motor-evacuation function.
Под функциональными заболеваниями кишечника следует понимать такие заболевания кишечника, когда расстройство его функции происходит не вследствие органического поражения, а в результате нарушения нервной и гуморальной регуляции деятельности пищеварительного тракта (органические поражения кишечника или отсутствуют вовсе, или играют второстепенную роль). Функциональные заболевания кишечника характеризуются отсутствием морфологических изменений (которыми можно было бы объяснить имеющиеся клинические симптомы) и их связью, во-первых, с повышенной возбудимостью моторики, во-вторых, с сенсорной гиперчувствительностью и, в-третьих, с неадекватной реакцией внутренних органов на сигналы центральной нервной системы при воздействии психосоциальных факторов. Функциональные заболевания кишечника являются самым частым видом функциональной патологии желудочно-кишечного тракта и отмечаются у 40-70% больных гастроэнтерологического профиля. На формирование функциональных нарушений кишечника оказывают влияние генетические факторы, факторы окружающей среды, психосоциальные факторы, висцеральная гиперчувствительность и инфекции. Функциональные заболевания кишечника составляют часть большой группы заболеваний желудочно-кишечного тракта, относящихся к функциональной патологии и, согласно классификации функциональных заболеваний кишечника (Римский Консенсус, 1999), включают такие клинические состояния, как синдром раздраженного кишечника, функциональный метеоризм, функциональный запор, функциональную диарею и неспецифические функциональные расстройства кишечника. В патогенезе заболеваний существенную роль играют нарушения двигательной функции желудка и кишечника. Особенностью больных с функциональными заболеваниями кишечника является повышение двигательной и сенсорной реакции, появление боли в животе в ответ на стрессы. Комплекс функциональных расстройств кишечника включает в себя жалобы на боли в животе (обычно уменьшающиеся после дефекации), метеоризм, урчание, чувство неполного опорожнения кишечника, императивные позывы на дефекацию, запоры, поносы или их чередование. Клинические особенности, свойственные всем функциональным заболеваниям желудочно-кишечного тракта: длительное (обычно многолетнее) течение заболевания без заметного прогрессирования; многообразие клинической картины (сочетание болей в животе, диспепсических расстройств и нарушений функций кишечника с головным болями по типу мигрени, нарушениями сна, ощущением кома при глотании, неудовлетворенностью вдоха, невозможностью спать на левом боку, учащенным мочеиспусканием, разнообразными вазоспастическими реакциями и другими вегетативными расстройствами); изменчивый характер жалоб; связь ухудшения самочувствия с психо-эмоциональными факторами.Functional diseases of the intestine should be understood as such diseases of the intestine when the disorder of its function does not occur as a result of organic damage, but as a result of a violation of the nervous and humoral regulation of the digestive tract (organic lesions of the intestine are either absent or play a secondary role). Functional intestinal diseases are characterized by the absence of morphological changes (which could explain the existing clinical symptoms) and their relationship, firstly, with increased excitability of motility, secondly, with sensory hypersensitivity and, thirdly, with an inadequate response of internal organs to signals the central nervous system when exposed to psychosocial factors. Functional intestinal diseases are the most common type of functional pathology of the gastrointestinal tract and are observed in 40-70% of patients with a gastroenterological profile. The formation of functional intestinal disorders is influenced by genetic factors, environmental factors, psychosocial factors, visceral hypersensitivity and infections. Functional bowel diseases form part of a large group of diseases of the gastrointestinal tract related to functional pathology and, according to the classification of functional bowel diseases (Roman Consensus, 1999), include such clinical conditions as irritable bowel syndrome, functional flatulence, functional constipation, functional diarrhea and non-specific functional bowel disorders. In the pathogenesis of diseases, an essential role is played by violations of the motor function of the stomach and intestines. A feature of patients with functional bowel diseases is an increase in motor and sensory reactions, the appearance of abdominal pain in response to stress. The complex of functional intestinal disorders includes complaints of abdominal pain (usually decreasing after a bowel movement), flatulence, rumbling, a feeling of incomplete bowel movement, mandatory urge to defecate, constipation, diarrhea or their alternation. Clinical features common to all functional diseases of the gastrointestinal tract: long-term (usually long-term) course of the disease without noticeable progression; the diversity of the clinical picture (a combination of abdominal pain, dyspeptic disorders and intestinal dysfunctions with headaches such as migraines, sleep disturbances, coma when swallowing, dissatisfaction with inspiration, inability to sleep on the left side, frequent urination, various vasospastic reactions and other autonomic disorders) ; the volatile nature of complaints; connection worsening well-being with psycho-emotional factors.
Синдром раздраженного кишечника (СРК) - одно из наиболее часто встречающихся функциональных заболеваний кишечника, регистрирующееся, как показывают наблюдения последних лет, практически во всех странах мира. Распространенность СРК в большинстве стран мира в среднем составляет 20%, варьируя, по данным различных исследований, от 9 до 48%. Пик заболеваемости приходится на молодой трудоспособный возраст - 30-40 лет. Соотношение женщин и мужчин колеблется от 1:1 до 2:1. Среди мужчин «проблемного» возраста (после 50 лет) СРК распространен так же часто, как среди женщин. Средний возраст пациентов составляет 24-41 год.Irritable bowel syndrome (IBS) is one of the most common functional bowel diseases, which is recorded, as recent observations show, in almost all countries of the world. The prevalence of IBS in most countries of the world averages 20%, varying, according to various studies, from 9 to 48%. The peak incidence occurs in young working age - 30-40 years. The ratio of women to men ranges from 1: 1 to 2: 1. Among men of “problem” age (after 50 years), IBS is as common as among women. The average age of patients is 24-41 years.
Этиология и патогенез СРК сложны и до конца не известны. Наибольшее число исследователей сходятся во мнении о важной роли психоэмоционального стресса в развитии СРК. В зависимости от ведущего симптома выделяются три варианта течения СРК: с преобладающими болями в животе и метеоризмом, с преобладающей диареей и с преобладающими запорами. До 1988 г. СРК описывался под различными названиями, такими как спастический колит, слизистая колика, нервная диарея, раздраженная толстая кишка, функциональный кишечный дистресс-синдром и другими. Эти названия отражали различные симптомы заболевания и не отображали единого понимания проблемы. В 1988 г. в Риме Международная группа по изучению функциональной патологии желудочно-кишечного тракта (ЖКТ) впервые официально утвердила термин «синдром раздраженного кишечника», дала его определение и разработала критерии постановки диагноза, получившие в дальнейшем название «Римские критерии СРК». В 1999 г. критерии были дополнены и приняты «Римские критерии СРК II», а в 2006 г. - «Римские критерии СРК III». В соответствии с «Римскими критериями III» СРК - это устойчивая совокупность функциональных расстройств, проявляющаяся в наличии рецидивирующих болей или дискомфорта в животе, отмечающихся по меньшей мере 3 дня в течение месяца на протяжении последних 3 месяцев и сочетающихся с двумя из трех следующих признаков: боли уменьшаются после акта дефекации; боли сопровождаются изменением частоты стула; боли сопровождаются изменением консистенции стула; эти симптомы должны отмечаться у больных в течение последних 3 месяцев; их общая длительность должна быть не менее 6 месяцев; под дискомфортом следует понимать неприятные ощущения, не описываемые пациентами как боль; для патофизиологических и клинических исследований рекомендуется подбирать больных, у которых боли и дискомфорт отмечаются не менее 2 дней в неделю.The etiology and pathogenesis of IBS are complex and not fully known. Most researchers agree on the important role of psychoemotional stress in the development of IBS. Depending on the leading symptom, three variants of the course of IBS are distinguished: with predominant abdominal pain and flatulence, with predominant diarrhea and with predominant constipation. Until 1988, IBS was described under various names, such as spastic colitis, mucous colic, nervous diarrhea, irritable colon, functional intestinal distress syndrome, and others. These names reflected various symptoms of the disease and did not reflect a common understanding of the problem. In 1988, in Rome, the International Group for the Study of Functional Pathology of the Gastrointestinal tract (GIT) for the first time officially approved the term “irritable bowel syndrome”, gave its definition and developed the criteria for diagnosis, which later became known as the “Roman criteria for IBS”. In 1999, the criteria were supplemented and adopted by the "Roman criteria of IBS II", and in 2006 - the "Roman criteria of IBS III". According to the “Roman Criteria III”, IBS is a stable combination of functional disorders, manifested in the presence of recurring abdominal pain or discomfort, noted for at least 3 days during the month over the past 3 months and combined with two of the following three symptoms: pain decrease after the act of defecation; pain is accompanied by a change in stool frequency; pain is accompanied by a change in the consistency of the stool; these symptoms should be noted in patients within the last 3 months; their total duration should be at least 6 months; discomfort should be understood as unpleasant sensations that are not described by patients as pain; for pathophysiological and clinical studies, it is recommended to select patients in whom pain and discomfort are noted at least 2 days a week.
Из уровня техники известно лекарственное средство для лечения эрозивных и воспалительных заболеваний желудочно-кишечного тракта на основе активированных форм сверхмалых доз антител к морфину и активированных форм сверхмалых доз антител к гистамину (RU 2197266 C1, A61K 39/395, 27.01.2003). Однако данное лекарственное средство не во всех случаях может обеспечить достаточную терапевтическую эффективность для лечения функциональных нарушений кишечника, в том числе синдрома раздраженного кишечника и нарушения моторно-эвакуаторной функции кишечника.A medicine is known from the prior art for the treatment of erosive and inflammatory diseases of the gastrointestinal tract based on activated forms of ultra-low doses of antibodies to morphine and activated forms of ultra-low doses of antibodies to histamine (RU 2197266 C1, A61K 39/395, 01.27.2003). However, this drug may not in all cases provide sufficient therapeutic efficacy for the treatment of functional bowel disorders, including irritable bowel syndrome and impaired intestinal motor-evacuation function.
Изобретение направлено на повышение эффективности лечения функциональных нарушений кишечника, в том числе синдрома раздраженного кишечника и нарушения моторно-эвакуаторной функции кишечника.The invention is aimed at increasing the effectiveness of the treatment of functional bowel disorders, including irritable bowel syndrome and impaired intestinal motor-evacuation function.
Решение поставленной задачи обеспечивается тем, что лекарственное средство для лечения патологического синдрома, в том числе для лечения и профилактики функциональных нарушений кишечника, содержащее активированную-потенцированную форму антител к гистамину, согласно изобретению, выполнено в виде фармацевтической композиции и содержит в качестве дополнительных (усиливающих) компонентов активированную-потенцированную форму антител к фактору некроза опухоли - альфа (ФНО-α) и активированную-потенцированную форму антител к мозгоспецифическому белку S-100.The solution to this problem is provided by the fact that the drug for the treatment of pathological syndrome, including for the treatment and prevention of functional intestinal disorders, containing the activated-potentiated form of antibodies to histamine, according to the invention, is made in the form of a pharmaceutical composition and contains as additional (enhancing) components of the activated-potentiated form of antibodies to the tumor necrosis factor - alpha (TNF-α) and the activated-potentiated form of antibodies to brain-specific eskomu protein S-100.
Указанными функциональными нарушениями желудочно-кишечного тракта могут быть, в частности, синдром раздраженного кишечника, нарушение моторно-эвакуаторной функции кишечника, функциональный метеоризм, функциональный запор, функциональная диарея, неспецифические функциональные расстройства кишечника и др.The indicated functional disorders of the gastrointestinal tract can be, in particular, irritable bowel syndrome, impaired intestinal motor-evacuation function, flatulence, functional constipation, functional diarrhea, nonspecific functional intestinal disorders, etc.
