KR20230160738A - 혈뇌장벽을 통과하는 폴리펩타이드 및 이의 용도 - Google Patents
혈뇌장벽을 통과하는 폴리펩타이드 및 이의 용도 Download PDFInfo
- Publication number
- KR20230160738A KR20230160738A KR1020230063134A KR20230063134A KR20230160738A KR 20230160738 A KR20230160738 A KR 20230160738A KR 1020230063134 A KR1020230063134 A KR 1020230063134A KR 20230063134 A KR20230063134 A KR 20230063134A KR 20230160738 A KR20230160738 A KR 20230160738A
- Authority
- KR
- South Korea
- Prior art keywords
- blood
- brain
- brain barrier
- seq
- penetrating peptide
- Prior art date
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 73
- 230000008499 blood brain barrier function Effects 0.000 title claims abstract description 36
- 210000001218 blood-brain barrier Anatomy 0.000 title claims abstract description 36
- 102000004196 processed proteins & peptides Human genes 0.000 title abstract description 33
- 229920001184 polypeptide Polymers 0.000 title abstract description 22
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 16
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 15
- 239000013076 target substance Substances 0.000 claims description 19
- 239000013598 vector Substances 0.000 claims description 14
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 12
- 108091033319 polynucleotide Proteins 0.000 claims description 11
- 102000040430 polynucleotide Human genes 0.000 claims description 11
- 239000002157 polynucleotide Substances 0.000 claims description 11
- 208000014644 Brain disease Diseases 0.000 claims description 10
- 210000004556 brain Anatomy 0.000 claims description 9
- 208000015114 central nervous system disease Diseases 0.000 claims description 9
- 239000002773 nucleotide Substances 0.000 claims description 8
- 125000003729 nucleotide group Chemical group 0.000 claims description 8
- 230000000149 penetrating effect Effects 0.000 claims description 8
- 239000003814 drug Substances 0.000 claims description 7
- 229940079593 drug Drugs 0.000 claims description 6
- 239000000203 mixture Substances 0.000 claims description 6
- 238000011282 treatment Methods 0.000 claims description 6
- 239000008194 pharmaceutical composition Substances 0.000 claims description 5
- 150000002632 lipids Chemical class 0.000 claims description 4
- 241000700605 Viruses Species 0.000 claims description 3
- 239000004480 active ingredient Substances 0.000 claims description 3
- 150000001875 compounds Chemical class 0.000 claims description 3
- 238000000034 method Methods 0.000 claims description 3
- 230000002265 prevention Effects 0.000 claims description 3
- 239000002096 quantum dot Substances 0.000 claims description 3
- 229930186217 Glycolipid Natural products 0.000 claims description 2
- 102000003886 Glycoproteins Human genes 0.000 claims description 2
- 108090000288 Glycoproteins Proteins 0.000 claims description 2
- 150000001720 carbohydrates Chemical class 0.000 claims description 2
- BFMYDTVEBKDAKJ-UHFFFAOYSA-L disodium;(2',7'-dibromo-3',6'-dioxido-3-oxospiro[2-benzofuran-1,9'-xanthene]-4'-yl)mercury;hydrate Chemical compound O.[Na+].[Na+].O1C(=O)C2=CC=CC=C2C21C1=CC(Br)=C([O-])C([Hg])=C1OC1=C2C=C(Br)C([O-])=C1 BFMYDTVEBKDAKJ-UHFFFAOYSA-L 0.000 claims description 2
- 238000009472 formulation Methods 0.000 claims description 2
- 239000002502 liposome Substances 0.000 claims description 2
- 239000002105 nanoparticle Substances 0.000 claims description 2
- 102000039446 nucleic acids Human genes 0.000 claims description 2
- 108020004707 nucleic acids Proteins 0.000 claims description 2
- 150000007523 nucleic acids Chemical class 0.000 claims description 2
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 claims 1
- 210000005013 brain tissue Anatomy 0.000 abstract description 14
- 239000000126 substance Substances 0.000 abstract description 13
- 108020001507 fusion proteins Proteins 0.000 description 12
- 102000037865 fusion proteins Human genes 0.000 description 12
- 210000004204 blood vessel Anatomy 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 7
- 230000035699 permeability Effects 0.000 description 7
- 210000004027 cell Anatomy 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 238000002372 labelling Methods 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 210000003169 central nervous system Anatomy 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 230000002776 aggregation Effects 0.000 description 3
- 238000004220 aggregation Methods 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- 208000024827 Alzheimer disease Diseases 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 208000018737 Parkinson disease Diseases 0.000 description 2
- -1 S413-PV Proteins 0.000 description 2
- 108010021188 Superoxide Dismutase-1 Proteins 0.000 description 2
- 102100038836 Superoxide dismutase [Cu-Zn] Human genes 0.000 description 2
