RU2565400C2 - Medication for treating genitourinary system diseases and method of treating genitourinary system diseases - Google Patents
Medication for treating genitourinary system diseases and method of treating genitourinary system diseases Download PDFInfo
- Publication number
- RU2565400C2 RU2565400C2 RU2011127053/15A RU2011127053A RU2565400C2 RU 2565400 C2 RU2565400 C2 RU 2565400C2 RU 2011127053/15 A RU2011127053/15 A RU 2011127053/15A RU 2011127053 A RU2011127053 A RU 2011127053A RU 2565400 C2 RU2565400 C2 RU 2565400C2
- Authority
- RU
- Russia
- Prior art keywords
- antibodies
- pharmaceutical composition
- day
- prostate
- administered
- Prior art date
Links
Landscapes
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Изобретение относится к области медицины и может быть использовано для лечения заболеваний мочеполовой системы, в частности заболеваний предстательной железы, включая доброкачественную гиперплазию предстательной железы I и II стадии, острый и хронический простатит, и эректильной дисфункции различного происхождения.The invention relates to medicine and can be used to treat diseases of the genitourinary system, in particular diseases of the prostate gland, including benign prostatic hyperplasia of the I and II stages, acute and chronic prostatitis, and erectile dysfunction of various origins.
Из уровня техники известно лекарственное средство для лечения заболеваний предстательной железы, содержащее активированную форму сверхмалых доз антител к простатоспецифическому антигену (RU 2192889 C1, А61К 39/395, 20.11.2002). Однако данное лекарственное средство не обеспечивает достаточную терапевтическую эффективность при лечении заболеваний мочеполовой системы, сопровождающихся нарушением эрекции различного происхождения (эректильной дисфункцией).In the prior art, a medicament for treating prostate diseases is known containing an activated form of ultra-low doses of antibodies to a prostate-specific antigen (RU 2192889 C1, A61K 39/395, 11/20/2002). However, this drug does not provide sufficient therapeutic efficacy in the treatment of diseases of the genitourinary system, accompanied by impaired erection of various origins (erectile dysfunction).
Из уровня техники известно лекарственное средство для лечения эректильных дисфункций, содержащее активированную форму сверхмалых доз антител к эндотелиальной NO-синтазе (RU 2191601 C1, А61К 39/395, 27.10.2002). Однако данное лекарственное средство не обеспечивает достаточную терапевтическую эффективность при лечении заболеваний предстательной железы.A medicament for treating erectile dysfunctions is known which contains an activated form of ultra-low doses of antibodies to endothelial NO synthase (RU 2191601 C1, A61K 39/395, 10.27.2002). However, this drug does not provide sufficient therapeutic efficacy in the treatment of prostate diseases.
Изобретение направлено на создание лекарственного средства в виде фармацевтической композиции, обеспечивающего эффективное лечение различных заболеваний мочеполовой системы, включая доброкачественную гиперплазию предстательной железы (ДГПЖ) I и II стадии, острый и хронический простатит, дизурические расстройства, нарушение эрекции, вегетативные расстройства климактерического периода у мужчин, и использование в комплексной терапии, применяемой до и после оперативных вмешательств на предстательной железе.The invention is directed to the creation of a medicinal product in the form of a pharmaceutical composition that provides effective treatment of various diseases of the genitourinary system, including benign prostatic hyperplasia (BPH) stage I and II, acute and chronic prostatitis, dysuric disorders, erectile dysfunction, autonomic menopause in men, and use in complex therapy used before and after surgical interventions on the prostate gland.
Решение поставленной задачи обеспечивается тем, что лекарственное средство для лечения заболеваний мочеполовой системы, содержащее активированную - потенцированную форму антител к простатоспецифическому антигену, согласно изобретению, выполнено в виде фармацевтической композиции и дополнительно содержит активированную - потенцированную форму антител к эндотелиальной NO-синтазе.The solution to this problem is provided by the fact that the drug for the treatment of diseases of the genitourinary system, containing the activated - potentiated form of antibodies to the prostate-specific antigen, according to the invention, is made in the form of a pharmaceutical composition and further comprises an activated - potentiated form of antibodies to endothelial NO synthase.
При этом активированную - потенцированную форму антител к простатоспецифическому антигену и активированную - потенцированную форму антител к эндотелиальной NO-синтазе используют в виде активированного - потенцированного водного или водно-спиртового раствора, полученного в процессе последовательного многократного разведения матричного раствора соответствующих антител в водном или водно-спиртовом растворителе и промежуточного внешнего механического воздействия - встряхивания.In this case, the activated — potentiated form of antibodies to the prostate-specific antigen and the activated — potentiated form of antibodies to endothelial NO synthase are used in the form of an activated — potentiated aqueous or aqueous-alcoholic solution obtained by sequential multiple dilution of the matrix solution of the corresponding antibodies in aqueous or aqueous-alcoholic solvent and intermediate external mechanical impact - shaking.
Предпочтительно, фармацевтическую композицию, содержащую активированную - потенцированную форму антител к простатоспецифическому антигену и активированную потенцированную форму антител к эндотелиальной NO-синтазе, используют для лечения заболеваний предстательной железы.Preferably, a pharmaceutical composition comprising an activated - potentiated form of antibodies to a prostate-specific antigen and an activated potentiated form of antibodies to endothelial NO synthase is used to treat prostate diseases.
Кроме того, фармацевтическую композицию, содержащую активированную - потенцированную форму антител к простатоспецифическому антигену и активированную - потенцированную форму антител к эндотелиальной NO-синтазе, используют для лечения эректильной дисфункций различного происхождения.In addition, a pharmaceutical composition comprising an activated — potentiated form of antibodies to a prostate-specific antigen and an activated — potentiated form of antibodies to endothelial NO synthase is used to treat erectile dysfunctions of various origins.
Фармацевтическая композиция может быть выполнена в твердой лекарственной форме и содержать эффективное количество гранул нейтрального носителя, насыщенного смесью активированной - потенцированной формы антител к простатоспецифическому антигену и активированной - потенцированной формы антител к эндотелиальной NO-синтазе, и фармацевтически приемлемые добавки, включающие лактозу, целлюлозу микрокристаллическую и магния стеарат.The pharmaceutical composition may be in solid dosage form and contain an effective amount of granules of a neutral carrier saturated with a mixture of an activated — potentiated form of antibodies to a prostate-specific antigen and an activated — potentiated form of antibodies to endothelial NO synthase, and pharmaceutically acceptable additives including lactose, microcrystalline cellulose and magnesium stearate.
При этом водные или водно-спиртовые растворы активированных - потенцированных форм антител к простатоспецифическому антигену и к эндотелиальной NO-синтазе могут быть получены путем многократного последовательного разведения и промежуточного внешнего воздействия из матричных растворов аффинно очищенных антител к простатоспецифическому антигену и к эндотелиальной NO-синтазе с концентрацией 0,5÷5,0 мг/мл.In this case, aqueous or aqueous-alcoholic solutions of activated - potentiated forms of antibodies to prostate-specific antigen and to endothelial NO synthase can be obtained by repeated serial dilution and intermediate external exposure from matrix solutions of affinity-purified antibodies to prostate-specific antigen and to endothelial NO synthase with a concentration 0.5 ÷ 5.0 mg / ml.
Причем каждый из компонентов может быть использовано в виде смеси различных, преимущественно сотенных, гомеопатических разведений.Moreover, each of the components can be used in the form of a mixture of various, mainly hundred, homeopathic dilutions.
Решение поставленной задачи обеспечивается также тем, что в способе лечения заболеваний мочеполовой системы путем введения в организм активированной - потенцированной формы антител к простатоспецифическому антигену, согласно изобретению, дополнительно одновременно и сочетано вводят активированную - потенцированную форму антител к эндотелиальной NO-синтазе.The solution of this problem is also ensured by the fact that in the method of treating diseases of the genitourinary system by introducing into the body an activated - potentiated form of antibodies to a prostate-specific antigen, according to the invention, an activated - potentiated form of antibodies to endothelial NO synthase is additionally simultaneously combined.
При этом активированную - потенцированную форму антител к простатоспецифическому антигену и активированную - потенцированную форму антител к эндотелиальной NO-синтазе используют в виде активированного - потенцированного водного или водно-спиртового раствора каждого компонента, полученного в процессе последовательного многократного разведения в водном или водно-спиртовом растворителе и промежуточного внешнего механического воздействия - встряхивания.In this case, the activated — potentiated form of antibodies to the prostate-specific antigen and the activated — potentiated form of antibodies to endothelial NO synthase are used in the form of an activated — potentiated aqueous or hydroalcoholic solution of each component obtained by repeated dilution in an aqueous or hydroalcoholic solvent and intermediate external mechanical impact - shaking.
Предпочтительно в организм вводят фармацевтическую композицию, приготовленную в виде единого лекарственного препарата - одной лекарственной формы, содержащую смесь различных гомеопатических разведений антител к простатоспецифическому антигену в сочетании со смесью различных гомеопатических разведений антител к эндотелиальной NO-синтазе.Preferably, the pharmaceutical composition is administered in the form of a single drug, a single dosage form containing a mixture of various homeopathic dilutions of antibodies to a prostate-specific antigen in combination with a mixture of various homeopathic dilutions of antibodies to endothelial NO synthase.
Предпочтительно активированную - потенцированную форму антител к простатоспецифическому антигену и активированную - потенцированную форму антител к эндотелиальной NO-синтазе используют для лечения заболеваний предстательной железы.Preferably, the activated — potentiated form of antibodies to the prostate-specific antigen and the activated — potentiated form of antibodies to endothelial NO synthase are used to treat diseases of the prostate gland.
При этом активированную - потенцированную форму антител к простатоспецифическому антигену и активированную - потенцированную форму антител к эндотелиальной NO-синтазе используют для лечения доброкачественной гиперплазии предстательной железы I и II стадии.At the same time, the activated - potentiated form of antibodies to the prostate-specific antigen and the activated - potentiated form of antibodies to endothelial NO synthase are used to treat benign prostatic hyperplasia of stage I and II.
Причем активированную - потенцированную форму антител к простатоспецифическому антигену и активированную потенцированную форму антител к эндотелиальной NO-синтазе используют для лечения острого и хронического простатита.Moreover, the activated - potentiated form of antibodies to the prostate-specific antigen and the activated potentiated form of antibodies to endothelial NO synthase are used to treat acute and chronic prostatitis.
Кроме того, активированную - потенцированную форму антител к простатоспецифическому антигену и активированную - потенцированную форму антител к эндотелиальной NO-синтазе используют для лечения эректильной дисфункции различного происхождения.In addition, the activated — potentiated form of antibodies to prostate-specific antigen and the activated — potentiated form of antibodies to endothelial NO synthase are used to treat erectile dysfunction of various origins.