Активированную-потенцированную форму антител к гистамину, активированную-потенцированную форму антител к ФНО-α и активированную-потенцированную форму антител к мозгоспецифическому белку S-100 используют в виде активированного-потенцированного водного или водно-спиртового раствора, полученного в процессе последовательного многократного разведения в водном или водно-спиртовом растворителе и промежуточного внешнего механического воздействия - вертикального встряхивания.The activated-potentiated form of antibodies to histamine, the activated-potentiated form of antibodies to TNF-α and the activated-potentiated form of antibodies to the brain-specific protein S-100 are used in the form of an activated-potentiated aqueous or aqueous-alcoholic solution obtained by sequential multiple dilution in aqueous or a water-alcohol solvent and an intermediate external mechanical effect - vertical shaking.
Фармацевтическая композиция заявленного лекарственного средства может быть выполнена в твердой лекарственной форме, которая содержит эффективное количество гранул нейтрального носителя, насыщенного смесью водных или водно-спиртовых растворов активированной-потенцированной формы антител к гистамину, активированной-потенцированной формы антител к ФНО-α и активированной-потенцированной формы антител к мозгоспецифическому белку S-100, и фармацевтически приемлемые добавки. При этом фармацевтически приемлемые добавки включают, например, лактозу, целлюлозу микрокристаллическую и магния стеарат.The pharmaceutical composition of the claimed drug can be made in solid dosage form, which contains an effective amount of granules of a neutral carrier saturated with a mixture of aqueous or aqueous-alcoholic solutions of the activated-potentiated form of antibodies to histamine, the activated-potentiated form of antibodies to TNF-α and the activated-potentiated forms of antibodies to the brain-specific protein S-100; and pharmaceutically acceptable additives. In this case, pharmaceutically acceptable additives include, for example, lactose, microcrystalline cellulose and magnesium stearate.
Водные или водно-спиртовые растворы активированных-потенцированных форм антител к гистамину, к ФНО-α и к мозгоспецифическому белку S-100 могут быть получены путем многократного последовательного разведения и промежуточного внешнего воздействия из матричных растворов аффинно очищенных антител к гистамину, к ФНО-α и к мозгоспецифическому белку S-100 с концентрацией 0,5÷5,0 мг/мл.Aqueous or aqueous-alcoholic solutions of activated-potentiated forms of antibodies to histamine, to TNF-α and to brain-specific protein S-100 can be obtained by repeated serial dilution and intermediate external exposure from matrix solutions of affinity-purified antibodies to histamine, to TNF-α and to the brain-specific protein S-100 with a concentration of 0.5 ÷ 5.0 mg / ml.
При этом каждый из компонентов сверхмалых доз аффинно очищенных антител используют в виде смеси различных, преимущественно сотенных, гомеопатических разведений.Moreover, each of the components of ultra-low doses of affinity-purified antibodies is used in the form of a mixture of various, mainly hundred, homeopathic dilutions.
Предпочтительно активированную-потенцированную форму антител к гистамину, активированную-потенцированную форму антител к ФНО-α и активированную-потенцированную форму антител к мозгоспецифическому белку S-100 в сверхмалой дозе каждого компонента, приготовленной из матричного раствора, разведенного в 10012, в 10030, в 100200, что эквивалентно смеси сотенных гомеопатических разведении С12, С30, С200.Preferably, the activated-potentiated form of antibodies to histamine, the activated-potentiated form of antibodies to TNF-α and the activated-potentiated form of antibodies to the brain-specific protein S-100 in an ultra-low dose of each component prepared from a matrix solution diluted in 100 12 , in 100 30 , in 100,200 , which is equivalent to a mixture of hundred-percent homeopathic dilutions of C12, C30, C200.
Решение поставленной задачи может обеспечиваться также тем, что в способе лечения функциональных нарушений кишечника путем введения в организм лекарственного средства, содержащего активированную - потенцированную форму антител к гистамину, согласно изобретению, дополнительно одновременно и сочетано вводят активированную-потенцированную форму сверхмалых доз аффинно очищенных антител к ФНО-α и активированную-потенцированную форму антител к мозгоспецифическому белку S-100.The solution to this problem can also be achieved by the fact that in the method of treating functional intestinal disorders by introducing into the body a medicine containing an activated - potentiated form of anti-histamine antibodies, according to the invention, an activated-potentiated form of ultra-low doses of affinity-purified antibodies to TNF is additionally combined and administered -α and the activated-potentiated form of antibodies to the brain-specific protein S-100.
При этом могут использовать приготовленную в виде единого лекарственного препарата - одной лекарственной формы смесь различных гомеопатических разведении антител к гистамину в сочетании со смесью различных гомеопатических разведении антител к ФНО-α и смесью различных гомеопатических разведении антител к мозгоспецифическому белку S-100.In this case, a mixture of various homeopathic dilutions of antibodies to histamine combined with a mixture of various homeopathic dilutions of antibodies to TNF-α and a mixture of various homeopathic dilutions of antibodies to brain-specific protein S-100 can be prepared in the form of a single drug - a single dosage form.
Заявленное лекарственное средство может быть использовано для лечения и профилактики больных с функциональными нарушениями кишечника, в том числе синдрома раздраженного кишечника, нарушения моторно-эвакуаторной функции кишечника и т.п.The claimed drug can be used for the treatment and prevention of patients with functional bowel disorders, including irritable bowel syndrome, impaired intestinal motor-evacuation function, etc.
Кроме того, заявленное лекарственное средство, как комплексная фармацевтическая композиция, может содержать действующие компоненты в соотношении 1:1:1, при этом каждый компонент используют в виде смеси трех соответствующих матричных растворов, разведенных в 10012, 10030, и 100200 раз, что эквивалентно сотенным гомеопатическим разведениям С12, С30, С200.In addition, the claimed drug, as a complex pharmaceutical composition, may contain active ingredients in a ratio of 1: 1: 1, with each component being used as a mixture of three appropriate matrix solutions diluted 100 12 , 100 30 , and 100 200 times, which is equivalent to hundreds of homeopathic dilutions of C12, C30, C200.
Заявленную фармацевтическую композицию рекомендуется принимать, предпочтительно, по 1-2 таблетке 2-4 раза в день.The claimed pharmaceutical composition is recommended to be taken, preferably, 1-2 tablets 2-4 times a day.
При лечении функциональных нарушений кишечника возможно раздельное применение в виде трех отдельно приготовленных препаратов, как в виде растворов, так и в твердых лекарственных формах (таблеток), каждая из которых содержит активированную-потенцированную форму сверхмалых доз аффинно очищенных антител к гистамину, активированную-потенцированную форму сверхмалых доз аффинно очищенных антител к ФНО-α и, соответственно, активированную-потенцированную форму сверхмалых доз аффинно очищенных антител к мозгоспецифическому белку S-100.In the treatment of functional intestinal disorders, separate use is possible in the form of three separately prepared preparations, both in the form of solutions and in solid dosage forms (tablets), each of which contains an activated-potentiated form of ultra-low doses of affinity-purified antibodies to histamine, an activated-potentiated form ultra-low doses of affinity-purified antibodies to TNF-α and, accordingly, an activated-potentiated form of ultra-low doses of affinity-purified antibodies to brain-specific protein S-100.
Предложенное сочетание активированных-потенцированных форм антител к гистамину, к ФНО-α и к мозгоспецифическому белку S-100 в фармацевтической композиции (т.е. формы антител к гистамину, к ФНО-α и к мозгоспецифическому белку S-100, приготовленные по гомеопатической технологии потенцирования путем многократного последовательного разведения и промежуточного внешнего воздействия - вертикального встряхивания, которые обладают активностью в фармакологических моделях и/или клинических методах лечения функциональных нарушений кишечника) обеспечивает получение неожиданного синергетического терапевтического эффекта, который заключается в более выраженном терапевтическом эффекте при лечении функциональных нарушений кишечника, в частности синдрома раздраженного кишечника, нарушения моторно-эвакуаторной функции кишечника и т.п., по сравнению с действием, оказываемым отдельными компонентами, что подтверждено на адекватных экспериментальных моделях и клинических исследованиях, который заключается в нормализации нервной и гуморальной регуляции функции кишечника, снижении висцеральной гиперчувствительности рецепторов толстой кишки к растяжению, что обеспечивает восстановление нарушения моторики кишечника, купировании ощущения вздутия живота и переполнения желудка, уменьшении выраженности болевого синдрома. При этом происходит расслабление гладкой мускулатуры, уменьшение тонуса стенки желудочно-кишечного тракта (ЖКТ), снижение внутрипросветного давления, нормализация консистенции стула, его частоты и сопутствующих симптомов (купирование императивных позывов, тенезмов, чувства неполного опорожнения кишечника, дополнительных усилий при акте дефекации и др.).The proposed combination of activated-potentiated forms of antibodies to histamine, to TNF-α and to brain-specific protein S-100 in a pharmaceutical composition (i.e., forms of antibodies to histamine, to TNF-α and to brain-specific protein S-100, prepared according to homeopathic technology potentiation by repeated serial dilution and intermediate external action - vertical shaking, which are active in pharmacological models and / or clinical methods of treatment of functional intestinal disorders) This means that an unexpected synergistic therapeutic effect is achieved, which consists in a more pronounced therapeutic effect in the treatment of functional intestinal disorders, in particular, irritable bowel syndrome, impaired intestinal motor-evacuation function, etc., as compared to the action exerted by individual components, which is confirmed by adequate experimental models and clinical studies, which consists in normalizing the nervous and humoral regulation of bowel function, reducing intestinal hypersensitivity of the colon receptors to stretching, which ensures the restoration of intestinal motility disorders, relief of the sensation of bloating and overfilling of the stomach, reducing the severity of pain. In this case, smooth muscles relax, a decrease in the tone of the wall of the gastrointestinal tract (GIT), a decrease in intraluminal pressure, normalization of the stool consistency, its frequency and associated symptoms (relief of imperative urges, tenesmus, feelings of incomplete bowel movement, additional efforts during defecation, etc. .).
Таким образом, лекарственное средство содержит три компонента, которые в сочетании оказывают многофакторное позитивное (лечебное) воздействие на различные проявления нарушенной деятельности кишечника и их заявленное совместное использование в виде фармацевтической композиции сопровождается нормализацией нейрогуморальной регуляции и деятельности ЖКТ.Thus, the drug contains three components that, in combination, have a multifactorial positive (therapeutic) effect on various manifestations of impaired intestinal activity and their claimed joint use in the form of a pharmaceutical composition is accompanied by normalization of neurohumoral regulation and gastrointestinal activity.
Кроме того, заявленное лекарственное средство расширяет арсенал препаратов, предназначенных для лечения и профилактики функциональных нарушений кишечника.In addition, the claimed drug expands the arsenal of drugs intended for the treatment and prevention of functional bowel disorders.
Лекарственный препарат приготовляют, преимущественно, следующим образом.The drug is prepared mainly as follows.