- 210000000133 brain stem Anatomy 0.000 description 2
- 230000003412 degenerative effect Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- SNICXCGAKADSCV-JTQLQIEISA-N (-)-Nicotine Chemical compound CN1CCC[C@H]1C1=CC=CN=C1 SNICXCGAKADSCV-JTQLQIEISA-N 0.000 description 1
- VZQHRKZCAZCACO-PYJNHQTQSA-N (2s)-2-[[(2s)-2-[2-[[(2s)-2-[[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]amino]propanoyl]amino]prop-2-enoylamino]-3-methylbutanoyl]amino]propanoic acid Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)C(=C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(N)=N VZQHRKZCAZCACO-PYJNHQTQSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 102100026882 Alpha-synuclein Human genes 0.000 description 1
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 1
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- OBMZMSLWNNWEJA-XNCRXQDQSA-N C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 Chemical compound C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 OBMZMSLWNNWEJA-XNCRXQDQSA-N 0.000 description 1
- 238000011814 C57BL/6N mouse Methods 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 206010012289 Dementia Diseases 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- 201000011240 Frontotemporal dementia Diseases 0.000 description 1
- 108091092584 GDNA Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 208000023105 Huntington disease Diseases 0.000 description 1
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 244000147568 Laurus nobilis Species 0.000 description 1
- 235000017858 Laurus nobilis Nutrition 0.000 description 1
- 101800004761 Magainin-2 Proteins 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 108010088535 Pep-1 peptide Proteins 0.000 description 1
- 101710176384 Peptide 1 Proteins 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 102100040347 TAR DNA-binding protein 43 Human genes 0.000 description 1
- 101710150875 TAR DNA-binding protein 43 Proteins 0.000 description 1
- 235000005212 Terminalia tomentosa Nutrition 0.000 description 1
- 244000299461 Theobroma cacao Species 0.000 description 1
- 235000005764 Theobroma cacao ssp. cacao Nutrition 0.000 description 1
- 235000005767 Theobroma cacao ssp. sphaerocarpum Nutrition 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000003570 air Substances 0.000 description 1
- 108090000185 alpha-Synuclein Proteins 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 229940035674 anesthetics Drugs 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 210000004958 brain cell Anatomy 0.000 description 1
- 108010025307 buforin II Proteins 0.000 description 1
- 235000001046 cacaotero Nutrition 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000013601 cosmid vector Substances 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 208000037765 diseases and disorders Diseases 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 239000003205 fragrance Substances 0.000 description 1
- 239000003193 general anesthetic agent Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 229960002725 isoflurane Drugs 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 229940057995 liquid paraffin Drugs 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 229960003511 macrogol Drugs 0.000 description 1
- MGIUUAHJVPPFEV-ABXDCCGRSA-N magainin ii Chemical compound C([C@H](NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O)C1=CC=CC=C1 MGIUUAHJVPPFEV-ABXDCCGRSA-N 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 229960002715 nicotine Drugs 0.000 description 1
- SNICXCGAKADSCV-UHFFFAOYSA-N nicotine Natural products CN1CCCC1C1=CC=CN=C1 SNICXCGAKADSCV-UHFFFAOYSA-N 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 108010043655 penetratin Proteins 0.000 description 1
- MCYTYTUNNNZWOK-LCLOTLQISA-N penetratin Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CC=CC=C1 MCYTYTUNNNZWOK-LCLOTLQISA-N 0.000 description 1
- 230000007903 penetration ability Effects 0.000 description 1
- 238000011458 pharmacological treatment Methods 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 210000003625 skull Anatomy 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 102000013498 tau Proteins Human genes 0.000 description 1
- 108010026424 tau Proteins Proteins 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/001—Preparation for luminescence or biological staining
- A61K49/0013—Luminescence
- A61K49/0017—Fluorescence in vivo
- A61K49/005—Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
- A61K49/0056—Peptides, proteins, polyamino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
Abstract
본 발명은 혈뇌장벽 또는 뇌혈관장벽을 통과하는 폴리펩타이드 및 상기 폴리펩타이드의 물질 전달 용도에 관한 것으로 상기 폴리펩타이드는 단백질과 같이 자연적으로는 혈뇌장벽을 통과할 수 없는 물질을 뇌 조직 내로 전달할 수 있다.
Description
본 발명은 혈뇌장벽 또는 뇌혈관장벽을 통과하는 폴리펩타이드 및 상기 폴리펩타이드의 물질 전달 용도에 관한 것이다.