При этом фармацевтическую композицию можно использовать в твердой лекарственной форме - таблетке, которая содержит эффективное количество гранул нейтрального носителя, насыщенного смесью активированной - потенцированной формы антител к простатоспецифическому антигену и активированной -потенцированной формы антител к эндотелиальной NO-синтазе, и фармацевтически приемлемые добавки.In this case, the pharmaceutical composition can be used in solid dosage form — a tablet, which contains an effective amount of granules of a neutral carrier saturated with a mixture of the activated — potentiated form of antibodies to the prostate-specific antigen and the activated —potentiated form of antibodies to endothelial NO synthase, and pharmaceutically acceptable additives.
Предпочтительно фармацевтическую композицию в твердой лекарственной форме вводят в организм по 1-4 таблетки 1-6 раз в день, например, по следующим схемам:Preferably, the pharmaceutical composition in solid dosage form is administered to the body in 1-4 tablets 1-6 times a day, for example, according to the following schemes:
- 1 таблетка 1 раз/день;- 1 tablet 1 time / day;
- 1 таблетка 2 раза/день;- 1 tablet 2 times / day;
- 1 таблетка 3 раза/день;- 1 tablet 3 times / day;
- 1 таблетка 4 раза/день;- 1 tablet 4 times / day;
- 1 таблетка 5 раз/день;- 1 tablet 5 times / day;
- 1 таблетка 6 раз/день;- 1 tablet 6 times / day;
- 2 таблетки 1 раз/день;- 2 tablets 1 time / day;
- 2 таблетки 2 раза/день;- 2 tablets 2 times / day;
- 2 таблетки 3 раза/день;- 2 tablets 3 times / day;
- 2 таблетки 4 раза/день;- 2 tablets 4 times / day;
- 2 таблетки 5 раз/день;- 2 tablets 5 times / day;
- 2 таблетки 6 раз/день;- 2 tablets 6 times / day;
- 3 таблетки 1 раз/день;- 3 tablets 1 time / day;
- 3 таблетки 2 раза/день;- 3 tablets 2 times / day;
- 3 таблетки 3 раза/день;- 3 tablets 3 times / day;
- 3 таблетки 4 раза/день;- 3 tablets 4 times / day;
- 4 таблетки 1 раз/день;- 4 tablets 1 time / day;
- 4 таблетки 2 раза/день;- 4 tablets 2 times / day;
- 4 таблетки 3 раза/день.- 4 tablets 3 times / day.
При этом каждый из действующих компонентов представляет собой смесь различных гомеопатических сотенных разведений.Moreover, each of the active components is a mixture of various homeopathic hundred-fold dilutions.
Предпочтительно, лекарственное средство содержит действующие компоненты в соотношении 1:1, при этом каждый компонент используют в виде смеси трех соответствующих матричных растворов, разведенных в 10012, 10030, и 100200 раз, что эквивалентно сотенным гомеопатическим разведениям С 12, С 30, С 200.Preferably, the drug contains active ingredients in a 1: 1 ratio, each component being used as a mixture of three appropriate matrix solutions, diluted 100 12 , 100 30 , and 100 200 times, which is equivalent to hundreds of homeopathic dilutions C 12, C 30, C 200.
Предложенное сочетание активированных - потенцированных форм антител к простатоспецифическому антигену (ПСА) и к эндотелиальной NO-синтазе в фармацевтической композиции (т.е. формы антител к простатоспецифическому антигену (ПСА) и к эндотелиальной NO-синтазе, приготовленные по гомеопатической технологии потенцирования путем многократного последовательного разведения и промежуточного внешнего воздействия - встряхивания, которые обладают активностью в фармакологических моделях и/или клинических методах лечения заболеваний мочеполовой системы) обеспечивает получение неожиданного синергетического терапевтического эффекта, подтвержденного на адекватных экспериментальных моделях и клинических исследованиях, который заключается в улучшении васкуляризации, усилении антиаденомного (антипролиферативного) эффекта и в усилении противовоспалительного эффекта. Заявленное лекарственное средство способствует нормализации функционального состояния простаты и нижних отделов мочевыводящих путей, улучшению показателей уродинамики, уменьшению эректильной дисфункции, и способствует нормализации уровня ПСА. Заявленное средство может применяться как при консервативной терапии, так и у больных с ДГПЖ, перенесших оперативное вмешательство для уменьшения объема предстательной железы, активирует регенеративно-репарационные процессы у пациентов, перенесших оперативное вмешательство по поводу ДГПЖ, уменьшает вероятность развития осложнений после операции. Кроме того, заявленное техническое решение способствует улучшению качества жизни пациентов с доброкачественной гиперплазии предстательной железы (ДГПЖ), простатитом и другими заболеваниями предстательной железы, уменьшает дизурические расстройства, оказывают вегетостабилизирующее действие и улучшает сперматологические показатели. Указанный технический результат обусловлен эндотелиопротективным действием активированной - потенцированной формы антител к эндотелиальной NO-синтазе, которая усиливает антипролиферативную и противовоспалительную активность активированной - потенцированной формы антител к ПСА, в том числе за счет воздействия активированной - потенцированной формы антител к эндотелиальной NO-синтазе на трансдукцию внутриклеточного сигнала, при их одновременном и совместном использовании в виде комплексного препарата.The proposed combination of activated - potentiated forms of antibodies to prostate-specific antigen (PSA) and to endothelial NO synthase in a pharmaceutical composition (i.e., forms of antibodies to prostate-specific antigen (PSA) and to endothelial NO synthase prepared by homeopathic technology of potentiation by multiple sequential dilution and intermediate external exposure - shaking, which are active in pharmacological models and / or clinical methods of treatment of diseases of the urogenital system) provides an unexpected synergistic therapeutic effect confirmed to adequate experimental models and clinical trials, which is to improve vascularization, enhancing antiadenomnogo (antiproliferative) effect and to enhance the anti-inflammatory effect. The claimed drug helps to normalize the functional state of the prostate and lower urinary tract, improve urodynamics, reduce erectile dysfunction, and helps to normalize the level of PSA. The claimed agent can be used both in conservative therapy and in patients with BPH who underwent surgery to reduce the volume of the prostate gland, activates regenerative and repair processes in patients who underwent surgery for BPH, reduces the likelihood of complications after surgery. In addition, the claimed technical solution improves the quality of life of patients with benign prostatic hyperplasia (BPH), prostatitis and other diseases of the prostate gland, reduces dysuric disorders, has a vegetative stabilizing effect and improves spermatological parameters. The specified technical result is due to the endothelial protective effect of the activated - potentiated form of antibodies to endothelial NO synthase, which enhances the antiproliferative and anti-inflammatory activity of the activated - potentiated form of antibodies to PSA, including due to the effect of the activated - potentiated form of antibodies to endothelial NO synthase on intracellular transduction signal, with their simultaneous and joint use in the form of a complex preparation.
При этом заявленное техническое решение характеризуется широтой терапевтического воздействия и может быть использовано для широкого спектра показаний, связанных с заболеваниями мочеполовой системы, сопровождающимися заболеваниями предстательной железы и эректильной дисфункцией, в том числе в составе комплексной терапии.Moreover, the claimed technical solution is characterized by the breadth of therapeutic effect and can be used for a wide range of indications associated with diseases of the genitourinary system, accompanied by diseases of the prostate gland and erectile dysfunction, including as part of complex therapy.
Кроме того, заявленное лекарственное средство расширяет арсенал препаратов, предназначенных для лечения мочеполовой системы.In addition, the claimed drug expands the arsenal of drugs intended for the treatment of the genitourinary system.
Для приготовления активированной - потенцированной формы действующих компонентов используют моноклональные или, преимущественно, поликлональные антитела, которые могут быть получены по известным технологиям - методикам, описанным, например, в книге: Иммунологические методы, под ред. Г.Фримеля, М., «Медицина», 1987, с.9-33; или, например, в статье Laffly Е., Sodoyer R. Hum. Antibodies. Monoclonal and recombinant antibodies, 30 years after. - 2005 - Vol.14. - N 1-2. P.33-55.For the preparation of the activated - potentiated form of the active components, monoclonal or, mainly, polyclonal antibodies are used, which can be obtained by known technologies - methods described, for example, in the book: Immunological methods, ed. G. Fremel, M., "Medicine", 1987, S. 9-33; or, for example, in an article by Laffly E., Sodoyer R. Hum. Antibodies. Monoclonal and recombinant antibodies, 30 years after. - 2005 - Vol.14. - N 1-2. P.33-55.
Моноклональные антитела получают, например, с помощью гибридомной технологии. Причем начальная стадия процесса включает иммунизацию, основанную на принципах, уже разработанных при приготовлении поликлональных антисывороток. Дальнейшие этапы работы предусматривают получение гибридных клеток, продуцирующих клоны одинаковых по специфичности антител. Их выделение в индивидуальном виде проводится теми же методами, что и в случае поликлональных антисывороток.Monoclonal antibodies are obtained, for example, using hybridoma technology. Moreover, the initial stage of the process includes immunization, based on the principles already developed in the preparation of polyclonal antisera. Further stages of the work include obtaining hybrid cells producing clones of antibodies of the same specificity. Their isolation in an individual form is carried out by the same methods as in the case of polyclonal antisera.
Поликлональные антитела могут быть получены активной иммунизацией животных. Для этого по специально разработанной схеме животным делают серию инъекций требуемыми в соответствии с изобретением веществами - антигенами: простатоспецифическим антигеном (ПСА) и эндотелиальной NO-синтазой. В результате проведения такой процедуры получают моноспецифические антисыворотки с высоким содержанием антител, которые используют для получения активированных - потенцированных форм. При необходимости проводят очистку антител, присутствующих в антисыворотке, например, методом аффинной хроматографии, путем применения фракционирования солевым осаждением или ионообменной хроматографии.Polyclonal antibodies can be obtained by active immunization of animals. For this purpose, according to a specially developed scheme, animals are given a series of injections with the antigens required by the invention: prostate-specific antigen (PSA) and endothelial NO synthase. As a result of this procedure, monospecific antisera with a high content of antibodies are obtained, which are used to obtain activated - potentiated forms. If necessary, the antibodies present in the antiserum are purified, for example, by affinity chromatography, using fractionation by salt precipitation or ion exchange chromatography.
Предпочтительным для приготовления заявленной фармацевтической композиции является использование поликлональных антител к простатоспецифическому антигену (ПСА) и к эндотелиальной NO-синтазе, которые в качестве матричного (первичного) раствора с концентрацией 0,5÷5,0 мг/мл, используют для последующего приготовления активированной - потенцированной формы.Preferred for the preparation of the claimed pharmaceutical composition is the use of polyclonal antibodies to prostate-specific antigen (PSA) and to endothelial NO synthase, which are used as a matrix (primary) solution with a concentration of 0.5 ÷ 5.0 mg / ml for the subsequent preparation of activated - potentiated form.