Для приготовления гомеопатически активированной потенцированной формы действующих компонентов используют моноклональные или, преимущественно, поликлональные антитела, которые могут быть получены по известным технологиям - методикам, описанным, например, в книге: Иммунологические методы, под ред. Г.Фримеля, М., «Медицина», 1987, с.9-33; или, например, в статье Laffly E., Sodoyer R. Hum. Antibodies. Monoclonal and recombinant antibodies, 30 years after. - 2005 - Vol.14. - N 1-2. P.33-55. Для проведения экспериментальных исследований могут быть использованы антитела, приготовленные по заказу специализированной фармацевтической фирмой.To prepare a homeopathically activated potentiated form of the active components, monoclonal or, mainly, polyclonal antibodies are used, which can be obtained by known technologies - the techniques described, for example, in the book: Immunological methods, ed. G. Fremel, M., "Medicine", 1987, S. 9-33; or, for example, in an article by Laffly E., Sodoyer R. Hum. Antibodies. Monoclonal and recombinant antibodies, 30 years after. - 2005 - Vol.14. - N 1-2. P.33-55. For experimental studies, antibodies prepared by order of a specialized pharmaceutical company can be used.
Моноклональные антитела получают, например, с помощью гибридомной технологии. Причем начальная стадия процесса включает иммунизацию, основанную на принципах, уже разработанных при приготовлении поликлональных антисывороток. Дальнейшие этапы работы предусматривают получение гибридных клеток, продуцирующих клоны одинаковых по специфичности антител. Их выделение в индивидуальном виде проводится теми же методами, что и в случае поликлональных антисывороток.Monoclonal antibodies are obtained, for example, using hybridoma technology. Moreover, the initial stage of the process includes immunization, based on the principles already developed in the preparation of polyclonal antisera. Further stages of the work include obtaining hybrid cells producing clones of antibodies of the same specificity. Their isolation in an individual form is carried out by the same methods as in the case of polyclonal antisera.
Поликлональные антитела могут быть получены активной иммунизацией животных. Для этого по специально разработанной схеме животным делают серию инъекций требуемым в соответствии с изобретением веществом - антигеном: гистамином, ФНО-α и мозгоспецифическим белком S-100. В результате проведения такой процедуры получают моноспецифическую антисыворотку с высоким содержанием антител, которую и используют для получения активированной-потенцированной формы. При необходимости проводят очистку антител, присутствующих в антисыворотке, например, методом аффинной хроматографии, путем применения фракционирования солевым осаждением или ионообменной хроматографии.Polyclonal antibodies can be obtained by active immunization of animals. To do this, according to a specially developed scheme, the animals are given a series of injections with the substance required in accordance with the invention - an antigen: histamine, TNF-α and brain-specific protein S-100. As a result of this procedure, a monospecific antiserum with a high antibody content is obtained, which is used to obtain the activated-potentiated form. If necessary, the antibodies present in the antiserum are purified, for example, by affinity chromatography, using fractionation by salt precipitation or ion exchange chromatography.
Поликлональные антитела к гистамину, который является биогенным амином (4-(2-Аминоэтил)-имидазол или бета-имидазолил-этиламин с химической формулой С5Н9N3), получают, используя в качестве иммуногена (антигена) для иммунизации кроликов адъювант и промышленно выпускаемый дигидрохлорид гистамина.Polyclonal antibodies to histamine, which is a biogenic amine (4- (2-aminoethyl) -imidazole or beta-imidazolyl-ethylamine with the chemical formula C 5 H 9 N 3 ), are prepared using an adjuvant as an immunogen (antigen) for immunizing rabbits commercially available histamine dihydrochloride.
Перед отбором крови за 7-9 дней проводят 1-3 внутривенных инъекций для повышения уровня антител. В процессе иммунизации у кроликов отбирают небольшие пробы крови для оценки количества антител. Максимальный уровень иммунного ответа на введение большинства растворимых антигенов достигается через 40-60 дней после первой инъекции. После окончания первого цикла иммунизации кроликов в течение 30 дней дают восстановить здоровье и проводят реиммунизацию, включающую 1-3 внутривенные инъекции. Для получения антисыворотки из иммунизированных кроликов собирают кровь в центрифужную пробирку объемом 50 мл. С помощью деревянного шпателя удаляют со стенок пробирки образовавшиеся сгустки и помещают палочку в сгусток, образовавшийся в центре пробирки. Кровь помещают в холодильник (температура 4°С) на ночь. На следующий день удаляют сгусток, прикрепившийся к шпателю, и центрифугируют оставшуюся жидкость при 13000 g в течение 10 мин. Супернатант (надосадочная жидкость) является антисывороткой. Полученная антисыворотка должна быть желтого цвета. Добавляют к антисыворотке 20% (весовая концентрация) NaN3 до конечной концентрации 0,02% и хранят до использования в замороженном состоянии при температуре -20°С (или без добавления NaN3 - при температуре -70°С). Для выделения из антисыворотки антител к гистамину производят абсорбцию на твердой фазе в следующей последовательности:Before blood sampling for 1-3 days, 1-3 intravenous injections are performed to increase the level of antibodies. During immunization, small blood samples are taken from rabbits to evaluate the amount of antibody. The maximum level of the immune response to the administration of most soluble antigens is achieved 40-60 days after the first injection. After the end of the first cycle of immunization of rabbits for 30 days, they restore health and re-immunization, including 1-3 intravenous injections. To obtain antisera from immunized rabbits, blood is collected in a 50 ml centrifuge tube. Using a wooden spatula, the formed clots are removed from the walls of the tube and the wand is placed in the clot formed in the center of the tube. Blood is placed in a refrigerator (temperature 4 ° C) at night. The next day, the clot attached to the spatula is removed and the remaining liquid is centrifuged at 13000 g for 10 minutes. The supernatant (supernatant) is an antiserum. The resulting antiserum should be yellow. Add to the antiserum 20% (weight concentration) NaN 3 to a final concentration of 0.02% and store until use in a frozen state at a temperature of -20 ° C (or without adding NaN 3 at a temperature of -70 ° C). To isolate anti-histamine antibodies from the antiserum, solid phase absorption is performed in the following sequence:
1. 10 мл антисыворотки кролика разбавляют в 2 раза 0,15 М NaCl добавляют 6,26 г Nа2SO4, перемешивают и инкубируют 12-16 ч при 4°С;1. 10 ml of rabbit antiserum is diluted 2 times with 0.15 M NaCl, 6.26 g of Na 2 SO 4 are added, stirred and incubated for 12-16 hours at 4 ° C;
2. выпавший осадок удаляют центрифугированием, растворяют в 10 мл фосфатного буфера и затем диализуют против того же буфера в течение ночи при комнатной температуре;2. The precipitate formed is removed by centrifugation, dissolved in 10 ml of phosphate buffer and then dialyzed against the same buffer overnight at room temperature;
3. после удаления осадка центрифугированием раствор наносят на колонку с ДЭАЭ-целлюлозой, уравновешенную фосфатным буфером;3. after removal of the precipitate by centrifugation, the solution is applied to a column with DEAE-cellulose, balanced with phosphate buffer;
4. фракцию антител определяют, измеряя оптическую плотность элюата при 280 нм.4. The antibody fraction is determined by measuring the optical density of the eluate at 280 nm.
Затем производят очистку антител методом аффинной хроматографии путем прикрепления полученных антител к гистамину, который находится на нерастворимом матриксе с последующим элюированием концентрированными растворами соли.The antibodies are then purified by affinity chromatography by attaching the obtained antibodies to histamine, which is located on an insoluble matrix, followed by elution with concentrated salt solutions.
Полученный, таким образом, буферный раствор поликлональных кроличьих антитела к гистамину, очищенных на антигене, с концентрацией 0,5-5,0 мг/мл, предпочтительно 2,0-3,0 мг/мл, используют в качестве матричного (первичного) раствора для последующего приготовления активированной - потенцированной формы.Thus obtained buffer solution of polyclonal rabbit antibodies to histamine, purified on antigen, with a concentration of 0.5-5.0 mg / ml, preferably 2.0-3.0 mg / ml, is used as a matrix (primary) solution for the subsequent preparation of the activated - potentiated form.
Получение поликлональных антител к фактору некроза опухоли - альфа (ФНО-α) может быть произведено по вышеуказанному методу получения поликлональных антител к гистамину с использованием цельной молекулы фактора некроза опухоли - альфа следующей последовательности:Obtaining polyclonal antibodies to the tumor necrosis factor-alpha (TNF-α) can be performed according to the above method of obtaining polyclonal antibodies to histamine using a whole tumor necrosis factor-alpha molecule of the following sequence:
1 MSTESMIRDV ELAEEALPKK TGGPQGSRRC LFLSLFSFLI VAGATTLFCL LHFGVIGPQR1 MSTESMIRDV ELAEEALPKK TGGPQGSRRC LFLSLFSFLI VAGATTLFCL LHFGVIGPQR
61 EEFPRDLSLI SPLAQAVRSS SRTPSDKPVA HVVANPQAEG QLQWLNRRAN ALLANGVELR61 EEFPRDLSLI SPLAQAVRSS SRTPSDKPVA HVVANPQAEG QLQWLNRRAN ALLANGVELR
121 DNQLVVPSEG LYLIYSQVLF KGQGCPSTHV LLTHTISRIA VSYQTKVNLL SAIKSPCQRE121 DNQLVVPSEG LYLIYSQVLF KGQGCPSTHV LLTHTISRIA VSYQTKVNLL SAIKSPCQRE
181 TPEGAEAKPW YEPIYLGGVF QLEKGDRLSA EINRPDYLDF AESGQVYFGI IAL181 TPEGAEAKPW YEPIYLGGVF QLEKGDRLSA EINRPDYLDF AESGQVYFGI IAL
Возможно для получения поликлональных антител к фактору некроза опухоли - альфа (ФНО-α) использование полипептидного фрагмента фактора некроза опухоли, выбранного, например, из следующих последовательностей:It is possible to obtain polyclonal antibodies to the tumor necrosis factor alpha (TNF-α) using a polypeptide fragment of the tumor necrosis factor selected, for example, from the following sequences:
84-88:84-88:
PSDKPPSDKP
93-97:93-97:
VANPQVanpq
65-199:65-199:
RDLSLI SPLAQAVRSS SRTPSDKPVA HVVANPQAEG QLQWLNRRAN ALLANGVELR DNQLVVPSEG LYLIYSQVLF KGQGCPSTHV LLTHTISRIA VSYQTKVNLL SAIKSPCQRE TPEGAEAKPW YEPIYLGGVRDLSLI SPLAQAVRSS SRTPSDKPVA HVVANPQAEG QLQWLNRRAN ALLANGVELR DNQLVVPSEG LYLIYSQVLF KGQGCPSTHV LLTHTISRIA VSYQTKVNLL SAIKSPCQRE TPEGAEAKPW YEPIYLGGV
77-93:77-93:
RSS SRTPSDKPVA HVVRSS SRTPSDKPVA HVV
32-54:32-54:
GGPQGSRRC LFLSLFSFLI VAGAGGPQGSRRC LFLSLFSFLI VAGA
56-73:56-73:
IGPQR EEFPRDLSLI SPLIGPQR EEFPRDLSLI SPL
123-160:123-160:
QLVVPSEG LYLIYSQVLF KGQGCPSTHV LLTHTISRIAQLVVPSEG LYLIYSQVLF KGQGCPSTHV LLTHTISRIA
176-190:176-190:
PCQRE TPEGAEAKPWPCQRE TPEGAEAKPW
5-45:5-45:
SMIRDV ELAEEALPKK TGGPQGSRRC LFLSLSMIRDV ELAEEALPKK TGGPQGSRRC LFLSL
150-184:150-184:
VLLTHTISRIA VSYQTKVNLL SAIKSPCQRE TPEGVLLTHTISRIA VSYQTKVNLL SAIKSPCQRE TPEG
77-233:77-233:
VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGANGR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKV NLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINR PDYLDFAESGQVYFGIIAL.DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKV NLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINR PDYLDFAESGQVYFGIIAL.