혈뇌장벽 또는 뇌혈관 장벽 (Blood-Brain Barrier, BBB)은 뇌척수액과 혈액을 분리시키는 장벽이다. 높은 선택적 투과성을 갖고 있어 몸의 주요 조절중추를 세균 등과 같이 혈액으로부터 운반될 수 있는 병원체 및 혈액 내의 잠재적인 위험물질로부터 격리시키는 역할을 한다.
혈뇌장벽은 포도당, 필수아미노산, 전해질 등은 내피세포를 통해 수동적으로 통과시키지만 혈중의 대사산물, 독소, 약물은 뇌세포로 들어오지 못하게 막는 역할을 한다. 그러나 물, 공기, 이산화탄소와 같은 지용성 물질은 자유롭게 장벽을 통과할 수 있으므로 알코올, 니코틴, 마취제 등은 뇌에 영향을 미치게 된다.
혈뇌장벽의 이러한 선택적 투과성은 알츠하이머 질환, 파킨슨 질환, 세균성 및 바이러스성 감염 및 암과 같은 뇌 및 중추신경계 (central nervous system, CNS) 질환의 약리학적 치료에 주요 장애가 된다. 뇌 및 중추신경계 (CNS) 질환 및 장애를 치료하기 위한 많은 치료제는 친수성이어서 혈뇌장벽을 직접 통과하지 못하기 때문이다.
상기와 같은 상황에서 본 발명자들은 신규한 혈뇌장벽 투과성 펩타이드를 발굴하기 위해 연구하였고, 5종의 신규 펩타이드와 GST의 융합 단백질이 혈뇌장벽을 통과하는 것을 생체 내 실험 결과로 확인하였다.
따라서, 본 발명의 목적은 신규한 혈뇌장벽 투과성 펩타이드 및 상기 펩타이드의 목적물질 뇌전달 용도를 제공하는 것이다.
상기 목적을 달성하기 위하여 본 발명의 일 양상은 서열번호 3 또는 서열번호 5의 아미노산 서열을 포함하는 혈뇌장벽 투과성 펩타이드를 제공한다.
본 발명의 일 구체예에 따르면, 서열번호 3의 아미노산 서열을 포함하는 혈뇌장벽 투과성 펩타이드는 서열번호 1 내지 3으로 이루어진 군에서 선택될 수 있고, 서열번호 5의 아미노산 서열을 포함하는 혈뇌장벽 투과성 펩타이드는 서열번호 4 또는 서열번호 5의 아미노산 서열로 이루어질 수 있다.
본 발명에서, 서열번호 3의 아미노산 서열을 포함하는 혈뇌장벽 투과성 펩타이드는 서열번호 1 내지 3으로 이루어진 군에서 선택되는 아미노산 서열과 70% 이상, 바람직하게는 80% 이상, 더욱 바람직하게는 90% 이상, 더더욱 바람직하게는 95% 이상, 가장 바람직하게는 98% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
본 발명에서, 서열번호 5의 아미노산 서열을 포함하는 혈뇌장벽 투과성 펩타이드는 서열번호 5의 아미노산 서열과 70% 이상, 바람직하게는 80% 이상, 더욱 바람직하게는 90% 이상, 더더욱 바람직하게는 95% 이상, 가장 바람직하게는 98% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
한편, 상기 혈뇌장벽 투과성 펩타이드는 다른 세포막 투과성 펩타이드와 융합되어 사용될 수 있으며, 세포막 투과성 펩타이드의 예에는 페네트라틴 (Penetratin), TAT 펩티드, Pep-1펩티드, S413-PV, 메가이닌 2 (Magainin 2) 또는 부포린 2 (Buforin 2)가 있다.
본 발명자들은 발굴한 혈뇌장벽 투과성 펩타이드와 GST의 융합 단백질이 마우스의 혈뇌장벽을 통과하는 것을 구체적인 실험으로 확인하였다 (도 1 내지 5).
따라서, 본 발명의 다른 양상은 혈뇌장벽 투과성 펩타이드; 및 상기 혈뇌장벽 투과성 펩타이드의 일 말단에 결합된 목적 물질;을 포함하는 목적 물질 뇌전달용 시스템을 제공한다.
상기 목적 물질은 화합물, 단백질, 당단백질, 펩타이드, 뉴클레오티드, 핵산, 탄수화물, 지질, 당지질, 나노입자, 리포좀, 약물, 지질 기반 제제 (lipid-based formulation), 바이러스, 양자점 (quantum dots) 및 형광색소 (fluorochrome)로 이루어진 군으로부터 선택될 수 있다.