Предпочтительной для приготовления каждого компонента является использование смеси трех водно-спиртовых разведений первичного матричного раствора антител, разведенных соответственно в 10012, 10030, и 100200 раз, что соответствует сотенным гомеопатическим разведениям С 12, С 30 и С 200.Preferred for the preparation of each component is the use of a mixture of three water-alcohol dilutions of the primary matrix solution of antibodies diluted 100 12 , 100 30 , and 100,200 times, respectively, which corresponds to hundreds of homeopathic dilutions of C 12, C 30 and C 200.
Предпочтительным для приготовления заявленного лекарственного препарата является использование поликлональных антител к простатоспецифическому антигену (ПСА) и эндотелиальной NO-синтазе, которые могут быть получены иммунизацией кроликов следующим образом.Preferred for the preparation of the claimed drug is the use of polyclonal antibodies to prostate-specific antigen (PSA) and endothelial NO synthase, which can be obtained by immunization of rabbits as follows.
Для проведения экспериментальных исследований были использованы антитела, приготовленные по заказу специализированной фармацевтической фирмой.For experimental studies were used antibodies prepared by order of a specialized pharmaceutical company.
Поликлональные антитела к простатоспецифическому антигену (ПСА) получают, используя в качестве иммуногена (антигена) для иммунизации кроликов адъювант и цельную молекулу простатоспецифического антигена следующей последовательности:Polyclonal antibodies to a prostate-specific antigen (PSA) are prepared using an adjuvant and a whole prostate-specific antigen molecule of the following sequence as an immunogen (antigen) for immunizing rabbits:
Возможно для получения поликлональных антител к простатоспецифическому антигену (ПСА) использование в качестве иммуногена (антигена) одного полипептидного фрагмента простатоспецифического антигена, выбранного, например, из следующих аминокислотных последовательностей:It is possible to obtain polyclonal antibodies to a prostate-specific antigen (PSA) using one polypeptide fragment of a prostate-specific antigen as an immunogen (antigen), selected, for example, from the following amino acid sequences:
Перед отбором крови за 7-9 дней проводят 1-3 внутривенных инъекций для повышения уровня антител. В процессе иммунизации у кроликов отбирают небольшие пробы крови для оценки количества антител. Максимальный уровень иммунного ответа на введение большинства растворимых антигенов достигается через 40-60 дней после первой инъекции. После окончания первого цикла иммунизации кроликов в течение 30 дней дают восстановить здоровье и проводят реиммунизацию, включающую 1-3 внутривенные инъекции. Для получения антисыворотки из иммунизированных кроликов собирают кровь в центрифужную пробирку объемом 50 мл. С помощью деревянного шпателя удаляют со стенок пробирки образовавшиеся сгустки и помещают палочку в сгусток, образовавшийся в центре пробирки. Кровь помещают в холодильник (температура 4°С) на ночь. На следующий день удаляют сгусток, прикрепившийся к шпателю, и центрифугируют оставшуюся жидкость при 13000 g в течение 10 мин. Супернатант (надосадочная жидкость) является антисывороткой. Полученная антисыворотка должна быть желтого цвета. Добавляют к антисыворотке 20% (весовая концентрация) NaN3 до конечной концентрации 0,02% и хранят до использования в замороженном состоянии при температуре -20°С (или без NaN3 - при -70°С). Для выделения из антисыворотки антител к простатоспецифическому антигену (ПСА) производят абсорбцию на твердой фазе в следующей последовательности:Before blood sampling for 1-3 days, 1-3 intravenous injections are performed to increase the level of antibodies. During immunization, small blood samples are taken from rabbits to evaluate the amount of antibody. The maximum level of the immune response to the administration of most soluble antigens is achieved 40-60 days after the first injection. After the end of the first cycle of immunization of rabbits for 30 days, they restore health and re-immunization, including 1-3 intravenous injections. To obtain antisera from immunized rabbits, blood is collected in a 50 ml centrifuge tube. Using a wooden spatula, the formed clots are removed from the walls of the tube and the wand is placed in the clot formed in the center of the tube. Blood is placed in a refrigerator (temperature 4 ° C) at night. The next day, the clot attached to the spatula is removed and the remaining liquid is centrifuged at 13000 g for 10 minutes. The supernatant (supernatant) is an antiserum. The resulting antiserum should be yellow. Add to the antiserum 20% (weight concentration) NaN 3 to a final concentration of 0.02% and store until use in a frozen state at a temperature of -20 ° C (or without NaN 3 at -70 ° C). To isolate antibodies to the prostate-specific antigen (PSA) from the antiserum, absorption on the solid phase is carried out in the following sequence:
1. 10 мл антисыворотки кролика разбавляют в 2 раза 0,15 М NaCl добавляют 6,26 г Na2SO4, перемешивают и инкубируют 12-16 ч при 4°С;1. 10 ml of rabbit antiserum is diluted 2 times with 0.15 M NaCl, 6.26 g of Na 2 SO 4 are added, stirred and incubated for 12-16 hours at 4 ° C;
2. выпавший осадок удаляют центрифугированием, растворяют в 10 мл фосфатного буфера и затем диализуют против того же буфера в течение ночи при комнатной температуре;2. The precipitate formed is removed by centrifugation, dissolved in 10 ml of phosphate buffer and then dialyzed against the same buffer overnight at room temperature;
3. после удаления осадка центрифугированием раствор наносят на колонку с ДЭАЭ-целлюлозой, уравновешенную фосфатным буфером;3. after removal of the precipitate by centrifugation, the solution is applied to a column with DEAE-cellulose, balanced with phosphate buffer;
4. фракцию антител определяют, измеряя оптическую плотность элюата при 280 нм.4. The antibody fraction is determined by measuring the optical density of the eluate at 280 nm.
Затем производят очистку антител методом аффинной хроматографии путем прикрепления полученных антител к простатоспецифическому антигену (ПСА), который находится на нерастворимом матриксе с последующим элюированием концентрированными растворами соли.The antibodies are then purified by affinity chromatography by attaching the obtained antibodies to a prostate-specific antigen (PSA), which is located on an insoluble matrix, followed by elution with concentrated salt solutions.
Полученный, таким образом, буферный раствор поликлональных кроличьих антител к простатоспецифическому антигену (ПСА), очищенных на антигене, с концентрацией 0,5÷5,0 мг/мл, предпочтительно 2,0÷3,0 мг/мл, используют в качестве матричного (первичного) раствора для последующего приготовления активированной - потенцированной формы.Thus obtained, a buffer solution of polyclonal rabbit antibodies to prostate-specific antigen (PSA), purified on the antigen, with a concentration of 0.5 ÷ 5.0 mg / ml, preferably 2.0 ÷ 3.0 mg / ml, is used as a matrix (primary) solution for the subsequent preparation of the activated - potentiated form.
Поликлональные антитела к эндотелиальной NO-синтазе получают аналогичным вышеуказанным способом, используя в качестве иммуногена (антигена) для иммунизации кроликов адъювант и цельную молекулу эндотелиальной NO-синтазы следующей последовательности:Polyclonal antibodies to endothelial NO synthase are obtained in a similar manner to the above, using as an immunogen (antigen) for immunization of rabbits an adjuvant and a whole molecule of endothelial NO synthase of the following sequence:
Возможно для получения поликлональных антител к эндотелиальной NO-синтазе использование в качестве иммуногена (антигена) цельной молекулы эндотелиальной NO-синтазы следующей последовательности:It is possible to obtain polyclonal antibodies to endothelial NO synthase using the following sequence as an immunogen (antigen) of a whole molecule of endothelial NO synthase:
Возможно для получения поликлональных антител к эндотелиальной NO-синтазе использование в качестве иммуногена (антигена) синтетического пептида эндотелиальной NO-синтазы, выбранного, например, из следующих аминокислотных последовательностей:It is possible to obtain polyclonal antibodies to endothelial NO synthase using, as an immunogen (antigen), a synthetic peptide of endothelial NO synthase, selected, for example, from the following amino acid sequences:
Активированную - потенцированную форму каждого компонента готовят путем равномерного уменьшения концентрации в результате последовательного разведения 1 части упомянутого матричного раствора в 9 частях (для десятичного разведения) или в 99 частях (для сотенного разведения) или в 999 частях (для тысячного разведения) нейтрального растворителя с многократным вертикальным встряхиванием ("динамизацией") каждого полученного разведения и использованием отдельных емкостей для каждого последующего разведения до получения требуемой потенции - кратности разведения по гомеопатическому методу (см., например, В.Швабе "Гомеопатические лекарственные средства", М., 1967 г., с.14-29).The activated - potentiated form of each component is prepared by uniformly decreasing the concentration as a result of successive dilution of 1 part of the matrix solution in 9 parts (for decimal dilution) or in 99 parts (for hundredth dilution) or in 999 parts (for thousandth dilution) of a neutral solvent with multiple vertical shaking ("dynamization") of each dilution obtained and using separate containers for each subsequent dilution to obtain the desired potency - to breeding rates according to the homeopathic method (see, for example, V. Schwabe "Homeopathic medicines", M., 1967, p.14-29).
Внешнюю обработку в процессе уменьшения концентрации также можно осуществлять ультразвуком, электромагнитным или иным физическим воздействием.External processing in the process of reducing the concentration can also be performed by ultrasound, electromagnetic or other physical effects.
Например, для приготовления 12-го сотенного разведения С12 одну часть упомянутого матричного раствора антител к простатоспецифическому антигену (ПСА) (или к NO-синтазе) с концентрацией 3,0 мг/мл разводят в 99 частях нейтрального водного или водно-спиртового растворителя и многократно (10 и более раз) вертикально встряхивают - потенцируют полученное 1-е сотенное С1 разведение. Из 1-го сотенного С1 разведения приготовляют 2-ое сотенное разведение С2. Данную операцию повторяют 11 раз, получая 12-е сотенное разведение С12. Таким образом, 12-е сотенное разведение С12 представляет собой раствор, полученный разбавлением последовательно в разных емкостях 12 раз 1-ой части исходного матричного раствора антител к простатоспецифическому антигену (ПСА) с концентрацией 3,0 мг/мл в 99-ти частях нейтрального растворителя, т.е. раствор, полученный разведением матричного раствора в 10012 раз. Аналогичные операции с соответствующей кратностью разведения проводят для получения разведений С 30 и С 200.For example, to prepare the 12th hundredth C12 dilution, one part of the mentioned matrix solution of antibodies to prostate-specific antigen (PSA) (or to NO synthase) with a concentration of 3.0 mg / ml is diluted in 99 parts of a neutral aqueous or aqueous-alcoholic solvent and repeatedly (10 or more times) vertically shake - potentiate the obtained 1st hundredth C1 dilution. From the 1st hundredth C1 dilution prepare the 2nd hundredth dilution C2. This operation is repeated 11 times, obtaining the 12th hundredth dilution of C12. Thus, the 12th hundredth dilution of C12 is a solution obtained by diluting successively in different containers 12 times of the first part of the initial matrix solution of antibodies to prostate-specific antigen (PSA) with a concentration of 3.0 mg / ml in 99 parts of a neutral solvent , i.e. the solution obtained by diluting the matrix solution in 100 to 12 times. Similar operations with the appropriate dilution ratio are carried out to obtain dilutions of C 30 and C 200.