Получение антител к мозгоспецифическому белку S-100. Для приготовления потенцированной формы антител - антисыворотки к мозгоспецифическому белку S-100 используют мозгоспецифический белок S-100, выделенный из ткани головного мозга быка по следующей методике:Obtaining antibodies to the brain-specific protein S-100. To prepare a potentiated form of antibodies - antisera to the brain-specific protein S-100, use the brain-specific protein S-100 isolated from the tissue of the brain of a bull by the following method:
- замороженную в жидком азоте ткань растирают в порошок на специальной мельнице;- fabric frozen in liquid nitrogen is ground into powder in a special mill;
- экстракцию белков проводят в соотношении 1:3 (вес/объем) в экстрагирующем буфере при гомогенизации;- the extraction of proteins is carried out in a ratio of 1: 3 (weight / volume) in the extraction buffer during homogenization;
- гомогенат прогревают в течение 10 мин при 60°С и охлаждают до 4°С на ледяной бане;- the homogenate is heated for 10 min at 60 ° C and cooled to 4 ° C in an ice bath;
- термолабильные белки удаляют центрифугированием;- thermolabile proteins are removed by centrifugation;
- проводят ступенчатое фракционирование сульфатом аммония с последующим удалением выпадающих в осадок примесных белков;- carry out stepwise fractionation with ammonium sulfate, followed by removal of precipitated impurity proteins;
- содержащую белок S-100 фракцию осаждают 100% насыщенным сульфатом аммония при снижении рН до 4,0 и собирают центрифугированием;- the S-100 protein-containing fraction is precipitated with 100% saturated ammonium sulfate when the pH is reduced to 4.0 and collected by centrifugation;
- осадок растворяют в минимальном объеме буфера, содержащего ЭДТА и меркаптоэтанол, диализируют против деионизованной воды и лиофильно высушивают;- the precipitate is dissolved in a minimum volume of a buffer containing EDTA and mercaptoethanol, dialyzed against deionized water and freeze-dried;
- фракционирование кислых белков продолжают хроматографией на ионообменных носителях - ДЭАЭ целлюлозе ДЕ-52 и затем ДЭАЭ-сефадексе А-50;- fractionation of acidic proteins is continued by chromatography on ion-exchange media — DEAE cellulose DE-52 and then DEAE-Sephadex A-50;
- собранные и отдиализованные фракции, содержащие белок S-100, разделяют по молекулярному весу гель-фильтрацией на сефадексе G-100;- collected and dialyzed fractions containing S-100 protein are separated by molecular weight by gel filtration on Sephadex G-100;
- очищенный белок S-100 диализируют и лиофильно высушивают.- purified S-100 protein is dialyzed and freeze-dried.
Молекулярный вес очищенного мозгоспецифического белка S-100 составляет - 21000 Д.The molecular weight of the purified brain-specific protein S-100 is 21,000 D.
Для получения мозгоспецифической антисыворотки к выделенному мозгоспецифическому белку S-100 готовят смесь очищенного белка S-100 (антигена) в комплексе с метилированным бычьим сывороточным альбумином в качестве носителя с полным адъювантом Фрейнда, которую вводят подкожно лабораторному животному - кролику в область спины в количестве 1-2 мл.To obtain a brain-specific antiserum, a purified S-100 protein (antigen) is prepared in combination with methylated bovine serum albumin as a carrier with Freund's complete adjuvant, which is administered subcutaneously to a laboratory rabbit animal in the amount of 1- to a selected brain-specific protein S-100. 2 ml
Полученная антисыворотка имеет титр 1:500 -1:1000.The resulting antiserum has a titer of 1: 500 -1: 1000.
Предпочтительным для приготовления заявленного лекарственного препарата является использование поликлональных антител к гистамину, к ФНО-α и к мозгоспецифическому белку S-100, которые в качестве матричного (первичного) раствора с концентрацией 0,5÷5,0 мг/мл (преимущественно, 2,0α3,0 мг/мл) используют для последующего приготовления активированной-потенцированной формы.Preferred for the preparation of the claimed drug is the use of polyclonal antibodies to histamine, to TNF-α and to brain-specific protein S-100, which as a matrix (primary) solution with a concentration of 0.5 ÷ 5.0 mg / ml (mainly 2, 0α3.0 mg / ml) is used for the subsequent preparation of the activated-potentiated form.
Активированную-потенцированную форму каждого компонента готовят путем равномерного уменьшения концентрации в результате последовательного разведения 1 части упомянутого матричного раствора в 9 частях (для десятичного разведения) или в 99 частях (для сотенного разведения) или в 999 частях (для тысячного разведения) нейтрального растворителя с многократным вертикальным встряхиванием ("динамизацией") каждого полученного разведения и использованием отдельных емкостей для каждого последующего разведения до получения требуемой потенции - кратности разведения по гомеопатическому методу (см., например, В.Швабе "Гомеопатические лекарственные средства", М., 1967 г., с.14-29).The activated-potentiated form of each component is prepared by uniformly decreasing the concentration as a result of sequential dilution of 1 part of the matrix solution in 9 parts (for decimal dilution) or in 99 parts (for hundredth dilution) or in 999 parts (for thousandth dilution) of a neutral solvent with multiple vertical shaking ("dynamization") of each dilution obtained and using separate containers for each subsequent dilution until the desired potency is obtained - cr dilution characteristics according to the homeopathic method (see, for example, V. Schwabe "Homeopathic medicines", M., 1967, p.14-29).
Внешнюю обработку в процессе уменьшения концентрации также можно осуществлять ультразвуком, электромагнитным или иным физическим воздействием.External processing in the process of reducing the concentration can also be performed by ultrasound, electromagnetic or other physical effects.
Например, для приготовления 12-го сотенного разведения С 12 одну часть упомянутого матричного раствора антител к гистамину с концентрацией 2,5 мг/мл разводят в 99 частях нейтрального водного или водно-спиртового растворителя (преимущественно 15% этиловый спирт) и многократно (10 и более раз) вертикально встряхивают - потенцируют полученное 1-е сотенное С1 разведение. Из 1-го сотенного С1 разведения приготовляют 2-ое сотенное разведение С2. Данную операцию повторяют 11 раз, получая 12-е сотенное разведение С 12. Таким образом, 12-е сотенное разведение С 12 представляет собой раствор, полученный разбавлением последовательно в разных емкостях 12 раз 1-ой части исходного матричного раствора антител к гистамину с концентрацией 2,5 мг/мл в 99-ти частях нейтрального растворителя, т.е. раствор, приготовленный из матричного раствора, разведенного в 10012 раз. Аналогичные операции с соответствующей кратностью разведения проводят для получения разведении С30 и С200.For example, to prepare the 12th hundredth C12 dilution, one part of the mentioned 2.5 mg / ml histamine antibody matrix solution is diluted in 99 parts of a neutral aqueous or hydroalcoholic solvent (mainly 15% ethanol) and repeatedly (10 and more than once) vertically shake - potentiate the obtained 1st hundredth C1 dilution. From the 1st hundredth C1 dilution prepare the 2nd hundredth dilution C2. This operation is repeated 11 times, obtaining the 12th hundredth dilution of C 12. Thus, the 12th hundredth dilution of C 12 is a solution obtained by diluting successively in different containers 12 times of the 1st part of the initial matrix solution of antibodies to histamine with a concentration of 2 5 mg / ml in 99 parts of a neutral solvent, i.e. a solution prepared from a matrix solution diluted 100 to 12 times. Similar operations with the appropriate dilution ratio are carried out to obtain a dilution of C30 and C200.
При использовании в качестве биологически активного жидкого компонента смеси различных гомеопатических, преимущественно сотенных, разведении, действующего вещества каждый компонент состава (например, С12, С30, С200) приготовляют раздельно по описанной выше технологии до их предпоследнего разведения (соответственно, до получения С11, С29, С199) и затем вносят в соответствии с составом смеси в одну емкость по одной части каждого компонента и смешивают с требуемым количеством нейтрального водного или водно-спиртового растворителя (преимущественно 50-70% этилового спирта) (соответственно, с 97 частями для сотенного разведения). При этом получают активированную-потенцированную форму антител к гистамину в сверхмалой дозе, приготовленной из матричного раствора, разведенного в 10012, в 10030, в 100200, что эквивалентно смеси сотенных гомеопатических разведении С12, С30, С200.When using as a biologically active liquid component a mixture of various homeopathic, mainly hundred, dilutions of the active substance, each component of the composition (for example, C12, C30, C200) is prepared separately according to the technology described above to the penultimate dilution (respectively, to obtain C11, C29, C199) and then, in accordance with the composition of the mixture, one part of each component is added to one container and mixed with the required amount of a neutral aqueous or aqueous-alcoholic solvent (mainly but 50-70% ethyl alcohol) (respectively, with 97 parts for hundred percent dilution). In this case, an activated-potentiated form of antibodies to histamine is obtained in an ultra-low dose prepared from a matrix solution diluted in 100 12 , 100 30 , 100 200 , which is equivalent to a mixture of hundred-percent homeopathic dilutions of C12, C30, C200.
Возможно использование действующего вещества в виде смеси других различных гомеопатических, разведении, например, десятичных и или сотенных, (D20, С30, С100 или С12, С30, С50 и т.д.), эффективность которых определяют экспериментально.It is possible to use the active substance in the form of a mixture of various different homeopathic ones, dilution, for example, decimal and or hundredths (D20, C30, C100 or C12, C30, C50, etc.), the effectiveness of which is determined experimentally.
При потенцировании вместо встряхивания в процессе уменьшения концентрации также можно осуществлять внешнее воздействие ультразвуком, электромагнитным или иным физическим воздействием.When potentiating instead of shaking in the process of decreasing the concentration, it is also possible to exert external influence by ultrasound, electromagnetic or other physical effect.
Для получения заявленной фармацевтической композиции водные или водно-спиртовые растворы действующих компонентов смешивают, преимущественно, в соотношении 1:1:1 и используют в жидкой лекарственной форме.To obtain the claimed pharmaceutical composition, aqueous or aqueous-alcoholic solutions of the active ingredients are mixed, mainly in a ratio of 1: 1: 1 and used in liquid dosage form.
Заявленная фармацевтическая композиция может быть использована и в твердой лекарственной форме, которая содержит эффективное количество гранул нейтрального носителя - например, лактозы, - насыщенного путем пропитывания до насыщения смесью водных или водно-спиртовых растворов активированной потенцированной формой антител к гистамину, активированной-потенцированной формой антител к ФНО-α и активированную-потенцированную форму антител к мозгоспецифическому белку S-100, и фармацевтически приемлемые добавки, включающие, преимущественно, лактозу, целлюлозу микрокристаллическую и магния стеарат.The claimed pharmaceutical composition can also be used in solid dosage form, which contains an effective amount of granules of a neutral carrier - for example, lactose - saturated by soaking in a mixture of aqueous or aqueous-alcoholic solutions with an activated potentiated form of anti-histamine antibodies, an activated-potentiated antibody form TNF-α and the activated-potentiated form of antibodies to the brain-specific protein S-100, and pharmaceutically acceptable additives, including mainly lactose, microcrystalline cellulose and magnesium stearate.