본 발명에서, 상기 혈뇌장벽 투과성 단백질과 목적 물질은 당 업계에 공지된 단백질과 목적 물질을 결합시키는 방법으로 연결될 수 있으며, 예를 들어 공유결합, 화학결합, 펩타이드 결합 등으로 연결될 수 있다.
상기 기술하였듯이 본 발명자들은 혈뇌장벽 투과성 펩타이드와 GST의 융합 단백질이 혈뇌장벽을 통과하는 것을 확인한 바, 목적 물질로 단백질(목적 단백질)을 사용할 때는 혈뇌장벽 투과성 단백질과 목적 단백질의 융합 단백질 형태로 뇌조직에 도입할 수 있다.
한편, 목적 물질로 뇌 또는 중추 신경계 질환의 치료제나 진단제를 사용한다면 목적 물질 뇌전달용 시스템은 뇌 또는 중추 신경계 질환의 치료 또는 예방용 약학 조성물, 뇌 또는 중추 신경계 질환의 진단용 조성물로 활용될 수 있다.
예를 들어, 본 발명은 알파-시누클레인 (alpha-synuclein), 아밀로이드 베타 (amyloid beta), 타우 (tau), SOD1 (Superoxide dismutase1), TDP-43 등 퇴행성 뇌질환에서 응집이 증가하는 다양한 타겟물질에 선택적으로 결합하여 응집을 억제하는 물질과 혈뇌장벽 투과성 펩타이드를 연결시킨 후, 이를 체내에 주입하면 뇌실질 내의 상기 타겟물질의 분포를 PET를 통해 조기에 조영하거나 응집을 억제할 수 있다.
상기 뇌 또는 중추 신경계 질환에는 일반적으로 말하는 퇴행성 신경 질환이 포함되며, 알츠하이머성 치매, 파킨슨 병, 전두측두치매, 루이치매, 및 헌팅톤병 등이 포함된다.
상기 뇌 또는 중추 신경계 질환의 진단용 조성물은 뇌 또는 중추 신경계 질환의 위험도 예측 또는 진단용 키트 형태로 구현되어 제공될 수 있다. 이 키트에는 혈뇌장벽 투과성 펩타이드를 검출할 수 있는 제제를 포함할 뿐만 아니라, 분석 방법에 적합한 1종 이상의 다른 구성성분 조성물, 용액, 또는 장치가 포함될 수 있다.
상기 뇌 또는 중추 신경계 질환의 치료 또는 예방용 약학 조성물은 목적하는 방법에 따라 경구투여하거나 비경구투여(예를 들어, 정맥 내, 피하, 복강 내 또는 국소에 적용)할 수 있으며, 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 제조된다.
경구투여를 위한 고형 제제에는 정제, 환제, 산제, 과립제, 캡슐제, 트로키제 등이 포함되며, 이러한 고형 제제는 유효성분에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로스(sucrose) 또는 락토오스(lactose) 또는 젤라틴 등을 섞어 제조된다. 또한, 단순한 부형제 외에 마그네슘 스티레이트 탈크 같은 윤활제들도 사용된다. 경구 투여를 위한 액상 제제로는 현탁제, 내용 액제, 유제 또는 시럽제 등이 해당되는데, 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다.
비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁용제, 유제, 동결건조제제, 좌제 등이 포함된다. 비수성용제, 현탁용제로는 프로필렌글리콜, 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세롤, 젤라틴 등이 사용될 수 있다.
본 발명의 약학적 조성물은 약학적으로 유효한 양으로 투여한다. 본 발명에 있어서 '약학적으로 유효한 양'은 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분한 양을 의미하며, 유효용량 수준은 환자의 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 예를 들어, 본 발명의 약학적 조성물은 0.1 ㎎/㎏ 내지 200 ㎎/㎏, 바람직하게는 1 ㎎/㎏ 내지 50 ㎎/㎏ 용량으로 1일 1회, 또는 1일 3회로 분할하여 투여할 수 있다. 상기 투여량은 어떠한 방법으로도 본 발명의 범위를 한정하는 것이 아니다. 그러나 투여 경로, 비만의 중증도, 성별, 체중, 연령 등에 따라서 증감될 수 있으므로 상기 투여량이 어떠한 방법으로도 본 발명의 범위를 한정하는 것은 아니다.
본 발명의 또 다른 양상은 상기 혈뇌장벽 투과성 펩타이드를 코딩하는 폴리뉴클레오티드를 제공한다.