При использовании в качестве биологически активного жидкого компонента смеси различных гомеопатических, преимущественно сотенных, разведений, каждый компонент состава (например, С 12, С 30, С 200) приготовляют раздельно по описанной выше технологии до их предпоследнего разведения (соответственно, до получения С 11, С 29, С 199) и затем вносят в соответствии с составом смеси в одну емкость по одной части каждого компонента и смешивают с требуемым количеством растворителя (соответственно, с 97 частями для сотенного разведения). При этом получают активированную потенцированную форму антител к простатоспецифическому антигену (ПСА) в сверхмалой дозе, приготовленной из матричного раствора, разведенного в 10012, в 10030 в 100200, что эквивалентно смеси сотенных гомеопатических разведений С 12, С 30 и С 200.When using as a biologically active liquid component mixtures of various homeopathic, mainly hundred, dilutions, each component of the composition (for example, C 12, C 30, C 200) is prepared separately according to the technology described above, before their last but one dilution (respectively, to obtain C 11, C 29, C 199) and then, in accordance with the composition of the mixture, make one part of each component in one container and mix with the required amount of solvent (respectively, with 97 parts for hundred-percent dilution). In this case, an activated potentiated form of antibodies to the prostate-specific antigen (PSA) is obtained in an ultra-low dose prepared from a matrix solution diluted in 100 12 , in 100 30 in 100 200 , which is equivalent to a mixture of hundred-percent homeopathic dilutions C 12, C 30 and C 200.
Возможно использование компонентов в виде смеси других различных гомеопатических, разведений, например, десятичных и или сотенных, (D 20, С 30, С 100 или С 12, С 30, С 50 и т.д.), эффективность которых определяют экспериментально.It is possible to use components in the form of a mixture of other various homeopathic dilutions, for example, decimal and or hundredths (D 20, C 30, C 100 or C 12, C 30, C 50, etc.), the effectiveness of which is determined experimentally.
При потенцировании вместо встряхивания в процессе уменьшения концентрации также можно осуществлять внешнее воздействие ультразвуком, электромагнитным или иным физическим воздействием.When potentiating instead of shaking in the process of decreasing the concentration, it is also possible to exert external influence by ultrasound, electromagnetic or other physical effect.
Для получения заявленной фармацевтической композиции водные или водно-спиртовые растворы действующих компонентов смешивают, преимущественно, в соотношении 1:1 и используют в жидкой лекарственной форме.To obtain the claimed pharmaceutical composition, aqueous or aqueous-alcoholic solutions of the active ingredients are mixed, mainly in a ratio of 1: 1 and used in liquid dosage form.
Заявленная фармацевтическая композиция может быть использована и в твердой лекарственной форме, которая содержит эффективное количество гранул нейтрального носителя (например, лактозы), насыщенного путем пропитывания до насыщения смесью водных или водно-спиртовых растворов активированной потенцированной формой антител к простатоспецифическому антигену (ПСА) и активированной - потенцированной формой антител к эндотелиальной NO-синтазе, и фармацевтически приемлемые добавки, включающие, преимущественно, лактозу, целлюлозу микрокристаллическую и магния стеарат.The claimed pharmaceutical composition can also be used in solid dosage form, which contains an effective amount of granules of a neutral carrier (for example, lactose), saturated by soaking until saturated with a mixture of aqueous or water-alcohol solutions with an activated potentiated form of antibodies to a prostate-specific antigen (PSA) and an activated - potentiated form of antibodies to endothelial NO synthase, and pharmaceutically acceptable additives, including, mainly, lactose, microcrista cellulose personal and magnesium stearate.
Для получения твердой оральной формы заявленного лекарственного средства производят в установке псевдоожиженного (кипящего) слоя (например, типа «Hüttlin Pilotlab» производства компании Hüttlin GmbH) орошение до насыщения вводимых в псевдоожиженный - кипящий слой гранул нейтрального вещества - лактозы (молочного сахара) с размером частиц 100÷300 мкм, предварительно полученным водным или водно-спиртовым раствором активированных - потенцированных форм антител к простатоспецифическому антигену и к эндотелиальной синтазе оксида азота (NO-синтазе), преимущественно, в соотношении 1 кг раствора антител на 5 или 10 кг лактозы (1:5 - 1:10) с одновременной сушкой в потоке подаваемого под решетку нагретого воздуха при температуре не выше 40°С. Расчетное количество 10÷34 масс частей высушенных гранул, насыщенных активированной - потенцированной формой антител, загружают в смеситель и смешивают с 25÷85 масс. частей от общей массы загрузки «ненасыщенной» чистой лактозы (для снижения стоимости и некоторого упрощения и ускорения технологического процесса без снижения эффективности лечебного воздействия). Затем в эту смесь добавляют стеарат магния в количестве 0,1÷1 масс. частей от общей массы загрузки и микрокристаллическую целлюлозу в количестве 3÷10 масс. частей от общей массы загрузки. Полученную таблеточную массу равномерно перемешивают и таблетируют прямым сухим прессованием (например, в таблет - прессе Korsch - XL 400) с формированием круглых таблеток массой 150÷500 мг, преимущественно массой 300 мг, пропитанных водно-спиртовым раствором (3,0-6,0 мг/табл.) активированной - потенцированной формой антител к простатоспецифическому антигену и к NO-синтазе в сверхмалой дозе каждого компонента, приготовленной из матричного раствора, разведенного в 10012, в 10030 в 100200, что эквивалентно смеси сотенных гомеопатических разведений С12, С30 и С200.To obtain a solid oral form of the claimed drug, a fluidized (fluidized) bed is installed (for example, a Hüttlin Pilotlab type manufactured by Hüttlin GmbH) irrigation until saturation of the granules of a neutral substance - lactose (milk sugar) with particle size introduced into the fluidized - boiling layer 100 ÷ 300 microns, previously obtained with an aqueous or aqueous-alcoholic solution of activated - potentiated forms of antibodies to prostate-specific antigen and to endothelial synthase of nitric oxide (NO synthase), predominantly Of course, in the ratio of 1 kg of antibody solution to 5 or 10 kg of lactose (1: 5 - 1:10) with simultaneous drying in a stream of heated air supplied under the grate at a temperature of no higher than 40 ° С. The estimated amount of 10 ÷ 34 mass parts of dried granules saturated with the activated - potentiated form of antibodies is loaded into the mixer and mixed with 25 ÷ 85 mass. parts of the total load mass of “unsaturated” pure lactose (to reduce the cost and some simplification and acceleration of the process without reducing the effectiveness of the therapeutic effect). Then, magnesium stearate is added to this mixture in an amount of 0.1 ÷ 1 mass. parts of the total mass of the load and microcrystalline cellulose in an amount of 3 ÷ 10 mass. parts of the total mass of the load. The resulting tablet mass is uniformly mixed and tabletted by direct dry pressing (for example, in a Korsch tablet press - XL 400) with the formation of round tablets weighing 150 ÷ 500 mg, mainly weighing 300 mg, soaked in an aqueous-alcohol solution (3.0-6.0 mg / table.) activated - potentiated form of antibodies to prostate-specific antigen and to NO synthase in an ultra-low dose of each component prepared from a matrix solution diluted in 100 12 , in 100 30 in 100 200 , which is equivalent to a mixture of hundred-percent homeopathic dilutions C12, C30 and C200.
В качестве нейтрального носителя возможно также использование глюкозы, сахарозы, мальтозы, крахмала, изомальтозы, изомальта и других моносахаридов, олигосахаридов и полисахаридов, использующихся в производстве фармацевтических препаратов, а также технологических смесей на основе последних с добавлением фармацевтически приемлемых добавок (например, изомальт, кросповидон, цикламат натрия, сахарин натрия, лимонная кислота безводная и т.д.), и в том числе лубрикантов, дезинтегрантов, связующих и красителей.Glucose, sucrose, maltose, starch, isomaltose, isomalt and other monosaccharides, oligosaccharides and polysaccharides used in the manufacture of pharmaceutical preparations, as well as technological mixtures based on the latter with the addition of pharmaceutically acceptable additives (for example, isomalt, crospovidone, can also be used as a neutral carrier. , sodium cyclamate, sodium saccharin, anhydrous citric acid, etc.), including lubricants, disintegrants, binders and dyes.
Заявленную фармацевтическую композицию, согласно изобретению, рекомендуется принимать по 1-4 таблетки 1-6 раз в день, например, по следующим схемам:The claimed pharmaceutical composition according to the invention, it is recommended to take 1-4 tablets 1-6 times a day, for example, according to the following schemes:
- 1 таблетка 1 раз/день;- 1 tablet 1 time / day;
- 1 таблетка 2 раза/день;- 1 tablet 2 times / day;
- 1 таблетка 3 раза/день;- 1 tablet 3 times / day;
- 1 таблетка 4 раза/день;- 1 tablet 4 times / day;
- 1 таблетка 5 раз/день;- 1 tablet 5 times / day;
- 1 таблетка 6 раз/день;- 1 tablet 6 times / day;
- 2 таблетки 1 раз/день;- 2 tablets 1 time / day;
- 2 таблетки 2 раза/день;- 2 tablets 2 times / day;
- 2 таблетки Зраза/день;- 2 tablets Zraza / day;
- 2 таблетки 4 раза/день;- 2 tablets 4 times / day;
- 2 таблетки 5 раз/день;- 2 tablets 5 times / day;
- 2 таблетки 6 раз/день;- 2 tablets 6 times / day;
- 3 таблетки 1 раз/день;- 3 tablets 1 time / day;
- 3 таблетки 2 раза/день;- 3 tablets 2 times / day;
- 3 таблетки 3 раза/день;- 3 tablets 3 times / day;
- 3 таблетки 4 раза/день;- 3 tablets 4 times / day;
- 4 таблетки 1 раз/день;- 4 tablets 1 time / day;
- 4 таблетки 2 раза/день;- 4 tablets 2 times / day;
- 4 таблетки 3 раза/день.- 4 tablets 3 times / day.
Для проведения экспериментальных исследований были использованы антитела, приготовленные по заказу специализированной фармацевтической фирмой.For experimental studies were used antibodies prepared by order of a specialized pharmaceutical company.