Для получения твердой оральной формы заявленного лекарственного средства производят в установке кипящего слоя (например, типа «Hiittlin Pilotlab» производства компании Huttlin GmbH) орошение до насыщения вводимых в псевдоожиженный -кипящий слой гранул нейтрального вещества - лактозы (молочного сахара) с размером частиц 150-300 мкм, предварительно полученным водным или водно-спиртовым раствором активированных-потенцированных форм антител к гистамину, активированных-потенцированных форм антител к ФНО-α и активированных-потенцированных форму антител к мозгоспецифическому белку S-100, преимущественно, в соотношении 1 кг раствора антител на 5 или 10 кг лактозы (1:5-1:10) с одновременной сушкой в потоке подаваемого под решетку нагретого воздуха при температуре не выше 40°С. Расчетное количество 0,17÷0,45 от массы твердой оральной формы высушенных гранул, насыщенных активированной-потенцированной формой антител, загружают в смеситель и смешивают с микрокристаллической целлюлозой, вводимой в количестве 2÷5 масс. частей от общей массы загрузки - от массы твердой оральной формы. Затем в эту смесь добавляют 10÷25 масс. частей от общей массы загрузки «ненасыщенной» чистой лактозы (для снижения стоимости и некоторого упрощения и ускорения технологического процесса без снижения эффективности лечебного воздействия), стеарат магния в количестве 0,1÷0,3 масс. частей от общей массы загрузки. Полученную таблеточную массу равномерно перемешивают и таблетируют прямым сухим прессованием (например, в таблет-прессе Korsch - XL 400) с формированием круглых таблеток массой 150÷500 мг. После таблетирования получают таблетки массой 300 мг, пропитанные водно-спиртовым раствором (3,0-6,0 мг/табл.) активированной-потенцированной формой антител к гистамину, к ФНО-α и к мозгоспецифическому белку S-100 в сверхмалой дозе каждого компонента, приготовленной из матричного раствора, разведенного в 10012, в 10030, в 100200, что эквивалентно смеси сотенных гомеопатических разведении С12, С30, С200.To obtain a solid oral form of the claimed drug, a fluidized bed is installed (for example, type “Hiittlin Pilotlab” manufactured by Huttlin GmbH) irrigation until saturation of granules of a neutral substance - lactose (milk sugar) with a particle size of 150-300 μm, a pre-prepared aqueous or aqueous-alcoholic solution of activated-potentiated forms of antibodies to histamine, activated-potentiated forms of antibodies to TNF-α and activated-potentiated forms of antibodies to brain-specific protein S-100, mainly in the ratio of 1 kg of antibody solution to 5 or 10 kg of lactose (1: 5-1: 10) with simultaneous drying in a stream of heated air supplied under the grate at a temperature of no higher than 40 ° C. The estimated amount of 0.17 ÷ 0.45 by weight of the solid oral form of the dried granules saturated with the activated-potentiated form of antibodies is loaded into the mixer and mixed with microcrystalline cellulose, introduced in an amount of 2 ÷ 5 mass. parts of the total mass of the load - from the mass of solid oral form. Then, 10 ÷ 25 masses are added to this mixture. parts of the total mass of the load of "unsaturated" pure lactose (to reduce the cost and some simplification and acceleration of the process without reducing the effectiveness of the therapeutic effect), magnesium stearate in an amount of 0.1 ÷ 0.3 mass. parts of the total mass of the load. The resulting tablet mass is uniformly mixed and tabletted by direct dry pressing (for example, in a Korsch tablet press - XL 400) with the formation of round tablets weighing 150 ÷ 500 mg. After tabletting, 300 mg tablets are obtained, impregnated with an aqueous-alcoholic solution (3.0-6.0 mg / tablet) with an activated-potentiated form of antibodies to histamine, to TNF-α and to the brain-specific protein S-100 in an ultra-low dose of each component prepared from a matrix solution diluted in 100 12 , in 100 30 , in 100 200 , which is equivalent to a mixture of hundred-percent homeopathic dilutions of C12, C30, C200.
Предпочтительно заявленную фармацевтическую композицию рекомендуется принимать по 1-2 таблетке 2-4 раза в день.Preferably, the claimed pharmaceutical composition is recommended to take 1-2 tablets 2-4 times a day.
В нижеприведенных Примерах 1-3 изучали эффективность заявленного комплексного лекарственного средства при лечении функциональных нарушений кишечника в виде композиции, содержащей антитела к гистамину, аффинно очищенные на антигене, в сверхмалой дозе, полученной сверхразведением исходного матричного раствора (концентрация 2,5 мг/мл) в 10012, 10030, 100200 раз (AT Гис), антитела к белку S100, аффинно очищенные на антигене, в сверхмалой дозе, полученной сверхразведением исходного матричного раствора (концентрация 2,5 мг/мл) в10012, 10030, 100200 раз (AT S100) и антитела к фактору некроза опухоли - альфа, аффинно очищенные на антигене, в сверхмалой дозе, полученной сверхразведением исходного матричного раствора (концентрация 2,5 мг/мл) в 10012, 10030, 100200 раз (AT ФНО-α) (AT S100+AT ФНО-α+AT Гис). Препарат сравнения: антитела к гистамину, аффинно очищенные на антигене, в сверхмалой дозе, полученной сверхразведением исходного матричного раствора (концентрация 2,5 мг/мл) в 10012,10030,100200 раз (AT Гис),In the following Examples 1-3, we studied the effectiveness of the claimed complex drug in the treatment of functional bowel disorders in the form of a composition containing antibodies to histamine, affinity purified on antigen, in an ultra-low dose obtained by super-dilution of the initial matrix solution (concentration 2.5 mg / ml) in 100 12 , 100 30 , 100 200 times (AT Gis), antibodies to S100 protein, affinity purified on antigen, in the ultra-low dose obtained by super-dilution of the initial matrix solution (concentration 2.5 mg / ml) in 100 12 , 100 30 , 100 200 times (AT S100) and en Ithel tumor necrosis factor - alpha, affinity purified on an antigen, in ultralow dose received sverhrazvedeniem initial matrix solution (concentration 2.5 mg / ml) 100 12 100 30 100 200 time (AT TNF-α) (AT S100 + AT TNF-α + AT His). Comparison drug: anti-histamine antibodies affinity purified on antigen in an ultra-low dose obtained by super-dilution of the initial matrix solution (concentration 2.5 mg / ml) 100 12 , 100 30 , 100 200 times (AT Gis),
Пример 1.Example 1
В исследовании влияния заявленного лекарственного средства на моторно-эвакуаторную функцию кишечника мышей были использованы 31 аутбредных самцов мыши (масса 17,5-26,3 г, возраст 1,5-2 месяца), которым внутрижелудочно в течение 5 дней вводили дистиллированную воду (контроль, 15 мл/кг, 10 мышей), AT Гис (15 мл/кг, 11 мышей) или AT S100+AT ФНО-α+AT Гис (15 мл/кг, 10 мышей). Состояние моторно-эвакуаторной функции кишечника изучали методом «меток» (Coopman G.P., Kermis H.M. Two methods to assess the gastrointestinal transit - time in mice // Z. Versuchstierk. 1977. Vol.19, No.5. P.298-303). Для этого через 1 час после последнего введения препаратов мышам в качестве «метки» в пищеварительный тракт вводили 10% взвесь активированного угля, приготовленную на 2% слизи картофельного крахмала, в количестве 0,5 мл/одну мышь. Через 10 мин после введения «метки» у мышей извлекали кишечник, растягивали на стеклянной пластине, измеряли общую длину кишечника и заполненную углем (отношение длины заполненной активированным углем части кишечника к общей длине выражали в процентах).In a study of the effect of the claimed drug on the motor-evacuation function of the intestines of mice, 31 outbred male mice were used (weight 17.5-26.3 g, age 1.5-2 months), which were administered intragastrically for 5 days with distilled water (control 15 ml / kg, 10 mice), AT His (15 ml / kg, 11 mice) or AT S100 + AT TNF-α + AT His (15 ml / kg, 10 mice). The state of the motor-evacuation function of the intestine was studied by the method of “tags” (Coopman GP, Kermis HM Two methods to assess the gastrointestinal transit - time in mice // Z. Versuchstierk. 1977. Vol.19, No.5. P.298-303) . To do this, 1 hour after the last injection of the mice, a 10% suspension of activated charcoal prepared with 2% mucilage of potato starch in the amount of 0.5 ml / one mouse was injected into the digestive tract as mice. 10 minutes after the introduction of the “label”, the intestines were removed from the mice, stretched on a glass plate, the total length of the intestine and filled with charcoal was measured (the ratio of the length of the part of the intestine filled with activated charcoal to the total length was expressed as a percentage).
Установлено, что предварительное курсовое введение здоровым мышам-самцам препарата AT S100+AT ФНО-α+AT Гис в дозе 15 мл/кг приводило к статистически значимому увеличению длины пробега активированного угля по кишечнику в 1,3 и 1,2 раза относительно соответствующих значений групп AT Гис и дистиллированной воды (контроля) (Таблица 1). При этом в данной группе отношение длины заполненной углем части к общей длине кишечника также превышало аналогичные показатели в группе AT Гис (Р<0,05) и контрольной группы (Р<0,05).It was found that a preliminary course administration of AT S100 + AT TNF-α + AT Gis to healthy male mice at a dose of 15 ml / kg led to a statistically significant increase in the path length of activated carbon in the intestine by 1.3 and 1.2 times relative to the corresponding values AT gis groups and distilled water (control) (Table 1). Moreover, in this group, the ratio of the length of the coal-filled part to the total length of the intestine also exceeded the similar indicators in the AT Gis group (P <0.05) and the control group (P <0.05).
Таким образом, показано, что комплексный препарат AT S100+AT ФНО-α+AT Гис усиливает моторно-эвакуаторную активность кишечника мышей, то есть обладает умеренным тоногенным действием, превосходящим по эффективности AT Гис.Thus, it was shown that the complex preparation AT S100 + AT TNF-α + AT Gis enhances the motor-evacuation activity of the intestines of mice, that is, it has a moderate tonogenic effect, superior in efficiency to AT Gis.
Пример 2.Example 2
В исследовании влияния заявленного комплексного лекарственного средства на выделительную функцию кишечника мышей было использовано 33 аутбредных мышей-самцов (масса 17,5-26,3 г, возраст 1.5-2 мес), которым внутрижелудочно однократно вводили дистиллированную воду (контроль, 15 мл/кг), AT Гис (15 мл/кг) или AT S100+AT ФНО-α+AT Гис (15 мл/кг). Состояние выделительной функции кишечника изучали по методу Г.В.Оболенцевой (Оболенцева Г.В., Хаджай Я.И. Фармакологическое исследование плантаглюцида // Фармакология и токсикология. - 1996. - №4. - С.469-472). Для этого препараты вводили вместе с активированным углем в дозе 10 мг/кг. Положительным результатом считали появление фекалий, окрашенных углем в черный цвет. Замеры результатов проводились через 3, 6, 24 ч от начала эксперимента. Степень проявления эффекта для каждого животного определяли в баллах: «+» - появление оформленного окрашенного кала; «++» - появление мягкого окрашенного кала; «+++» - появление жидкого окрашенного кала. Слабительную активность препаратов оценивали суммой баллов в группе и по проценту животных с положительной реакцией. Влияние тестируемых препаратов на выделительную функцию кишечника у аутбредных мышей-самцов приведено в Таблице 2.In a study of the effect of the claimed complex drug on the excretory function of the intestines of mice, 33 outbred male mice (weight 17.5-26.3 g, age 1.5-2 months) were used, which were administered intragastrically once with distilled water (control, 15 ml / kg ), AT His (15 ml / kg) or AT S100 + AT TNF-α + AT His (15 ml / kg). The state of the excretory function of the intestine was studied by the method of G.V.Obolentseva (Obolentseva G.V., Khadzhai Y.I. Pharmacological study of plantaglucide // Pharmacology and Toxicology. - 1996. - No. 4. - S.469-472). For this, the preparations were administered together with activated carbon at a dose of 10 mg / kg. The appearance of feces stained with black coal was considered a positive result. Measurements of the results were carried out after 3, 6, 24 hours from the start of the experiment. The degree of manifestation of the effect for each animal was determined in points: "+" - the appearance of the decorated colored feces; "++" - the appearance of soft colored feces; "+++" - the appearance of liquid stool. The laxative activity of the drugs was evaluated by the total score in the group and by the percentage of animals with a positive reaction. The effect of the tested drugs on the excretory function of the intestine in outbred male mice is shown in Table 2.