본 명세서에 사용된 용어, '폴리뉴클레오티드(polynucleotide)'는 단일가닥 또는 이중가닥 형태로 존재하는 디옥시리보뉴클레오티드 (deoxyribonucleotide) 또는 리보뉴클레오티드(ribonucleotide)의 중합체이다. RNA 게놈 서열, DNA(gDNA 및 cDNA) 및 이로부터 전사되는 RNA 서열을 포괄하며, 특별하게 다른 언급이 없는 한 천연의 폴리뉴클레오티드의 유사체를 포함한다.
본 발명에서, 상기 폴리뉴클레오티드는 세포막 투과성 펩타이드를 코딩하는 뉴클레오티드 서열뿐만 아니라, 그 서열에 상보적인(complementary) 서열도 포함한다. 상기 상보적인 서열은 완벽하게 상보적인 서열뿐만 아니라, 실질적으로 상보적인 서열도 포함하다. 또한, 상기 폴리뉴클레오티드 서열은 변형될 수 있으며, 변형은 뉴클레오티드의 추가, 결실 또는 비보존적 치환 또는 보존적 치환을 포함한다.
본 발명의 또 다른 양상은 상기 혈뇌장벽 투과성 단백질을 코딩하는 폴리뉴클레오티드 서열을 포함하는 재조합 벡터를 제공한다.
본 명세서에 사용된 용어, '벡터(vector)'는 숙주세포에서 목적 유전자를 발현시키기 위한 수단을 의미한다. 예를 들어, 플라스미드 벡터, 코즈미드 벡터 및 박테리오파아지 벡터, 아데노바이러스 벡터, 레트로바이러스 벡터 및 아데노-연관 바이러스 벡터와 같은 바이러스 벡터를 포함할 수 있으나, 이에 한정하지는 않는다. 상기 재조합 벡터로 사용될 수 있는 벡터는 당 업계에서 종종 사용되는 플라스미드 (예를 들면, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14, pGEX 시리즈, pET 시리즈 및 pUC19 등), 파지 (예를 들면, λgt4λB, λ-Charon, λΔz1 및 M13 등) 또는 바이러스(예를 들면, CMV, SV40 등)를 조작하여 제작될 수 있다.
상기 재조합 벡터는 상기 폴리뉴클레오티드 서열과 폴리뉴클레오티드 서열에 작동적으로 연결된(operatively linked) 프로모터를 포함할 수 있다.
본 명세서에 사용된 용어, '작동적으로 연결된'은 뉴클레오티드 발현 조절 서열(예를 들어, 프로모터 서열)과 다른 뉴클레오티드 서열 사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절 서열은 상기 다른 뉴클레오티드 서열의 전사 및/또는 해독을 조절하게 된다.
본 발명의 일 구체예에 따르면, 목적 물질로 단백질을 사용하는 경우 벡터에 혈뇌장벽 투과성 단백질과 목적 단백질을 코딩하는 폴리뉴클레오티드 서열을 같이 도입하여 융합 단백질 형태로 발현시킬 수 있다.
따라서, 상기 재조합 벡터는 융합 단백질의 정제를 용이하게 하는 태그(tag) 서열, 예를 들어, 연속된 히스티딘 코돈, 말토우즈 바인딩 단백질 코돈 및 Myc 코돈 등을 포함할 수 있다. 또한, 상기 재조합 벡터는 융합 단백질의 가용성(solubility)을 증가시키기 위한 융합파트너(partner) 등을 추가로 포함할 수 있다. 또한 융합 단백질 발현 시 불필요한 부분을 제거하기 위하여 효소에 의해 특이적으로 절단되는 서열, 발현 조절 서열 및 세포 내 전달을 확인하기 위한 마커(marker) 또는 리포터 유전자 서열을 포함할 수 있다.
본 발명의 혈뇌장벽 투과성 폴리펩타이드를 이용하면 자연적으로는 혈뇌장벽을 통과할 수 없는 물질을 뇌 조직 내로 효과적으로 전달할 수 있다.
도 1은 GST와 서열번호 1의 폴리펩타이드가 융합된 단백질에 형광물질을 표지하여 마우스에 투여한 후 뇌 조직에서 폴리펩타이드의 시간별 혈뇌장벽 투과도를 확인한 결과이다 (적색: 혈관, 녹색: 폴리펩타이드).
도 2는 GST와 서열번호 2의 폴리펩타이드가 융합된 단백질에 형광물질을 표지하여 마우스에 투여한 후 뇌 조직에서 폴리펩타이드의 시간별 혈뇌장벽 투과도를 확인한 결과이다 (적색: 혈관, 녹색: 폴리펩타이드).