Пример 1.Example 1
В экспериментальном исследовании изучали эффективность водного раствора фармацевтической композиции на основе активированных - потенцированных форм поликлональных аффинно очищенных на антигене кроличьих антител к простатоспецифическому антигену (анти-PSA) и к эндотелиальной NO-синтазе (анти-eNOS) в сверхмалых дозах (СМД), полученных сверхразведением исходного матричного раствора (с концентрацией 2,5 мг/мл) в 10012, 10030, 100200 раз, эквивалентных смеси сотенных гомеопатических разведений С 12, С 30, С 200 (СМД анти-РSА + анти-eNOS) в модели доброкачественной гиперплазии предстательной железы (ДГПЖ) у крыс.In an experimental study, the effectiveness of an aqueous solution of a pharmaceutical composition based on activated - potentiated forms of polyclonal affinity-purified rabbit antibodies to prostate-specific antigen (anti-PSA) and to endothelial NO synthase (anti-eNOS) in ultra-low doses obtained by ultra-dilution was studied initial matrix solution (2.5 mg / ml) 100 12, 100 30, 100 to 200 times equivalent mixture of centesimal homeopathic dilutions C12, C 30, C 200 (SMD anti-RSA + anti-eNOS) in benign model oh prostatic hyperplasia (BPH) in rats.
ДГПЖ является одним из самых распространенных урологических заболеваний у мужчин. Риск развития этого заболевания увеличивается с возрастом: около 10% мужчин старше 40 лет страдают ДГПЖ; после 60 лет их число увеличивается до 30-40%. Доброкачественную гиперплазию предстательной железы можно определить как гиперплазию тканей простаты, сопровождающуюся нарушением мочеиспускания (в том числе повышением частоты мочеиспускания, ложными позывами, никтурией, ослаблением или прерывистостью струи и ощущением неполного опорожнения мочевого пузыря). Симптомы ДГПЖ серьезно снижают качество жизни пациентов. Это постоянно прогрессирующее заболевание, и при отсутствии адекватной терапии могут развиться такие серьезные осложнения, как острая задержка мочи, нарушения ее оттока, почечная недостаточность.BPH is one of the most common urological diseases in men. The risk of developing this disease increases with age: about 10% of men over 40 suffer from BPH; after 60 years, their number increases to 30-40%. Benign prostatic hyperplasia can be defined as prostatic tissue hyperplasia accompanied by impaired urination (including an increase in urination frequency, false urge, nocturia, weakening or intermittent jets, and a feeling of incomplete emptying of the bladder). Symptoms of BPH seriously reduce the quality of life of patients. This is a constantly progressing disease, and in the absence of adequate therapy, serious complications such as acute urinary retention, impaired outflow, and renal failure can develop.
Одной из моделей ДГПЖ у животных является гормон-индуцированное воспаление простаты, приводящее к ее увеличению. Для этого у животных вызывают гиперпролактинемию введением внутрибрюшинно сульпирида в дозе 40 мг/кг в течение 60 дней (Coppenolle V.F. et al. Effects of hyperprolactinemia on rat prostate growth: evidence of androgeno-dependence // Am. J. Physiol. Endokrinol. Metab. 2001. 280: E 120-E129.).One of the models of BPH in animals is hormone-induced inflammation of the prostate, leading to its increase. For this, hyperprolactinemia is caused in animals by the administration of sulpiride intraperitoneally at a dose of 40 mg / kg for 60 days (Coppenolle VF et al. Effects of hyperprolactinemia on rat prostate growth: evidence of androgeno-dependence // Am. J. Physiol. Endokrinol. Metab. 2001.280: E 120-E129.).
При исследовании эффективности СМД анти-PSA + анти-eNOS в данной модели доброкачественной гиперплазии предстательной железы (ДГПЖ) у крыс были использованы 30 крыс-самцов линии Вистар (возраст 8 мес, массой 600-650 г). 10 крыс были интактными. Остальным индуцировали гиперплазию простаты (сульпирид внутрибрюшинно в дозе 40 мг/кг в течение 60 дней) и одновременно с сульпиридом вводили внутрижелудочно дистиллированную воду (контрольная группа, п=10; 10 мл/кг) или СМД анти-PSA + анти-eNOS (п=10; 10 мл/кг).When studying the efficacy of SMD anti-PSA + anti-eNOS in this model of benign prostatic hyperplasia (BPH) in rats, 30 Wistar male rats (8 months old, weighing 600-650 g) were used. 10 rats were intact. The rest was induced prostate hyperplasia (sulpiride intraperitoneally at a dose of 40 mg / kg for 60 days) and simultaneously with sulpiride was administered intragastrically distilled water (control group, n = 10; 10 ml / kg) or SMD anti-PSA + anti-eNOS (n = 10; 10 ml / kg).
Через 60 дней определяли весовой коэффициент простаты (отношение массы простаты к массе животного), объем и плотность простаты, стромально-эпителиальное отношение в простате (показатель соотношения в органе соединительной и секретирующей ткани), а также концентрацию в крови рецептора пролактина (косвенный показатель гиперпролактинемии).After 60 days, we determined the weight coefficient of the prostate (the ratio of the mass of the prostate to the mass of the animal), the volume and density of the prostate, the stromal-epithelial ratio in the prostate (an indicator of the ratio in the organ of connective and secreting tissue), and the concentration of prolactin in the blood (an indirect indicator of hyperprolactinemia) .
В результате введения сульпирида у крыс развивалась гиперпролактинемия (уровень рецептора пролактина, регулирующего пролактин и гормон роста, повышался в контрольной группе на 83,3% относительно интактной), которая приводила к увеличению весового коэффициента простаты на 51,9% (р<0,05) и ее объема на 33,3% (р<0,05) по сравнению с контролем (Таблица 1). При этом происходила замена секретирующей ткани на соединительную (стромально-эпителиальное отношение снижалось на 29,6%, р<0,05), что свидетельствовало о развитии воспаления.As a result of the administration of sulpiride, rats developed hyperprolactinemia (the level of the prolactin receptor that regulates prolactin and growth hormone increased in the control group by 83.3% relative to the intact one), which led to an increase in the prostate weight coefficient by 51.9% (p <0.05 ) and its volume by 33.3% (p <0.05) compared with the control (Table 1). In this case, the secretory tissue was replaced by a connective tissue (stromal-epithelial ratio decreased by 29.6%, p <0.05), which indicated the development of inflammation.
Введение СМД анти-PSA + анти-eNOS крысам с гиперплазией простаты приводило к снижению уровня рецептора пролактина (на 40,6%, р<0,05 по сравнению с контролем), уменьшению весового коэффициента и объема простаты (на 22,0% и 41,7%), соответственно, р<0,05), а также исчезновению воспаления (стромально-эпителиальное соотношение не отличалось от интактных крыс).The administration of SMD anti-PSA + anti-eNOS to rats with prostatic hyperplasia led to a decrease in the level of prolactin receptor (by 40.6%, p <0.05 compared with the control), a decrease in the weight coefficient and volume of the prostate (by 22.0% and 41.7%), respectively, p <0.05), as well as the disappearance of inflammation (stromal-epithelial ratio did not differ from intact rats).
отличие от контроля достоверно: # - р<0,05Note: the difference from the intact group is significantly * - p <0.05;
significant difference from control: # - p <0.05
Таким образом, заявленный лекарственный препарат СМД анти-PSA + анти-eNOS обладает эффективностью в условиях экспериментальной модели ДГПЖ (гормон-индуцированного воспаления).Thus, the claimed drug SMD anti-PSA + anti-eNOS is effective in the experimental model of BPH (hormone-induced inflammation).
Пример 2.Example 2
Для исследования свойств заявленного лекарственного средства для лечения пациентов с доброкачественной гиперплазией предстательной железы были использованы таблетки массой 300 мг, пропитанные фармацевтической композицией, содержащей водно-спиртовые растворы (6 мг/табл.) активированных - потенцированных форм поликлональных кроличьих аффинно очищенных антител к простатоспецифическому антигену (анти-PSA) и эндотелиальной NO синтазе (анти-eNOS) в сверхмалых дозах (СМД), полученных сверхразведением исходного матричного раствора в 10012, 10030, 100200 раз, эквивалентных смеси сотенных гомеопатических разведений С12, С 30, С 200 (СМД анти-PSA + анти-eNOS), и таблетки массой 300 мг, пропитанные фармацевтической композицией, содержащей водно-спиртовые растворы (3 мг/табл.) активированных - потенцированных форм поликлональных кроличьих аффинно очищенных антител к простатоспецифическому антигену в сверхмалых дозах (СМД), полученных сверхразведением исходного матричного раствора в 10012, 10030, 100200 раз, эквивалентных смеси сотенных гомеопатических разведений С 12, С 30, С 200 (СМД анти-PSA).To study the properties of the claimed drug for the treatment of patients with benign prostatic hyperplasia, 300 mg tablets were used, impregnated with a pharmaceutical composition containing water-alcohol solutions (6 mg / tablet) of activated - potentiated forms of polyclonal rabbit affinity-purified antibodies to prostate-specific antigen ( anti-PSA) and endothelial NO synthase (anti-eNOS) in ultra-low doses (SMD) obtained by super-dilution of the initial matrix solution in 100 12 , 100 30 , 100 20 0 times, equivalent to a mixture of hundreds of homeopathic dilutions C 12 , C 30, C 200 (SMD anti-PSA + anti-eNOS), and tablets weighing 300 mg, impregnated with a pharmaceutical composition containing aqueous-alcoholic solutions (3 mg / table.) Activated - potentiated forms of polyclonal rabbit affinity-purified antibodies to prostate-specific antigen in ultra-low doses (SMD) obtained by super-dilution of the initial matrix solution in 100 12 , 100 30 , 100 200 times, equivalent to a mixture of hundred-percent homeopathic dilutions C 12, C 30, C 200 (SMD anti -PSA).
Доброкачественная гиперплазия предстательной железы (ДГПЖ) является одним из наиболее распространенных заболеваний у мужчин (Bruskewitz R.C., 2003; Rosen R., 2003): с одной стороны, эпидемиологические исследования, проведенные в России, указывают на постепенное возрастание частоты ДГПЖ с 11,3% в возрасте 40-49 лет до 81,4% в возрасте 80 лет (Гориловский Л.М., 1999); с другой стороны, демографические исследования ВОЗ свидетельствуют о значительном росте населения планеты в возрасте старше 60 лет, темпы которого существенно опережают рост населения в целом.Benign prostatic hyperplasia (BPH) is one of the most common diseases in men (Bruskewitz RC, 2003; Rosen R., 2003): on the one hand, epidemiological studies conducted in Russia indicate a gradual increase in the frequency of BPH from 11.3% at the age of 40-49 years to 81.4% at the age of 80 years (Gorilovsky L.M., 1999); on the other hand, WHO demographic studies indicate a significant increase in the world's population over the age of 60, the pace of which is significantly faster than the population as a whole.