Некоторое усиление перистальтики наступало уже в первые 3 ч после введения AT S100+AT ФНО-α+AT Гис: 25 баллов vs 18 баллов в группе AT Гис и 22 баллов в группе контроля (Табл.3). Эффект сохранялся в группе AT S100+AT ФНО-α+AT Гис через 6 ч наблюдения: 24 vs 18 баллов в группах AT Гис и контроля. Через 24 ч отмечалось снижение выделительной активности во всех трех опытных группах вплоть до прекращения дефекации у 45% животных.A slight increase in peristalsis occurred already in the first 3 hours after the administration of AT S100 + AT TNF-α + AT Gis: 25 points vs 18 points in the AT Gis group and 22 points in the control group (Table 3). The effect persisted in the AT S100 + AT TNF-α + AT His group after 6 h of observation: 24 vs 18 points in the AT His group and control. After 24 hours, there was a decrease in excretory activity in all three experimental groups until the end of defecation in 45% of the animals.
Таким образом, показано, что комплексный препарат AT S100+AT ФНО-α+AT Гис обладает умеренным слабительным действием, превосходящим по эффективности AT Гис.Thus, it was shown that the complex preparation AT S100 + AT TNF-α + AT Gis has a mild laxative effect, superior in effectiveness to AT gis.
Пример 3.Example 3
В исследовании спазмолитической активности заявленного комплексного лекарственного средства было использовано 30 аутбредных мышей-самцов (масса 17,5-26,3 г, возраст 1,5-2 мес), которым внутрижелудочно в течение 5 дней вводили дистиллированную воду (контроль, 15 мл/кг), AT Гис (15 мл/кг) или AT S100+AT ФНО-α+AT Гис (15 мл/кг). Спазмолитическую активность препаратов оценивали по методу J. Setnicar (Setnicar J., Da Re P. 3-methyl-6(N-diethyl-amino-methyl)-Flavone - a new smooth-muscle relaxant // Arzneimittel-Forsch. 1959. No.9. P.653-697).In the study of the antispasmodic activity of the claimed complex drug, 30 outbred male mice (weight 17.5-26.3 g, age 1.5-2 months) were used, which were administered intragastrically for 5 days with distilled water (control, 15 ml / kg), AT His (15 ml / kg) or AT S100 + AT TNF-α + AT His (15 ml / kg). The antispasmodic activity of the preparations was evaluated according to the method of J. Setnicar (Setnicar J., Da Re P. 3-methyl-6 (N-diethyl-amino-methyl) -Flavone - a new smooth-muscle relaxant // Arzneimittel-Forsch. 1959. No .9. P.653-697).
Через 1 час после последнего введения препаратов мышам вводили внутрибрюшинно 0,2 мл 0,1% раствора BaCl2 и внутрижелудочно 0,5 мл 10% взвеси активированного угля, приготовленного на 2% слизи картофельного крахмала. Через 10 минут животных умерщвляли и определяли соотношение между общей длиной кишечника и заполненной углем. Соотношение выражали в процентах и учитывали как первичный результат опыта.One hour after the last administration of the preparations, mice were injected intraperitoneally with 0.2 ml of a 0.1% BaCl 2 solution and intragastrically with 0.5 ml of a 10% suspension of activated charcoal prepared in 2% potato starch mucus. After 10 minutes, the animals were sacrificed and the ratio between the total length of the intestine and the charcoal filled was determined. The ratio was expressed as a percentage and was taken into account as the primary result of the experiment.
В группе мышей, получавшей препарат AT S100+AT ФНО+AT Гис, отмечалась максимальная дистанция продвижения угля по кишечнику мышей: длина заполненной улем части оказалась в 1,3 раза больше относительно аналогичных показателей группы AT Гис и контроля (Таблица 3). То есть спазм ЖКТ, вызванный введением BaCl2 и приводящий к снижению скорости продвижения активированного угля по кишечнику, менее всего был выражен в группе AT S100+AT ФНО-α+AT Гис.In the group of mice treated with the AT S100 + AT TNF + AT Gis preparation, the maximum distance of coal advancement in the intestines of mice was observed: the length of the ulcer-filled part was 1.3 times longer than the similar parameters of the AT Gis group and control (Table 3). That is, a gastrointestinal spasm caused by the introduction of BaCl 2 and leading to a decrease in the rate of advancement of activated carbon through the intestines was least expressed in the AT S100 + AT TNF-α + AT His group.
Таким образом, показано, что комплексный препарат AT S100+AT ФНО+AT Гис обладает умеренным спазмолитическим действием, превосходящим по эффективности AT Гис.Thus, it was shown that the complex preparation AT S100 + AT TNF + AT Gis has a moderate antispasmodic effect, superior in effectiveness to AT Gis.
Пример 4.Example 4
При исследовании свойств заявленного лекарственного средства для лечения пациентов группы активного препарата были использованы таблетки массой 300 мг, пропитанные фармацевтической композицией, содержащей водно-спиртовые растворы (6 мг/табл.) активированных-потенцированных форм поликлональных аффинно очищенных кроличьих антител к человеческому фактору некроза опухоли-альфа (AT ФНО-α), мозгоспецифическому белку S-100 (AT S100) и гистамину (AT Гис) в сверхмалых дозах (СМД), полученных сверхразведением исходного матричного раствора концентрации 2,5 мг/мл в 10012, 10030, 1002000 раз, эквивалентных смеси сотенных гомеопатических разведении С12, С30, С200. Для лечения пациентов группы сравнения были использованы таблетки массой 300 мг, пропитанные водно-спиртовым раствором (3 мг/табл.) активированной - потенцированной формы поликлональных кроличьих антител к гистамину, очищенных на антигене, в сверхмалой дозе (СМД AT Гис), полученной сверхразведением исходного матричного раствора концентрации 2,5 мг/мл в 10012, 10030, 100200 раз, эквивалентной смеси сотенных гомеопатических разведении С12, С30, С200 (препарат сравнения).In the study of the properties of the claimed drug for the treatment of patients of the active drug group, 300 mg tablets were used, impregnated with a pharmaceutical composition containing aqueous-alcoholic solutions (6 mg / tablet) of activated-potentiated forms of polyclonal affinity-purified rabbit antibodies to human tumor necrosis factor alpha (AT TNF-α), brain-specific protein S-100 (AT S100) and histamine (AT His) in ultra-low doses (SMD) obtained by super-dilution of the initial concentration 2 matrix solution, 5 mg / ml 100 12 , 100 30 , 100 2000 times, equivalent to a mixture of hundreds of homeopathic dilutions of C12, C30, C200. To treat patients of the comparison group, 300 mg tablets were used, impregnated with an aqueous-alcoholic solution (3 mg / tablet) of an activated, potentiated form of polyclonal rabbit antibodies to histamine, purified on an antigen, in an ultra-low dose (SMD AT Gis) obtained by super-dilution of the initial a matrix solution of a concentration of 2.5 mg / ml in 100 12 , 100 30 , 100 200 times, the equivalent mixture of hundred-percent homeopathic dilutions of C12, C30, C200 (comparison drug).
В сравнительном исследовании оценки эффективности композиции СМД AT ФНО-α+AT S100+AT Гис и монокомпонентного препарата AT Гис в лечении больных с синдромом раздраженного кишечника (СРК) приняли участие 52 пациента с верифицированным в соответствии с Римскими критериями III (2006) диагнозом, которые проходили амбулаторный курс наблюдения и терапии в течение 12 недель. 24 участника исследования были включены в группу активного препарата (СМД AT ФНО-α+AT S100+AT Гис по 2 таблетки 2 раза в день), 28 - в группу препарата сравнения (СМД AT Гис по 2 таблетки 2 раза в день). Обе группы пациентов были сопоставимы по исходным демографическим, антропометрическим и клинико-лабораторным показателям. 18 больных имели СРК с запорами (твердый или комковатый стул составлял более 25%, а жидкий стул - менее 25% всех опорожнений кишечника), 14 - СРК с диареей (кашицеобразный или жидкий стул составлял более 25%, а твердый стул - менее 25% всех опорожнений кишечника) и 20 - смешанный вариант СРК (соответственно и твердый, комковатый стул, и жидкий стул составляли более 25% всех опорожнений кишечника). В качестве критериев эффективности терапии учитывали снижение интенсивности боли/дискомфорта (среднее значение за неделю, колебания от 0 до 10 баллов) по сравнению с исходным состоянием, а также динамику других диспепсических симптомов по шкале VAS-IBS (Visual Analogue Scale-Irritable Bowel Syndrome (VAS-IBS): Guidance for Industry Irritable Bowel Syndrome - Clinical Evaluation of Products for Treatment. U.S. Department of Health and Human Services; Food and Drug Administration; Center for Drug Evaluation and Research (CDER). - March 2010; Muller-Lissner, S, G Koch, NJ Talley et al., 2004, Subject's Global Assessment of Relief: An Appropriate Method to Assess the Impact of Treatment on IBS-Related Symptoms in Clinical Trials, J Clin Epidemiol, 56:310-316; CPMP/EWP/785/97, 2003, Points to Consider on the Evaluation of Medicinal Products for 483 the Treatment of Irritable Bowel Syndrome, London, Available at: 484 http://www.emea.europa.eu/pdfs/human/ewp/078597en.pdf); изменение индекса висцеральной чувствительности (наихудший - 15, наилучший - 90) по шкале VSI (Visceral Sensitivity Index (VSI): Labus S. Jennifer et al. The Central Role of Gastrointestinal-Specific Anxiety in Irritable Bowel Syndrome: Further Validation of the Visceral Sensitivity Index Psychosomatic Medicine, 2007; 69:89-98) и результатов оценки по шкале HADS (Hospital Anxiety And Depression Scale (HADS): Snaith R. Philip. The Hospital Anxiety And Depression Scale. Health and Quality of Life Outcomes 2003, 1:1-4. http://www.hqlo.com/content/1/1/29); у пациентов с СРК с преобладанием диареи подсчитывали долю пациентов с изменением типа стула по Бристольской шкале формы стула (Guidance for Industry Irritable Bowel Syndrome - Clinical Evaluation of Products for Treatment. U.S. Department of Health and Human Services; Food and Drug Administration; Center for Drug Evaluation and Research (CDER). - March 2010.) до 5 и менее (но не ниже ≤2 в среднем за неделю); у пациентов в подгруппе СРК с преобладанием запоров - процент пациентов с увеличением числа актов дефекации в среднем на 1 раз в неделю по сравнению с исходным.A comparative study evaluating the effectiveness of the composition of SMD AT TNF-α + AT S100 + AT Gis and the monocomponent drug AT Gis in the treatment of patients with irritable bowel syndrome (IBS) involved 52 patients with a diagnosis verified in accordance with Rome III (2006), which underwent an outpatient course of observation and therapy for 12 weeks. 24 study participants were included in the active drug group (DMF AT TNF-α + AT S100 + AT Gis 2 tablets 2 times a day), 28 - in the comparison drug group (SMD AT GIS 2 tablets 2 times a day). Both groups of patients were comparable in terms of baseline demographic, anthropometric, and clinical laboratory parameters. 18 patients had IBS with constipation (hard or lumpy stools accounted for more than 25%, and loose stools - less than 25% of all bowel movements), 14 - IBS with diarrhea (mushy or loose stools made up more than 25%, and hard stools - less than 25% all bowel movements) and 20 - a mixed variant of IBS (respectively, hard, lumpy stools and loose stools accounted for more than 25% of all bowel movements). As criteria for the effectiveness of therapy, a decrease in the intensity of pain / discomfort (weekly average, fluctuations from 0 to 10 points) compared with the initial state, as well as the dynamics of other dyspeptic symptoms on the VAS-IBS (Visual Analogue Scale-Irritable Bowel Syndrome ( VAS-IBS): Guidance for Industry Irritable Bowel Syndrome - Clinical Evaluation of Products for Treatment. US Department of Health and Human Services; Food and Drug Administration; Center for Drug Evaluation and Research (CDER). - March 2010; Muller-Lissner, S, G Koch, NJ Talley et al., 2004, Subject's Global Assessment of Relief: An Appropriate Method to Assess the Impact of Treatment on IBS-Related Symptoms in Clinical Trials, J Clin Epidemiol, 56: 310-316; CPMP / EWP / 785/97, 2003, Points to Consider on the Evaluation of Medicinal Products for 483 the Treatment of Irritable Bowel Syndrome, London, Available at: 484 http://www.emea.europa.eu/pdfs/human/ewp/078597en.pdf); Visceral Sensitivity Index (VSI): Labus S. Jennifer et al. The Central Role of Gastrointestinal-Specific Anxiety in Irritable Bowel Syndrome: Further Validation of the Visceral Sensitivity Index Psychosomatic Medicine, 2007; 69: 89-98) and HADS score (Hospital Anxiety And Depression Scale (HADS): Snaith R. Philip. The Hospital Anxiety And Depression Scale. Health and Quality of Life Outcomes 2003, 1: 1-4. Http://www.hqlo.com/content/1/1/29); in patients with IBS with a predominance of diarrhea, the proportion of patients with a change in stool type was calculated according to the Bristol Stool Shape Scale (Guidance for Industry Irritable Bowel Syndrome - Clinical Evaluation of Products for Treatment. US Department of Health and Human Services; Food and Drug Administration; Center for Drug Evaluation and Research (CDER). - March 2010.) up to 5 or less (but not lower than ≤2 on average per week); in patients in the IBS subgroup with a predominance of constipation, the percentage of patients with an increase in the number of bowel movements on average 1 time per week compared to the original.