도 3은 서열번호 3의 폴리펩타이드에 형광물질을 표지하여 마우스에 투여한 후 뇌 조직에서 폴리펩타이드의 시간별 혈뇌장벽 투과도를 확인한 결과이다 (적색: 혈관, 녹색: 폴리펩타이드).
도 4는 서열번호 4의 폴리펩타이드에 형광물질을 표지하여 마우스에 투여한 후 뇌 조직에서 폴리펩타이드의 시간별 혈뇌장벽 투과도를 확인한 결과이다 (적색: 혈관, 녹색: 폴리펩타이드).
도 5는 서열번호 5의 폴리펩타이드에 형광물질을 표지하여 마우스에 투여한 후 뇌 조직에서 폴리펩타이드의 시간별 혈뇌장벽 투과도를 확인한 결과이다 (적색: 혈관, 녹색: 폴리펩타이드).
도 2는 GST와 서열번호 2의 폴리펩타이드가 융합된 단백질에 형광물질을 표지하여 마우스에 투여한 후 뇌 조직에서 폴리펩타이드의 시간별 혈뇌장벽 투과도를 확인한 결과이다 (적색: 혈관, 녹색: 폴리펩타이드).
도 3은 서열번호 3의 폴리펩타이드에 형광물질을 표지하여 마우스에 투여한 후 뇌 조직에서 폴리펩타이드의 시간별 혈뇌장벽 투과도를 확인한 결과이다 (적색: 혈관, 녹색: 폴리펩타이드).
도 4는 서열번호 4의 폴리펩타이드에 형광물질을 표지하여 마우스에 투여한 후 뇌 조직에서 폴리펩타이드의 시간별 혈뇌장벽 투과도를 확인한 결과이다 (적색: 혈관, 녹색: 폴리펩타이드).
도 5는 서열번호 5의 폴리펩타이드에 형광물질을 표지하여 마우스에 투여한 후 뇌 조직에서 폴리펩타이드의 시간별 혈뇌장벽 투과도를 확인한 결과이다 (적색: 혈관, 녹색: 폴리펩타이드).
이하 하나 이상의 구체예를 실시예를 통하여 보다 상세하게 설명한다. 그러나 이들 실시예는 하나 이상의 구체예를 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실시예 1: 펩타이드 준비
펩타이드를 다음과 같이 준비하였으며, 펩타이드 서열은 표 1에 기재하였다.
| 서열번호 | 펩타이드 서열 |
| 1 | GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIER HKQKIKMLKHDD |
| 2 | GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKK |
| 3 | VDRGAGSIREAGGAFGKREQAEEERYFR |
| 4 | GSDQSENVDRG |
| 5 | GSDQSEN |
투과성 펩타이드가 약물 전달체로 활용될 수 있는지 평가하기 위해 자연적으로는 혈뇌장벽을 투과할 수 없는 GST를 서열번호 1 또는 2에 해당하는 펩타이드의 N-말단에 접합시켰다.
구체적으로 pGEX 벡터 시스템에 서열번호 1 또는 2의 펩타이드 서열과 GST를 인코딩하는 뉴클레오티드 서열을 삽입하여 재조합 벡터를 만들고, 이 재조합 벡터를 대장균 균주 BL21(DE3)에 형질전환으로 도입하였다. 상기 균주를 LB 배지에서 26℃로 3시간 동안 배양한 후 1 mM의 IPTG (isopropyl-β-D-thiogalactopyranoside)를 처리하고, 다시 18℃에서 12시간 배양하였다.
이후 배양액을 회수하여 원심분리로 세포를 회수하고, 세포에 초음파를 처리 (sonication)하였다. 친화성 크로마토그래피로 GST+펩타이드의 융합 단백질을 얻었다. 수득한 융합 단백질은 PBS(pH 7.4) 완충액을 이용해 2~3일간 염 농도를 맞추고 순도를 높였다.
서열번호 1, 2를 제외한 서열번호 3, 4 및 5의 펩타이드는 합성하였고, 순도는 95 % 이상인 것을 확인 후 이후 실험에 활용하였다.
실시예 2: 펩타이드의 BBB 투과능 평가
본 발명의 펩타이드가 생체 시스템에서 혈뇌장벽을 투과할 수 있는지 다음과 같이 확인하였다.