Основными симптомами ДГПЖ являются симптомы нижних мочевых путей, которые могут значительно беспокоить больных и снижать качество их жизни (Bruskewitz R.C., 2003; Lepor Н., 2004; O'Leary М.Р., 2005). В тяжелых случаях заболевание может сопровождаться развитием осложнений, таких как острая задержка мочи, инфекции мочевыводящих путей, гематурия, почечная недостаточность (Степанов В.Н., 1999; Jacobsen S.J., 1997; Lepor Н., 2004). ДГПЖ также ассоциирована с развитием эректильной дисфункции у пациентов (Bruskewitz R.C., 2003; Daly MP, 2005).The main symptoms of BPH are the symptoms of the lower urinary tract, which can significantly disturb patients and reduce their quality of life (Bruskewitz R.C., 2003; Lepor N., 2004; O'Leary M.R., 2005). In severe cases, the disease can be accompanied by the development of complications, such as acute urinary retention, urinary tract infections, hematuria, renal failure (Stepanov V.N., 1999; Jacobsen S.J., 1997; Lepor N., 2004). BPH is also associated with the development of erectile dysfunction in patients (Bruskewitz R.C., 2003; Daly MP, 2005).
В открытое сравнительное параллельно-групповое исследование по изучению эффективности и безопасности препаратов СМД анти-PSA + анти-eNOS и СМД анти-PSA в лечении нарушений мочеиспускания, вызванных доброкачественной гиперплазией простаты (ДГПЖ), было включено 40 пациентов, соответствующих критериям включения/исключения. Пациенты были рандомизированы в 2 группы, одна из которых получала препарат СМД анти-PSA + анти-eNOS по 1 таблетке 3 раза в день в течение 12 недель (n=21), а другая препарат СМД анти-PSA по 1 таблетке 3 раза в день в течение 12 недель (n=19). Группы были сопоставимы по возрасту, выраженности клинической симптоматики ДГПЖ, параметрам мочеиспускания и объему простаты.In an open, comparative, parallel-group study to study the efficacy and safety of SMD anti-PSA + anti-eNOS and SMD anti-PSA in the treatment of urinary disorders caused by benign prostatic hyperplasia (BPH), 40 patients who met inclusion / exclusion criteria were included. Patients were randomized into 2 groups, one of which received anti-PSA + anti-eNOS DMD 1 tablet 3 times a day for 12 weeks (n = 21), and the other anti-PSA DMD 1 tablet 3 times per day for 12 weeks (n = 19). The groups were comparable in age, the severity of the clinical symptoms of BPH, urination parameters and prostate volume.
В исследование включали пациентов старше 45 лет с анамнезом ДГПЖ с соответствующими симптомами нижних мочевых путей не менее 6 месяцев, IPSS>13, объемом простаты по данным ТРУЗИ≥30 см3, с максимальной скоростью мочеиспускания ≥4 мл/с и ≤15 мл/с при минимальном объеме выделенной мочи 125 мл, с уровнем PSA≤4 нг/мл. Необходимым критерием включения также было отсутствие в анамнезе приема следующих препаратов: финастерида, дутастерида или любых экспериментальных препаратов за 6 месяцев до включения в исследование, α1-адреноблокаторов и растительных препаратов за 4 недели до включения в исследование, любых ингибиторов фосфодиэстеразы 5 типа и других средства для лечения эректильной дисфункции за 4 недели до включения в исследование.The study included patients older than 45 years with a history of BPH with the corresponding symptoms of the lower urinary tract for at least 6 months, IPSS> 13, prostate volume according to TRUS ≥30 cm3, with a maximum urination rate of ≥4 ml / s and ≤15 ml / s at the minimum volume of excreted urine is 125 ml, with a PSA level of ≤4 ng / ml. A necessary inclusion criterion was also the lack of a history of taking the following drugs: finasteride, dutasteride or any experimental drugs 6 months before inclusion in the study, α1-blockers and herbal preparations 4 weeks before inclusion in the study, any type 5 phosphodiesterase inhibitors and other drugs treatment of erectile dysfunction 4 weeks before inclusion in the study.
В исследование не включали пациентов с инвазивными вариантами лечения ДГПЖ, включая трансуретральную резекцию простаты, термотерапию, микроволновую терапию, трансуретральную игольную абляцию и стентирование и др.; злокачественными онкологическими процессами, острой задержкой мочеиспускания, камнями мочевого пузыря, стриктурой уретры, склерозом шейки мочевого пузыря, инфекциями мочеполовой системы в фазе активного воспаления и др.The study did not include patients with invasive treatment options for BPH, including transurethral resection of the prostate, thermotherapy, microwave therapy, transurethral needle ablation and stenting, etc .; malignant oncological processes, acute urinary retention, bladder stones, urethral stricture, sclerosis of the bladder neck, infections of the genitourinary system in the phase of active inflammation, etc.
Клиническую эффективность приема препаратов оценивали по улучшению клинической симптоматики нижних мочевых путей, оцениваемой с помощью опросника IPSS (International Prostate Symptom Score), параметров мочеиспускания (максимальная и средняя скорость мочи, объем мочеиспускания, объем остаточной мочи) и объему простаты по данным трансуретрального ультразвукового исследования (ТРУЗИ), а также оценивали эректильную функцию по данным опросника МИЭФ (Международный индекс эректильной функции). Результаты исследования приведены в таблицах 2 и 3.The clinical efficacy of taking the drugs was evaluated by improving the clinical symptoms of the lower urinary tract, assessed using the IPSS questionnaire (International Prostate Symptom Score), urination parameters (maximum and average urine speed, urination volume, residual urine volume) and prostate volume according to transurethral ultrasound ( TRUS), and also evaluated erectile function according to the ICEF Questionnaire (International Index of Erectile Function). The results of the study are shown in tables 2 and 3.
2 - указан % снижения от исходного, среднее значения по группе * - p <0.05 from the original; ** - p <0.01 from the original; ± - p <0.001 from the original ## - p <0.05 from the afalase group
2 -% reduction from the initial value is indicated, the average value for the group
Как видно из приведенных данных, как препарат СМД анти-PSA, так и препарат СМД анти-PSA + анти-eNOS эффективно устраняли клиническую симптоматику нижних мочевых путей, увеличивали среднюю и максимальную скорость мочи, повышали качество жизни пациентов (Таблица 2). Срок применения препаратов был непродолжительным (12 недель), поэтому добиться значимого уменьшения объема простаты не удалось ни в одной из исследуемых групп. Препарат СМД анти-PSA практически не влиял на объем мочеиспускания, данный показатель улучшился только у 52,6% пациентов, а в среднем по группе было даже выявлено некоторое недостоверное уменьшение объема мочеиспускания (на 11,8 мл (5,4%) по сравнению с исходными данными. В тоже время, в группе пациентов, принимавших СМД анти-PSA + анти-eNOS, увеличение объема мочеиспускания было достигнуто у 71,4% пациентов, а в среднем по группе прирост объема составил 48,3 мл (23,7%) по сравнению с исходными данными.As can be seen from the above data, both the SMD anti-PSA drug and the anti-PSA + anti-eNOS SMD effectively eliminated the clinical symptoms of the lower urinary tract, increased the average and maximum urine speed, and improved the quality of life of patients (Table 2). The period of use of the drugs was short (12 weeks), therefore, it was not possible to achieve a significant reduction in prostate volume in any of the studied groups. The SMD anti-PSA drug had practically no effect on the volume of urination, this indicator improved only in 52.6% of patients, and on the average, the group even revealed some unreliable decrease in the volume of urination (by 11.8 ml (5.4%) compared to At the same time, in the group of patients taking SMD anti-PSA + anti-eNOS, an increase in urination was achieved in 71.4% of patients, and the average increase in the group was 48.3 ml (23.7 %) compared with the source data.
Анализ динамики обструктивной и ирритативной симптоматики по подшкалам IPSS, а также выраженности никтурии (7 вопрос IPSS) показал, что оба препарата способствовали снижению симптомов обструкции и раздражения, а также уменьшали выраженность никтурии. Вместе с тем СМД анти-PSA + анти-eNOS более эффективно по сравнению с СМД анти-PSA устранял ирритативную симптоматику нижних мочевых путей (28,2% vs 40,3%, р<0,05) и ночные позывы к мочеиспусканию (2,0% vs 37,7%,).Analysis of the dynamics of obstructive and irritative symptoms according to the IPSS subscales, as well as the severity of nocturia (question 7 IPSS) showed that both drugs helped to reduce symptoms of obstruction and irritation, as well as reduced the severity of nocturia. At the same time, SMD anti-PSA + anti-eNOS more effective than SMD anti-PSA eliminated irritative symptoms of the lower urinary tract (28.2% vs 40.3%, p <0.05) and nightly urination (2 , 0% vs 37.7%,).
Следует отметить, что СМД анти-PSA + анти-eNOS также более эффективно по сравнению с СМД анти-PSA улучшала эректильную функцию пациентов. В группе СМД анти-PSA + анти-eNOS суммарный балл МИЭФ увеличился у 19% пациентов (в группе СМД анти-PSA - у 10,5%), а среднее увеличение суммарного балла МИЭФ в группе СМД анти-PSA + анти-eNOS составило 8% vs 4,5% в группе СМД анти-PSA.It should be noted that SMD anti-PSA + anti-eNOS is also more effective compared to SMD anti-PSA improved erectile function of patients. In the SMD anti-PSA + anti-eNOS group, the total IIEF score increased in 19% of patients (in the anti-PSA SMD group - in 10.5%), and the average increase in the IIEF anti-PSA + anti-eNOS total SMD score was 8% vs 4.5% in the SMD group of anti-PSA.
Препараты показали высокий профиль безопасности, в течение всего срока исследования не было зарегистрировано ни одного нежелательного явления, связанного с приемом препарата.The drugs showed a high safety profile; during the entire study period, not a single adverse event was observed associated with taking the drug.
Таким образом, препарат СМД анти-PSA + анти-eNOS показал свою большую эффективность по сравнению с СМД анти-PSA в лечении нарушений мочеиспускания, вызванных доброкачественной гиперплазией простаты. Кроме того, было выявлено более выраженное положительное влияние СМД анти-PSA + анти-eNOS на эректильную функцию пациентов по сравнению с СМД анти-PSA.Thus, the drug SMD anti-PSA + anti-eNOS has shown its greater effectiveness compared with SMD anti-PSA in the treatment of urination disorders caused by benign prostatic hyperplasia. In addition, a more pronounced positive effect of SMD anti-PSA + anti-eNOS on erectile function of patients was revealed compared with SMD anti-PSA.