В клинической картине заболевания в обеих группах превалировал болевой абдоминальный синдром (средний балл 7,56±0,26 - в группе активного препарата и 7,21±0,24 - в группе сравнения по VAS-IBS) (Таблица 4), встречавшийся у 100% больных при первоначальном обследовании. Среди диспепсических проявлений одинаково часто регистрировались диарея (у 54% пациентов группы активного препарата и у 57% больных группы сравнения) и запоры (62% и 57% соответственно), вздутие живота и метеоризм (у 46% и 36% соответственно), выраженность которых была примерно одинаковой в двух группах (Таблица 4). Реже встречались тошнота и рвота (30% и 32% соответственно). Средние значения индекса висцеральной чувствительности (VSI) и показателя шкалы HADS не имели различий в обеих группах (Таблица 4), указывая на значимое влияние нарушений со стороны центральной нервной системы в развитии СРК. Помимо исследуемой терапии пациентам обеих групп разрешался прием слабительного средства Гутталакс® и противодиарейного средства Смекта® для купирования запоров или диареи соответственно, а также препарата Но-шпа® для уменьшения выраженности спастических болей в животе. Данные препараты принимались пациентами по необходимости. Все пациенты исследуемых групп завершили лечение в сроки, установленные протоколом исследования, досрочно выбывших пациентов не было.In the clinical picture of the disease, pain abdominal syndrome prevailed in both groups (average score 7.56 ± 0.26 in the active drug group and 7.21 ± 0.24 in the VAS-IBS comparison group) (Table 4), which occurred in 100% of patients at the initial examination. Among dyspeptic manifestations, diarrhea (in 54% of patients of the active drug group and in 57% of patients in the comparison group) and constipation (62% and 57%, respectively), bloating and flatulence (in 46% and 36%, respectively) were recorded equally, the severity of which was approximately the same in two groups (Table 4). Nausea and vomiting were less common (30% and 32%, respectively). The average visceral sensitivity index (VSI) and HADS score did not differ in both groups (Table 4), indicating a significant effect of disturbances on the part of the central nervous system in the development of IBS. In addition to the studied therapy, patients of both groups were allowed to take the laxative Guttalax® and the antidiarrheal Smecta® for relieving constipation or diarrhea, respectively, as well as No-shpa® to reduce the severity of spastic abdominal pain. These drugs were taken by patients as needed. All patients of the study groups completed the treatment within the time period established by the study protocol; there were no prematurely retired patients.
При анализе эффективности выявлено, что в течение 12-недельной терапии выраженность основного клинического проявления СРК - болевого абдоминального синдрома - у пациентов группы приема композиции СМД AT ФНО-α+AT S100+AT Гис снизилась в среднем более чем на 50% по сравнению с исходным состоянием (до 3,32±0,13 баллов). Данное снижение имело значимые отличия и при сравнении с результатами лечения препаратом сравнения (СМД AT Гис), который также способствовал уменьшению выраженности боли/дискомфорта, однако это уменьшение было менее существенным (менее чем на 30%).The analysis of efficacy revealed that during the 12-week therapy the severity of the main clinical manifestation of IBS - abdominal pain syndrome - in patients of the group receiving the composition of SMD AT TNF-α + AT S100 + AT Gis decreased on average by more than 50% compared with the initial state (up to 3.32 ± 0.13 points). This decrease had significant differences when compared with the results of treatment with the reference drug (SMD AT Gis), which also helped to reduce the severity of pain / discomfort, but this decrease was less significant (less than 30%).
Прием композиции СМД AT ФНО-α+AT S100+AT Гис положительно влиял на другие диспепсические расстройства у больных, включая диарею (снижение исходных 5,52±0,18 баллов до 3,34±0,22 баллов к окончанию терапии), запор (5,79±0,26 и 4,41±0,33 баллов соответственно), вздутие живота и метеоризм (4,98±0,34 и 3,84±0,24 баллов соответственно), причем эффективность в отношении двух последних симптомов имела значимые отличия при сравнении как с исходным состоянием, так и с эффективностью терапией монокомпонентным препаратом СМД AT Гис.Acceptance of the composition of SMD AT TNF-α + AT S100 + AT Gis had a positive effect on other dyspeptic disorders in patients, including diarrhea (reduction of the initial 5.52 ± 0.18 points to 3.34 ± 0.22 points by the end of therapy), constipation (5.79 ± 0.26 and 4.41 ± 0.33 points, respectively), bloating and flatulence (4.98 ± 0.34 and 3.84 ± 0.24 points, respectively), and the effectiveness in relation to the last two the symptoms had significant differences when compared with both the initial state and the effectiveness of therapy with the monocomponent drug SMD AT Gis.
В подгруппе пациентов с СРК с преобладанием диареи (n=14) доля пациентов с изменением типа стула по Бристольской шкале формы стула до 5 и менее в результате 12-недельного курса терапии композицией СМД AT ФНО-α+AT S100+AT Гис составила 57%; в подгруппе СРК с преобладанием запоров (n=18) процент пациентов с увеличением числа актов дефекации в среднем на 1 раз в неделю достиг 94%; среди пациентов со смешанным вариантом СРК (n=20) аналогичные показатели составили 45% и 75% соответственно. Среди пациентов группы сравнения изучаемые показатели не имели значимой динамики.In the subgroup of patients with IBS with a predominance of diarrhea (n = 14), the proportion of patients with a change in stool type on the Bristol scale of stool shape to 5 or less as a result of a 12-week course of therapy with SMD AT TNF-α + AT S100 + AT Gis was 57% ; in the IBS subgroup with a predominance of constipation (n = 18), the percentage of patients with an increase in the number of bowel movements on average 1 time per week reached 94%; among patients with a mixed IBS variant (n = 20), similar indicators were 45% and 75%, respectively. Among patients in the comparison group, the studied indicators did not have significant dynamics.
Эффективность лечения композицией СМД AT ФНО-α+AT S100+AT Гис проявлялась в положительном влиянии на висцеральную гиперчувствительность, которая значимо снизилась через 12-недель приема комбинированного препарата, в результате чего индекс VSI возрос с 22,3±1,6 до 68,7±2,4 (против 25,4±1,8 и 33,9±1,7 соответственно в группе препарата сравнения). Позитивные сдвиги под воздействием композиции СМД AT ФНО-α+AT S100+AT Гис проявлялись также в уменьшении суммарного балла по шкале HADS (с 19,3±1,4 до 12,8±0,6), что свидетельствовало о купировании исходно имевшей место субклинически выраженной тревоги и депрессии.The effectiveness of treatment with the SMD AT TNF-α + AT S100 + AT Gis composition was manifested in a positive effect on visceral hypersensitivity, which significantly decreased after 12 weeks of taking the combined drug, as a result of which the VSI index increased from 22.3 ± 1.6 to 68, 7 ± 2.4 (versus 25.4 ± 1.8 and 33.9 ± 1.7, respectively, in the comparison drug group). Positive shifts under the influence of the composition of SMD AT TNF-α + AT S100 + AT GIS also manifested themselves in a decrease in the total score on the HADS scale (from 19.3 ± 1.4 to 12.8 ± 0.6), which indicated the relief of the initial a place of subclinical anxiety and depression.
Оценка безопасности терапии, которую проводили на основании регистрации нежелательных явлений в период лечения и повторного исследования лабораторных показателей, свидетельствовала о хорошей переносимости препаратов. В анализ безопасности были включены данные всех пациентов, участвовавших в исследовании (n=52). В течение 12-недельного курса лечения ни у одного пациента из обеих групп не было выявлено ни одного нежелательного явления, имеющего «возможную» либо «очевидную» связь с приемом лекарственного средства. Лабораторные исследования, включая общий и биохимический анализы крови, клинический анализ мочи, также не зафиксировали каких-либо патологических отклонений в ходе терапии.The safety assessment of therapy, which was carried out on the basis of registration of adverse events during treatment and re-examination of laboratory parameters, indicated good tolerance to the drugs. The safety analysis included data from all patients participating in the study (n = 52). During the 12-week course of treatment, not a single patient from both groups revealed a single adverse event that had a “possible” or “obvious” connection with taking the drug. Laboratory studies, including general and biochemical blood tests, a clinical analysis of urine, also did not record any pathological abnormalities during therapy.