생체 내에서 펩타이드를 추적하기 위해 실시예 1에서 제작한 GST+펩타이드의 융합 단백질 또는 서열번호 3 내지 5의 펩타이드에 형광신호를 나타내는 Dylight 488을 결합시켰다. 형광물질이 결합된 각 융합 단백질 또는 펩타이드 시료를 인체와 유사한 대사작용을 나타내는 것으로 알려진 마우스 (계통명: C57BL/6N, 8주령)에 주입하고 뇌 조직 및 혈관부위에서 시료의 존재 여부를 관찰하였다
마우스는 움직임을 제한하고 이에 따른 부적절한 결과 해석을 방지하고자 호흡마취 (isoflurane)을 진행하였다. 뇌 조직과 혈관을 구분하기 위하여 항-CD31과 FSD fluor 647 화합물을 통해 혈관을 염색하였으며, 조직 이미징을 위해 두개골 위의 피부 조직을 절개하고, 절개 부위에 두개골 창 (cranial window)를 부착하여 고정된 이미지를 얻었다. 이후 시료 주입 직전 (0 hr)의 조직 이미지를 형광현미경 (IVM-CM Confocal & Two-photon convertible microscopy)으로 촬영하고, 시료 (10 mg/kg)를 정맥주사로 주입하여 시간에 따른 형광신호 양상을 관찰하였다.
그 결과, 펩타이드 1 및 2는 주입 후 0.16시간 (10분) 시점부터 뇌 조직 내 혈관에서 형광신호를 관찰할 수 있었고, 펩타이드 1은 주입 후 1시간, 펩타이드 2는 주입 후 4시간 시점에 뇌 조직 내 형광신호가 가장 높은 것을 알 수 있었다 (도 1 및 도 2).
펩타이드 3 내지 5는 모두 주입 후 0.5시간 (30분) 시점부터 뇌 조직 내 혈관에서 형광신호를 관찰할 수 있었으며, 주입 후 1시간 시점에 형광신호가 가장 높았다 (도 1 내지 5).
도 1 내지 5의 결과를 통해 본 발명의 펩타이드가 혈뇌장벽을 투과하고, GST와 같은 큰 물질을 효과적으로 뇌 조직 내로 전달할 수 있음을 확인하였다.
Claims (10)
- 서열번호 3 또는 서열번호 5의 아미노산 서열을 포함하는 혈뇌장벽 투과성 펩타이드.
- 제1항에 있어서, 서열번호 3의 아미노산 서열을 포함하는 혈뇌장벽 투과성 펩타이드는 서열번호 1 내지 3으로 이루어진 군에서 선택되는, 혈뇌장벽 투과성 펩타이드.
- 제1항에 있어서, 서열번호 5의 아미노산 서열을 포함하는 혈뇌장벽 투과성 펩타이드는 서열번호 4 또는 서열번호 5의 아미노산 서열로 이루어지는, 혈뇌장벽 투과성 펩타이드.
- 제1항 내지 제3항 중 어느 한 항에 따른 혈뇌장벽 투과성 펩타이드; 및
상기 혈뇌장벽 투과성 펩타이드의 일 말단에 결합된 목적 물질;을 포함하는 목적 물질 뇌전달용 시스템. - 제4항에 있어서, 상기 목적 물질은 화합물, 단백질, 당단백질, 펩타이드, 뉴클레오티드, 핵산, 탄수화물, 지질, 당지질, 나노입자, 리포좀, 약물, 지질 기반 제제 (lipid-based formulation), 바이러스, 양자점 (quantum dots) 및 형광색소 (fluorochrome)로 이루어진 군으로부터 선택되는, 목적 물질 뇌전달용 시스템.
- 제4항에 있어서, 상기 혈뇌장벽 투과성 펩타이드의와 목적 물질은 공유결합으로 연결되는, 목적 물질 뇌전달용 시스템.
- 제1항 내지 제3항 중 어느 한 항에 따른 혈뇌장벽 투과성 펩타이드를 코딩하는 폴리뉴클레오티드.
- 제7항의 폴리뉴클레오티드를 포함하는 재조합 벡터.
- 제4항 내지 제6항 중 어느 한 항에 따른 목적 물질 뇌전달용 시스템을 유효성분으로 포함하는, 뇌 또는 중추 신경계 질환의 치료 또는 예방용 약학 조성물.