Пример 3.Example 3
В экспериментальном исследовании изучали эффективность водного раствора фармацевтической композиции на основе активированных - потенцированных форм поликлональных аффинно очищенных на антигене кроличьих антител к простатоспецифическому антигену (анти-PSA) и к эндотелиальной NO-синтазе (анти-eNOS) в сверхмалых дозах (СМД), полученных сверхразведением исходного матричного раствора (с концентрацией 2,5 мг/мл) в 10012, 10030, 100200 раз, эквивалентных смеси сотенных гомеопатических разведений С 12, С 30, С 200 (СМД анти-PSA + анти-eNOS) в модели абактериального простатита у животных (крыс), включающей прошивание простаты шелковой нитью.In an experimental study, the effectiveness of an aqueous solution of a pharmaceutical composition based on activated - potentiated forms of polyclonal affinity-purified rabbit antibodies to prostate-specific antigen (anti-PSA) and to endothelial NO synthase (anti-eNOS) in ultra-low doses obtained by ultra-dilution was studied initial matrix solution (with a concentration of 2.5 mg / ml) 100 12 , 100 30 , 100 200 times, equivalent to a mixture of hundred-percent homeopathic dilutions C 12, C 30, C 200 (SMD anti-PSA + anti-eNOS) in the model of abacterial prostatitis in animals (rats), including flashing of the prostate with silk thread.
Воспалительные заболевания предстательной железы занимают существенное место среди урологических патологий. К числу наиболее часто встречающихся из них принадлежат простатиты. Причем абактериальная форма простатита распространена в 8 раз чаще, чем бактериальная. Заболеваемость хроническим простатитом, не связанным с уретральной инфекцией и другими урологическими патологиями, среди мужчин 40-50 лет составляет 30-40%. Это заболевание трудно поддается лечению и при снятии субъективных расстройств и уменьшении выраженности лабораторных признаков воспаления, морфологические изменения в железистой ткани и строме органа сохраняются.Inflammatory diseases of the prostate gland occupy a significant place among urological pathologies. Among the most common of them are prostatitis. Moreover, the abacterial form of prostatitis is distributed 8 times more often than bacterial. The incidence of chronic prostatitis, not associated with urethral infection and other urological pathologies, among men 40-50 years old is 30-40%. This disease is difficult to treat and when removing subjective disorders and reducing the severity of laboratory signs of inflammation, morphological changes in the glandular tissue and organ stroma persist.
Одной из моделей абактериального простатита у животных является прошивание простаты шелковой нитью.One of the models of abacterial prostatitis in animals is flashing of the prostate with silk thread.
В настоящем эксперименте использовали 60 крыс-самцов линии Вистар (возраст 2 мес, массой 250 г), из которых 12 крыс были интактными, а остальным индуцировали простатит путем прошивания простаты шелковой нитью под наркозом (тиопентал в дозе 60 мг/кг внутрибрюшинно). В течение 1,5 месяцев, начиная через 1 месяц после операции, крысам разных групп начинали внутрижелудочно вводить дистиллированную воду (контроль, 10 мл/кг, n=12), СМД анти-PSA + анти-eNOS (в дозах 5 мл/кг (n=12), 7,5 мл/кг (n=12) и 10 мл/кг (n=12)). Через 2,5 месяца после операции у всех крыс определяли массу простаты, вычисляли ее весовой коэффициент, определяли объем прошитой доли железы и ее плотность, при этом у 6 животных из каждой группы в гистологическом исследовании измеряли площадь коллагеновых волокон в соединительной ткани (Sк, показатель склеротических процессов в железе), площадь эпителиальных структур ацинусов (Sэa, показатель атрофических процессов в железе), площадь просвета ацинусов (Sпa, показатель секреторной активности железы).In this experiment, 60 Wistar male rats (2 months old, weighing 250 g) were used, of which 12 rats were intact, and the rest were induced with prostatitis by flashing the prostate with silk thread under anesthesia (thiopental at a dose of 60 mg / kg ip). Within 1.5 months, starting 1 month after the operation, rats of different groups were started intragastrically injected with distilled water (control, 10 ml / kg, n = 12), SMD anti-PSA + anti-eNOS (in doses of 5 ml / kg (n = 12), 7.5 ml / kg (n = 12) and 10 ml / kg (n = 12)). 2.5 months after the operation, the prostate mass was determined in all rats, its weight coefficient was calculated, the volume of the stitched portion of the gland and its density were determined, and in 6 animals from each group, the area of collagen fibers in the connective tissue was measured in a histological study (Sk, indicator sclerotic processes in the gland), the area of the epithelial structures of the acini (Sеa, an indicator of atrophic processes in the gland), the lumen area of the acini (Spa, an indicator of the secretory activity of the gland).
После прошивания шелковой нитью у крыс развивалось воспаление простаты, что приводило к достоверному повышению весового коэффициента простаты на 25%, плотности простаты на 14% и склеротическим изменениям ткани простаты (Sк увеличивалась в 3,1 раза) по сравнению с интактными животными (Таблица.4). Введение СМД анти-PSA + анти-eNOS ни в одной из использованных доз не приводило к достоверному снижению весового коэффициента и плотности простаты, однако значительно (практически до уровня интактных животных) снижало площадь коллагеновых волокон, что свидетельствует о снижении воспалительного процесса в железе (Таблица 4). Кроме того, СМД анти-PSA + анти-eNOS в дозе 10 мл/кг значительно (на 19,5%, р=0,055) увеличивал площадь просвета ацинусов, что свидетельствует о повышении секреторной активности простаты (Таблица 4).After floss stitching, the rats developed inflammation of the prostate, which led to a significant increase in the prostate weight coefficient by 25%, prostate density by 14% and sclerotic changes in prostate tissue (Sk increased 3.1 times) compared with intact animals (Table 4 ) The introduction of SMD anti-PSA + anti-eNOS in any of the doses did not lead to a significant decrease in the weight coefficient and density of the prostate, however, it significantly (almost to the level of intact animals) reduced the area of collagen fibers, which indicates a decrease in the inflammatory process in the gland (Table four). In addition, SMD anti-PSA + anti-eNOS at a dose of 10 ml / kg significantly (by 19.5%, p = 0.055) increased the lumen area of the acini, which indicates an increase in the secretory activity of the prostate (table 4).
отличие от контроля достоверно: # = р<0,055, ### - р<0,001Note: the difference from the intact group is significantly * - p <0.05
the difference from the control is significant: # = p <0.055, ### - p <0.001
Таким образом, СМД анти-PSA + анти-eNOS обладает противовоспалительными свойствами в модели абактериального простатита у крыс.Thus, SMD anti-PSA + anti-eNOS has anti-inflammatory properties in the rat abacterial prostatitis model.
Claims (31)
193-208: TKFMLCAG RWTGGKST;
211-241:GDSGGPLVCN GVLQGITSWG SEPCALPERP S;
189-200: PQ KVTKFMLCAG;
67-190:IRNK SVILLGRHSL FHPEDTGQVF QVSHSFPHPL YDMSLLKNRF LRPGDDSSHD LMLLRLSEPA ELTDAVKVMD LPTQEPALGT TCYASGWGSI EPEEFLTPKK LQCVDLHVIS NDVCAQVHPQ;
77-99: PvHSL FHPEDTGQVF QVSHSFPHP;
101-125: YDMSLLKNRF LRPGD;
122-135: MLLRLSEPA ELTDA;
5-25: VVFLTL SVTWI;
107-200: KNRF LRPGDDSSHD LMLLRLSEPA ELTDAVKVMD LPTQEPALGT TCYASGWGSI EPEEFLTPKK LQCVDLHVIS NDVCAQVHPQ KVTKFMLCAG;
25-261: IVGGW ECEKHSQPWQ VLVASRGRAVC GGVLVHPQWV LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLK
NPvFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCY ASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCA GRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTK VVHYRKWIKDTIVANP2. The drug according to claim 1, characterized in that antibodies are used against one polypeptide fragment of a prostate-specific antigen selected from the following amino acid sequences:
193-208: TKFMLCAG RWTGGKST;
211-241: GDSGGPLVCN GVLQGITSWG SEPCALPERP S;
189-200: PQ KVTKFMLCAG;
67-190: IRNK SVILLGRHSL FHPEDTGQVF QVSHSFPHPL YDMSLLKNRF LRPGDDSSHD LMLLRLSEPA ELTDAVKVMD LPTQEPALGT TCYASGWGSI EPEEFLTPKK LQCVDLHVIS NDVCAQVHP;
77-99: PvHSL FHPEDTGQVF QVSHSFPHP;
101-125: YDMSLLKNRF LRPGD;
122-135: MLLRLSEPA ELTDA;
5-25: VVFLTL SVTWI;
107-200: KNRF LRPGDDSSHD LMLLRLSEPA ELTDAVKVMD LPTQEPALGT TCYASGWGSI EPEEFLTPKK LQCVDLHVIS NDVCAQVHPQ KVTKFMLCAG;
25-261: IVGGW ECEKHSQPWQ VLVASRGRAVC GGVLVHPQWV LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLK
NPvFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCY ASGWGSIEPEEFLTPKKQQVDLHVISNDVCAQVHPQKVTKFMLCA GRWTGGKSTCSGDSGGPLVCNGVLQTKLVKQTKLVKWTKVAL
простатоспецифическому антигену в сочетании со смесью различных гомеопатических разведений антител к эндотелиальной NO-синтазе.10. The treatment method according to p. 8 or 9, characterized in that the pharmaceutical composition is used in the form of a single drug - one dosage form containing a mixture of different homeopathic dilutions of antibodies to
prostate-specific antigen in combination with a mixture of various homeopathic dilutions of antibodies to endothelial NO synthase.