Таким образом, исследование продемонстрировало эффективность и безопасность композиции СМД AT ФНО-α+AT S100+AT Гис в лечении пациентов с СРК. Показано, что 12-недельный прием композиции СМД AT ФНО-α+AT S100+AT Гис способствовал купированию болевого абдоминального синдрома, а также значимому уменьшению выраженности диспепсических проявлений у больных с СРК. Эффект лечения подтверждался высоким процентом пациентов, улучшивших показатели опорожнения кишечника. Помимо положительной динамики основных симптомов со стороны желудочно-кишечного тракта, отмечалась закономерная нормализация соматического и психического состояния больного, что выражалось в позитивных изменениях висцеральной чувствительности и нивелировании симптомов тревоги и депрессии. Все отмеченные эффекты терапии композицией СМД AT ФНО-α+AT S100+AT Гис имели значимые различия по сравнению с исходным состоянием и результатами лечения СМД AT Гис. Профиль безопасности был одинаково высоким у обоих препаратов. И композиция СМД AT ФНО-α+AT S100+AT Гис, и монокомпонентный препарат СМД AT Гис не приводили к появлению нежелательных явлений либо патологических отклонений лабораторных показателей, связанных с приемом исследуемых лекарственных средств.Thus, the study demonstrated the effectiveness and safety of the composition of SMD AT TNF-α + AT S100 + AT His in the treatment of patients with IBS. It was shown that a 12-week intake of the composition of SMD AT TNF-α + AT S100 + AT Gis contributed to the relief of abdominal pain syndrome, as well as a significant decrease in the severity of dyspeptic manifestations in patients with IBS. The treatment effect was confirmed by a high percentage of patients who improved bowel movements. In addition to the positive dynamics of the main symptoms of the gastrointestinal tract, a normalization of the patient's somatic and mental state was observed, which was expressed in positive changes in visceral sensitivity and the leveling of symptoms of anxiety and depression. All the noted effects of therapy with the SMD AT TNF-α + AT S100 + AT Gis composition had significant differences compared with the initial state and the results of treatment with the SMD AT Gis. The safety profile was equally high for both drugs. Both the composition of SMD AT TNF-α + AT S100 + AT Gis and the monocomponent drug SMD AT Gis did not lead to the appearance of adverse events or pathological deviations of laboratory parameters associated with the administration of the studied drugs.
Claims (11)
Priority Applications (25)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
RU2011124809/15A RU2532323C2 (en) | 2011-06-20 | 2011-06-20 | Therapeutic agent for treating pathological syndrome and method of treating functional bowel disorders |
EP11775833.4A EP2593138A2 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
CA2804964A CA2804964C (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
US13/135,888 US8637030B2 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
CN2011800429401A CN103096927A (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
SG2013002290A SG187035A1 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
NZ606765A NZ606765A (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
ES201390001A ES2425004R1 (en) | 2010-07-15 | 2011-07-15 | Combined pharmaceutical composition and its use to prepare a drug for the treatment of diseases or functional conditions of the gastrointestinal tract |
IT000628A ITTO20110628A1 (en) | 2010-07-15 | 2011-07-15 | PHARMACEUTICAL COMPOSITION OF COMBINATION AND METHODS FOR TREATING FUNCTIONAL DISORDERS OR PATHOLOGICAL STATES OF THE GASTROINTESTINAL TRACT |
DE112011102355T DE112011102355T5 (en) | 2010-07-15 | 2011-07-15 | A combination pharmaceutical composition and method for the treatment of functional diseases or conditions of the gastrointestinal tract |
PCT/IB2011/002178 WO2012007839A2 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
KR1020137003751A KR101901465B1 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
MX2013000542A MX2013000542A (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract. |
BR112013000842A BR112013000842A2 (en) | 2010-07-15 | 2011-07-15 | pharmaceutical compositions, method of treating the condition of functional etiology of the gastrointestinal tract, and use of activated potentiated antibody form s-100, activated potentiated antibody form histamine and activated potentiated antibody form tnf-alpha. |
AU2011278032A AU2011278032B2 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
PE2013000075A PE20130397A1 (en) | 2010-07-15 | 2011-07-15 | COMBINED PHARMACEUTICAL COMPOSITION AND METHODS FOR THE TREATMENT OF DISEASES OR FUNCTIONAL CONDITIONS OF THE GASTROINTESTINAL TRACT |
GB1302654.7A GB2496794B (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
EA201300125A EA030542B1 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and method of treating diseases or conditions of functional etiology of gastrointestinal tract |
FR1156469A FR2962651A1 (en) | 2010-07-15 | 2011-07-15 | PHARMACEUTICAL ASSOCIATION COMPOSITION AND ITS USE IN METHODS FOR TREATING FUNCTIONAL DISEASES OR DISORDERS OF THE GASTROINTESTINAL TRACT |
JP2013519174A JP2013532181A (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and method for treating functional diseases or conditions of the gastrointestinal tract |
MYPI2013000109A MY157564A (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract |
ARP110102575A AR082245A1 (en) | 2010-07-15 | 2011-07-18 | PHARMACEUTICAL COMBINATION COMPOSITION TO TREAT FUNCTIONAL DISEASES OR CONDITIONS OF GASTROINTESTINAL TRACT |
CL2013000097A CL2013000097A1 (en) | 2010-07-15 | 2013-01-10 | Combined pharmaceutical composition that includes an enhanced activated form of an antibody of the s-100 protein and an enhanced activated form of an anti tnf-alpha antibody; methods for the treatment of diseases or functional conditions of the gastrointestinal tract. |
IL224215A IL224215A (en) | 2010-07-15 | 2013-01-14 | Combination pharmaceutical composition for treating functional diseases or conditions of the gastrointestinal tract |
JP2016131657A JP2016210787A (en) | 2010-07-15 | 2016-07-01 | Combination pharmaceutical compositions and methods for treating functional disorders or conditions of gastrointestinal tract |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
RU2011124809/15A RU2532323C2 (en) | 2011-06-20 | 2011-06-20 | Therapeutic agent for treating pathological syndrome and method of treating functional bowel disorders |
Publications (2)
Publication Number | Publication Date |
---|---|
RU2011124809A RU2011124809A (en) | 2012-12-27 |
RU2532323C2 true RU2532323C2 (en) | 2014-11-10 |
Family
ID=49257203
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
RU2011124809/15A RU2532323C2 (en) | 2010-07-15 | 2011-06-20 | Therapeutic agent for treating pathological syndrome and method of treating functional bowel disorders |
Country Status (1)
Country | Link |
---|---|
RU (1) | RU2532323C2 (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2197266C1 (en) * | 2001-06-01 | 2003-01-27 | Эпштейн Олег Ильич | Medicinal agent and method of treatment of erosive and inflammatory diseases of gastroenteric tract |
RU2343158C2 (en) * | 2004-01-27 | 2009-01-10 | Ньювело, Инк. | Gastrointestinal proliferative factor and its applications |
-
2011
- 2011-06-20 RU RU2011124809/15A patent/RU2532323C2/en not_active Application Discontinuation
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU2197266C1 (en) * | 2001-06-01 | 2003-01-27 | Эпштейн Олег Ильич | Medicinal agent and method of treatment of erosive and inflammatory diseases of gastroenteric tract |
RU2343158C2 (en) * | 2004-01-27 | 2009-01-10 | Ньювело, Инк. | Gastrointestinal proliferative factor and its applications |
Non-Patent Citations (2)
Title |
---|
0. * |
ЭПШТЕЙН О.И. и др. "Фармакология сверхмалых доз антител к эндогенным регуляторам функций". М., РАМН, 2005, [найдено 29.05.2012] найдено из Интернет:folof.ru›"knigi"farmakologiya"sverhmalyih"antitel) * |
Also Published As
Publication number | Publication date |
---|---|
RU2011124809A (en) | 2012-12-27 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8637030B2 (en) | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract | |
EP1997481B1 (en) | Solid oral form of a medicinal preparation and a method for the production thereof | |
EP2601219A2 (en) | Combination pharmaceutical composition and methods of treating and preventing the infectious diseases | |
JPS63502591A (en) | Methods and substances for the treatment of rheumatoid arthritis | |
RU2500427C2 (en) | Therapeutic agent for treating functional gastrointestinal disturbance and method of treating functional gastrointestinal disturbance | |
RU2532323C2 (en) | Therapeutic agent for treating pathological syndrome and method of treating functional bowel disorders | |
RU2502521C2 (en) | Combined drug for treating bacterial infections and method of treating bacterial infections | |
RU2526153C2 (en) | Method for increase of pharmacological activity of active agent of drug preparation and pharmaceutical composition | |
RU2531049C2 (en) | Therapeutic agent for treating prostatic diseases and method of treating prostatic diseases | |
RU2651005C2 (en) | Method of increasing the pharmacological activity of the activated-potentiated form of antibodies to the prostate-specific antigen and the pharmaceutical composition | |
RU2533224C2 (en) | Method of treating psychoactive substance dependence, alcohol and nicotine addiction and medication for treatment of psychoactive substance dependence, alcohol and nicotine addiction | |
RU2542414C2 (en) | Medication for treating erectile dysfunctions and method of treating erectile dysfunctions | |
RU2509573C2 (en) | Drug for treating multiple sclerosis and method of treating multiple sclerosis | |
RU2519196C2 (en) | Therapeutic agent for treating pathological syndrome and method of treating multiple sclerosis | |
RU2446821C2 (en) | Drug preparation for treating infectious diseases accompanied by neurotoxic disorders, and method of treating infectious diseases accompanied by neurotoxic disorders | |
RU2529783C2 (en) | Medication for treating pathological syndrome and method of treating acute and chronic respiratory system diseases and cough synrdome | |
RU2522499C2 (en) | Drug preparation for treating infectious diseases accompanied by neurotoxic disorders, and method of treating infectious diseases accompanied by neurotoxic disorders | |
RU2441023C1 (en) | Drug for multiple sclerosis and method for treating multiple sclerosis | |
RU2536230C2 (en) | Therapeutic agent for treating neurological behaviour disorders and method of treating neurological behaviour development disorders | |
RU2519695C2 (en) | Medication for treating attention deficit disorder and method of treating attention deficit disorder | |
RU2523451C2 (en) | Method of treating chronic cardiac failure and pharmaceutical composition for treating chronic cardiac failure | |
RU2565400C2 (en) | Medication for treating genitourinary system diseases and method of treating genitourinary system diseases | |
RU2528093C2 (en) | Pharmaceutical composition and method of treating acute and chronic respiratory diseases and cough syndrome |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FA92 | Acknowledgement of application withdrawn (lack of supplementary materials submitted) |
Effective date: 20130328 |
|
FZ9A | Application not withdrawn (correction of the notice of withdrawal) |
Effective date: 20140320 |
|
HZ9A | Changing address for correspondence with an applicant | ||
QZ41 | Official registration of changes to a registered agreement (patent) |
Free format text: LICENCE FORMERLY AGREED ON 20130114 Effective date: 20160229 |
|
QZ41 | Official registration of changes to a registered agreement (patent) |
Free format text: LICENCE FORMERLY AGREED ON 20130114 Effective date: 20170830 |
|
QC41 | Official registration of the termination of the licence agreement or other agreements on the disposal of an exclusive right |
Free format text: LICENCE FORMERLY AGREED ON 20130114 Effective date: 20190129 |
|
PC41 | Official registration of the transfer of exclusive right |
Effective date: 20190201 |