- 제4항 내지 제6항 중 어느 한 항에 따른 목적 물질 뇌전달용 시스템을 유효성분으로 포함하는, 뇌 또는 중추 신경계 질환의 진단용 조성물.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020220059758 | 2022-05-16 | ||
| KR20220059758 | 2022-05-16 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| KR20230160738A true KR20230160738A (ko) | 2023-11-24 |
Family
ID=88835742
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020230063134A KR20230160738A (ko) | 2022-05-16 | 2023-05-16 | 혈뇌장벽을 통과하는 폴리펩타이드 및 이의 용도 |
Country Status (2)
| Country | Link |
|---|---|
| KR (1) | KR20230160738A (ko) |
| WO (1) | WO2023224357A1 (ko) |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102166549B1 (ko) | 2014-01-10 | 2020-10-16 | 주식회사 젬백스앤카엘 | 혈뇌장벽 투과성 펩티드 및 이를 포함하는 컨쥬게이트 |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5906923A (en) * | 1996-10-02 | 1999-05-25 | Incyte Pharmaceuticals, Inc. | ATPase inhibitor |
| EP3336100B1 (en) * | 2015-08-21 | 2021-01-13 | IUCF-HYU (Industry-University Cooperation Foundation Hanyang University) | Peptide having effect of preventing or treating central nervous system diseases and pharmaceutical composition for preventing and treating central nervous system diseases, containing same as active ingredient |
| KR101941975B1 (ko) * | 2017-03-17 | 2019-01-25 | 고려대학교 산학협력단 | Atpif1을 함유하는 당뇨 치료용 약학조성물 |
| KR102587460B1 (ko) * | 2019-11-28 | 2023-10-11 | 고려대학교 산학협력단 | 신규한 세포막 투과성 단백질 및 이의 용도 |
-
2023
- 2023-05-16 KR KR1020230063134A patent/KR20230160738A/ko unknown
- 2023-05-16 WO PCT/KR2023/006613 patent/WO2023224357A1/ko unknown
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102166549B1 (ko) | 2014-01-10 | 2020-10-16 | 주식회사 젬백스앤카엘 | 혈뇌장벽 투과성 펩티드 및 이를 포함하는 컨쥬게이트 |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2023224357A1 (ko) | 2023-11-23 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9056892B2 (en) | Retrograde transport peptide and use of same for delivery to central nervous system | |
| US9040477B2 (en) | Macromolecule transduction domains and methods for identification and uses thereof | |
| US6248558B1 (en) | Sequence and method for genetic engineering of proteins with cell membrane translocating activity | |
| JP6625071B2 (ja) | 慢性疼痛用のナトリウムチャネルを標的とする非麻薬性ｃｒｍｐ２ペプチド | |
| US8445650B2 (en) | Mutant botulinum neurotoxin serotype A polypeptide and uses thereof | |
| US10131888B2 (en) | Intracellular protein delivery | |
| Khafagy et al. | Structural requirements of penetratin absorption enhancement efficiency for insulin delivery | |
| CN101490081A (zh) | 用于抑制神经元nmda受体(nmdar)与nmdar相互作用蛋白的相互作用的融合肽 | |
| JP2024029097A (ja) | ミニヌクレオソームコアタンパク質及び核酸送達における使用 | |
| JP7384672B2 (ja) | Ｃ末端ｃｄｎｆ断片及びｃ末端ｍａｎｆ断片、それらを含む医薬組成物、並びにそれらの使用 | |
| JP2021505135A (ja) | Ｃｄｋｌ５発現変異体及びｃｄｋｌ５融合タンパク質 | |
| US20210299263A1 (en) | Cell-penetrating peptides | |
| KR20210109551A (ko) | 링커 | |
| KR102274999B1 (ko) | 신규한 세포 투과성 펩타이드 및 이의 용도 | |
| JP5700409B2 (ja) | Ｈｓｐ９０を標的にした新規抗がんキメラペプチド | |
| KR20230160738A (ko) | 혈뇌장벽을 통과하는 폴리펩타이드 및 이의 용도 | |
| WO2011133112A1 (en) | Cell penetrating peptide derived from the premembrane protein of flavivirus | |
| ES2281278B1 (es) | Empleo de un polipeptido que comprende el dominio c-terminal de la cadena pesada de la toxina tetanica en el tratamiento del parkinsonismo. | |
| KR102511500B1 (ko) | 파이브로넥틴 단편 단백질이 과발현된 세포외소포체 및 이의 약물 전달 용도 | |
| KR102410556B1 (ko) | 미토콘드리아 타겟팅용 펩타이드 | |
| KR20230119663A (ko) | 양이온성 세포 투과성 펩타이드 및 이의 용도 | |
| KR20210063744A (ko) | App에서 유래된 폴리펩타이드를 포함하는 조성물 | |
| Shi et al. | In situ entry of oligonucleotides into brain cells can occur through a nucleic acid channel; options for effectuating antisense therapy in the brain | |
| KR20170018225A (ko) | 세포투과성 열충격단백질 22 융합단백질을 포함하는 뇌허혈 예방 및 치료용 약학 조성물 |