Priority Applications (51)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
RU2011127053/15A RU2565400C2 (en) | 2011-07-01 | 2011-07-01 | Medication for treating genitourinary system diseases and method of treating genitourinary system diseases |
AU2011278042A AU2011278042B2 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
PCT/IB2011/002350 WO2012007845A2 (en) | 2010-07-15 | 2011-07-15 | A method of increasing the effect of an activated-potentiated form of an antibody |
DE112011102358T DE112011102358T5 (en) | 2010-07-15 | 2011-07-15 | A method of increasing the effect of an activated-potentiated form of an antibody |
IT000631A ITTO20110631A1 (en) | 2010-07-15 | 2011-07-15 | PHARMACEUTICAL COMPOSITION OF COMBINATION AND METHODS TO TREAT GENITOURINARY SYSTEM DISEASES |
PCT/IB2011/002417 WO2012007849A2 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
CA2805094A CA2805094A1 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
FR1156482A FR2962656A1 (en) | 2010-07-15 | 2011-07-15 | METHOD FOR INCREASING THE EFFECT OF AN ACTIVATED-POTENTIALIZED FORM OF ANTIBODY |
GB1302651.3A GB2495885B (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
NZ606775A NZ606775A (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
NZ606767A NZ606767A (en) | 2010-07-15 | 2011-07-15 | A method of increasing the effect of an activated-potentiated form of an antibody |
JP2013519175A JP2013538186A (en) | 2010-07-15 | 2011-07-15 | Method for increasing the effect of activation-enhancing antibodies |
MX2013000543A MX2013000543A (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract. |
EA201300129A EA029860B1 (en) | 2010-07-15 | 2011-07-15 | Pharmaceutical composition and methods of treating genitourinary system disorders |
FR1156476A FR2962655A1 (en) | 2010-07-15 | 2011-07-15 | PHARMACEUTICAL ASSOCIATION COMPOSITION AND USES THEREOF IN METHODS OF TREATMENT OF GENITAL URINARY SYSTEM DISORDERS |
ES201390006A ES2440393R1 (en) | 2010-07-15 | 2011-07-15 | A METHOD FOR INCREASING THE EFFECT OF A POTENTIATED ACTIVATED FORM OF AN ANTIBODY |
EP11784771.5A EP2593483A2 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
SG10201505561TA SG10201505561TA (en) | 2010-07-15 | 2011-07-15 | A Method Of Increasing The Effect Of An Activated-Potentiated Form Of An Antibody |
PE2013000076A PE20130398A1 (en) | 2010-07-15 | 2011-07-15 | A METHOD TO INCREASE THE EFFECT OF AN ACTIVE ENHANCED FORM OF AN ANTIBODY |
EEP201300006A EE201300006A (en) | 2010-07-15 | 2011-07-15 | A pharmaceutical composition for enhancing the effect of an activated and potentiated form of an antibody |
KR1020137003861A KR20140014059A (en) | 2010-07-15 | 2011-07-15 | A method of increasing the effect of an activated-potentiated form of an antibody |
SG2013002308A SG187036A1 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
US13/135,898 US20130064860A1 (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of theating genitourinary system disorders |
CN201180044500XA CN103282384A (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
DE112011102350T DE112011102350T5 (en) | 2010-07-15 | 2011-07-15 | A combination pharmaceutical composition and method for treating disorders of the genitourinary system |
CA2804966A CA2804966A1 (en) | 2010-07-15 | 2011-07-15 | A method of increasing the effect of an activated-potentiated form of an antibody |
US13/135,901 US9308275B2 (en) | 2010-07-15 | 2011-07-15 | Method of increasing the effect of an activated-potentiated form of an antibody |
EP11775838.3A EP2593140A2 (en) | 2010-07-15 | 2011-07-15 | A method of increasing the effect of an activated-potentiated form of an antibody |
ES201390004A ES2425314R1 (en) | 2010-07-15 | 2011-07-15 | Combined pharmaceutical composition and use to prepare medicines for the treatment of disorders of the genitourinary system |
CZ20130105A CZ2013105A3 (en) | 2010-07-15 | 2011-07-15 | Method of increasing effect of antibody activated potentiated form |
SG2013002324A SG187038A1 (en) | 2010-07-15 | 2011-07-15 | A method of increasing the effect of an activated-potentiated form of an antibody |
SG10201505564VA SG10201505564VA (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
MYPI2013000108A MY165267A (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
MX2013000547A MX354187B (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and methods of treating genitourinary system disorders. |
JP2013519179A JP2013538791A (en) | 2010-07-15 | 2011-07-15 | Combination pharmaceutical composition and method for treating genitourinary disorders |
EA201300126A EA030566B1 (en) | 2010-07-15 | 2011-07-15 | Method of increasing therapeutic effectiveness of an activated-potentiated form of an antibody to an endogenous biological molecule and pharmaceutical composition |
IT000639A ITTO20110639A1 (en) | 2010-07-15 | 2011-07-15 | METHOD TO INCREASE THE EFFECT OF AN ACTIVE-ENHANCED SHAPE OF AN ANTI-BODY |
BR112013000840A BR112013000840A2 (en) | 2010-07-15 | 2011-07-15 | method for enhancing the effect of potentiated activated form of antibody to biological endogenous molecule, pharmaceutical composition and use of combination of endogenous biological molecule with potentiated activated form of antibody to endothelial synthase. |
AU2011278038A AU2011278038B2 (en) | 2010-07-15 | 2011-07-15 | A method of increasing the effect of an activated-potentiated form of an antibody |
GB1302649.7A GB2495884B (en) | 2010-07-15 | 2011-07-15 | A method of increasing the effect of an activated-potentiated form of an antibody |
ARP110102578A AR082247A1 (en) | 2010-07-15 | 2011-07-18 | A METHOD FOR INCREASING THE EFFECTS OF A POTENTIATED ACTIVATED FORM OF AN ANTIBODY |
CL2013000099A CL2013000099A1 (en) | 2010-07-15 | 2013-01-10 | A method of increasing the effect of an potentiated active form of an antibody to an endogenous biological molecule, comprising the combination of the endogenous biological molecule with an enhanced active form of an endoltelial non-synthase antibody; composition that understands it. |
NO20130222A NO20130222A1 (en) | 2010-07-15 | 2013-02-08 | Process for increasing the effect of an activated-potentiated form of an antibody |
LT2013016A LT5988B (en) | 2010-07-15 | 2013-02-14 | A method of increasing the effect of an activated-potentiated form of an antibody |
DKPA201370079A DK201370079A (en) | 2010-07-15 | 2013-02-14 | A method of increasing the effect of an activated-potentiated form of an antibody |
FI20135143A FI20135143L (en) | 2010-07-15 | 2013-02-15 | A method of increasing the potency of an activated potentiated form of an antibody |
US15/060,157 US20160244531A1 (en) | 2010-07-15 | 2016-03-03 | Method of increasing the effect of an activated-potentiated form of an antibody |
US15/060,202 US20160251448A1 (en) | 2010-07-15 | 2016-03-03 | Method of increasing the effect of an activated-potentiated form of an antibody |
JP2016131664A JP2016199570A (en) | 2010-07-15 | 2016-07-01 | Combination pharmaceutical composition and methods of treating genitourinary system disorders |
JP2016135750A JP2016216483A (en) | 2010-07-15 | 2016-07-08 | Method of increasing effect of activated-potentiated antibody |
JP2018085388A JP2018150322A (en) | 2010-07-15 | 2018-04-26 | Combined pharmaceutical composition, and method for treating urogenital system disorder |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
RU2011127053/15A RU2565400C2 (en) | 2011-07-01 | 2011-07-01 | Medication for treating genitourinary system diseases and method of treating genitourinary system diseases |
Publications (2)
Publication Number | Publication Date |
---|---|
RU2011127053A RU2011127053A (en) | 2013-01-10 |
RU2565400C2 true RU2565400C2 (en) | 2015-10-20 |
Family
ID=48795256
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
RU2011127053/15A RU2565400C2 (en) | 2010-07-15 | 2011-07-01 | Medication for treating genitourinary system diseases and method of treating genitourinary system diseases |
Country Status (1)
Country | Link |
---|---|
RU (1) | RU2565400C2 (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1997005901A1 (en) * | 1995-08-03 | 1997-02-20 | Sinha Akhouri A | Targeting of organs by immunoconjugates |
RU2192889C1 (en) * | 2001-03-16 | 2002-11-20 | Эпштейн Олег Ильич | Medicinal preparation and method for treating prostatic diseases |
-
2011
- 2011-07-01 RU RU2011127053/15A patent/RU2565400C2/en active IP Right Revival
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1997005901A1 (en) * | 1995-08-03 | 1997-02-20 | Sinha Akhouri A | Targeting of organs by immunoconjugates |
RU2192889C1 (en) * | 2001-03-16 | 2002-11-20 | Эпштейн Олег Ильич | Medicinal preparation and method for treating prostatic diseases |
Non-Patent Citations (1)
Title |
---|
АЗИЗОВ А.П. "Простакс" при доброкачственной гиперплазии простаты и хроническом простатите". Золотое здоровье. Тезисы конференции 2005, найдено 22.11.2011, найдено из Интернет: au-health.rulistview.php. ЦЫБДЕНОВ Г.Д. и др. "Клиническая эффективность препаратов афала и импаза в лечении гиперплазии предстательной железы в сочетании с эректильной дисфункцией". Третий съезд хирургов Сибири и Дальнего Востока. 15-16 октября 2009, стр.278-279 * |
Also Published As
Publication number | Publication date |
---|---|
RU2011127053A (en) | 2013-01-10 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2011278042B2 (en) | Combination pharmaceutical composition and methods of treating genitourinary system disorders | |
EP1997481B1 (en) | Solid oral form of a medicinal preparation and a method for the production thereof | |
US8637030B2 (en) | Combination pharmaceutical composition and methods of treating functional diseases or conditions of gastrointestinal tract | |
AU2011281247B2 (en) | Combination pharmaceutical composition and methods of treating diseases or conditions associated with respiratory disease or condition | |
US7700096B2 (en) | Medicinal agent for treating erectile dysfunction | |
RU2565400C2 (en) | Medication for treating genitourinary system diseases and method of treating genitourinary system diseases | |
RU2191601C1 (en) | Medicinal preparation and method for treating erectile dysfunctions | |
RU2651005C2 (en) | Method of increasing the pharmacological activity of the activated-potentiated form of antibodies to the prostate-specific antigen and the pharmaceutical composition | |
RU2531049C2 (en) | Therapeutic agent for treating prostatic diseases and method of treating prostatic diseases | |
RU2500427C2 (en) | Therapeutic agent for treating functional gastrointestinal disturbance and method of treating functional gastrointestinal disturbance | |
RU2542414C2 (en) | Medication for treating erectile dysfunctions and method of treating erectile dysfunctions | |
RU2502521C2 (en) | Combined drug for treating bacterial infections and method of treating bacterial infections | |
RU2529783C2 (en) | Medication for treating pathological syndrome and method of treating acute and chronic respiratory system diseases and cough synrdome | |
RU2543332C2 (en) | Therapeutic agent for endothelial dysfunction correction | |
RU2543331C2 (en) | Therapeutic agent for endothelial dysfunction correction | |
RU2532323C2 (en) | Therapeutic agent for treating pathological syndrome and method of treating functional bowel disorders | |
RU2528093C2 (en) | Pharmaceutical composition and method of treating acute and chronic respiratory diseases and cough syndrome | |
RU2525156C2 (en) | Method of treatment and prevention of arterial hypertension and pharmaceutical composition for treatment of arterial hypertension | |
RU2523451C2 (en) | Method of treating chronic cardiac failure and pharmaceutical composition for treating chronic cardiac failure | |
RU2500424C2 (en) | Therapeutic agent for endothelial dysfunction correction | |
RU2533224C2 (en) | Method of treating psychoactive substance dependence, alcohol and nicotine addiction and medication for treatment of psychoactive substance dependence, alcohol and nicotine addiction | |
RU2542403C2 (en) | Method for endothelial dysfunction correction |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FA92 | Acknowledgement of application withdrawn (lack of supplementary materials submitted) |
Effective date: 20131016 |
|
FZ9A | Application not withdrawn (correction of the notice of withdrawal) |
Effective date: 20140929 |
|
MM4A | The patent is invalid due to non-payment of fees |
Effective date: 20150928 |
|
NF4A | Reinstatement of patent |
Effective date: 20161227 |