KR20190130562A - Bcma 표적 항체 및 이의 용도 - Google Patents
Bcma 표적 항체 및 이의 용도 Download PDFInfo
- Publication number
- KR20190130562A KR20190130562A KR1020197024625A KR20197024625A KR20190130562A KR 20190130562 A KR20190130562 A KR 20190130562A KR 1020197024625 A KR1020197024625 A KR 1020197024625A KR 20197024625 A KR20197024625 A KR 20197024625A KR 20190130562 A KR20190130562 A KR 20190130562A
- Authority
- KR
- South Korea
- Prior art keywords
- gly
- ser
- leu
- ala
- seq
- Prior art date
Links
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 title abstract description 7
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 title abstract description 7
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 title abstract 3
- 210000004027 cell Anatomy 0.000 claims abstract description 126
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims abstract description 78
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 40
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 109
- 230000027455 binding Effects 0.000 claims description 48
- 210000002865 immune cell Anatomy 0.000 claims description 44
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 36
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 36
- 108020004707 nucleic acids Proteins 0.000 claims description 36
- 102000039446 nucleic acids Human genes 0.000 claims description 36
- 150000007523 nucleic acids Chemical class 0.000 claims description 36
- 206010028980 Neoplasm Diseases 0.000 claims description 34
- 238000000034 method Methods 0.000 claims description 33
- 108090000623 proteins and genes Proteins 0.000 claims description 32
- 239000000427 antigen Substances 0.000 claims description 30
- 102000036639 antigens Human genes 0.000 claims description 30
- 108091007433 antigens Proteins 0.000 claims description 30
- 230000003834 intracellular effect Effects 0.000 claims description 28
- 102000004169 proteins and genes Human genes 0.000 claims description 23
- 229940127121 immunoconjugate Drugs 0.000 claims description 21
- 239000013604 expression vector Substances 0.000 claims description 19
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 claims description 17
- 239000003550 marker Substances 0.000 claims description 17
- 241000700605 Viruses Species 0.000 claims description 16
- 230000000139 costimulatory effect Effects 0.000 claims description 16
- 102100040678 Programmed cell death protein 1 Human genes 0.000 claims description 15
- 230000000694 effects Effects 0.000 claims description 14
- 102000004127 Cytokines Human genes 0.000 claims description 13
- 108090000695 Cytokines Proteins 0.000 claims description 13
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims description 13
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims description 13
- 239000003446 ligand Substances 0.000 claims description 12
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 11
- 239000002458 cell surface marker Substances 0.000 claims description 11
- 210000004881 tumor cell Anatomy 0.000 claims description 11
- 239000003153 chemical reaction reagent Substances 0.000 claims description 10
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 9
- 108010074708 B7-H1 Antigen Proteins 0.000 claims description 9
- -1 CD3ζ Proteins 0.000 claims description 9
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 claims description 9
- 101710089372 Programmed cell death protein 1 Proteins 0.000 claims description 9
- 230000000259 anti-tumor effect Effects 0.000 claims description 9
- 239000003814 drug Substances 0.000 claims description 9
- 229940079593 drug Drugs 0.000 claims description 8
- 210000004698 lymphocyte Anatomy 0.000 claims description 8
- 210000000822 natural killer cell Anatomy 0.000 claims description 8
- 102000001742 Tumor Suppressor Proteins Human genes 0.000 claims description 7
- 108010040002 Tumor Suppressor Proteins Proteins 0.000 claims description 7
- 101000834898 Homo sapiens Alpha-synuclein Proteins 0.000 claims description 6
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 claims description 6
- 101000652359 Homo sapiens Spermatogenesis-associated protein 2 Proteins 0.000 claims description 6
- 101000679851 Homo sapiens Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 6
- 102000013462 Interleukin-12 Human genes 0.000 claims description 6
- 108010065805 Interleukin-12 Proteins 0.000 claims description 6
- 102000003812 Interleukin-15 Human genes 0.000 claims description 6
- 108090000172 Interleukin-15 Proteins 0.000 claims description 6
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 6
- 102100038080 B-cell receptor CD22 Human genes 0.000 claims description 5
- 102100027207 CD27 antigen Human genes 0.000 claims description 5
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 claims description 5
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 claims description 5
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 claims description 5
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 5
- 101001042104 Homo sapiens Inducible T-cell costimulator Proteins 0.000 claims description 5
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 5
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 claims description 5
- 101000946860 Homo sapiens T-cell surface glycoprotein CD3 epsilon chain Proteins 0.000 claims description 5
- 102100021317 Inducible T-cell costimulator Human genes 0.000 claims description 5
- 102000002227 Interferon Type I Human genes 0.000 claims description 5
- 108010014726 Interferon Type I Proteins 0.000 claims description 5
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 claims description 5
- 102100035794 T-cell surface glycoprotein CD3 epsilon chain Human genes 0.000 claims description 5
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 5
- 102100032937 CD40 ligand Human genes 0.000 claims description 4
- 102000009410 Chemokine receptor Human genes 0.000 claims description 4
- 108050000299 Chemokine receptor Proteins 0.000 claims description 4
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 claims description 4
- 101000868215 Homo sapiens CD40 ligand Proteins 0.000 claims description 4
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 claims description 4
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 claims description 4
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 claims description 4
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 claims description 4
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 claims description 4
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 claims description 4
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 claims description 4
- 210000000581 natural killer T-cell Anatomy 0.000 claims description 4
- 239000008194 pharmaceutical composition Substances 0.000 claims description 4
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 claims description 3
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 claims description 3
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 claims description 3
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 claims description 3
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 claims description 3
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 claims description 3
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 3
- 239000003053 toxin Substances 0.000 claims description 3
- 231100000765 toxin Toxicity 0.000 claims description 3
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 claims description 2
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 claims description 2
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 claims description 2
- 101710149870 C-C chemokine receptor type 5 Proteins 0.000 claims description 2
- 102100028989 C-X-C chemokine receptor type 2 Human genes 0.000 claims description 2
- 102100031650 C-X-C chemokine receptor type 4 Human genes 0.000 claims description 2
- 101150013553 CD40 gene Proteins 0.000 claims description 2
- 102100035793 CD83 antigen Human genes 0.000 claims description 2
- 102100037904 CD9 antigen Human genes 0.000 claims description 2
- 102100024965 Caspase recruitment domain-containing protein 11 Human genes 0.000 claims description 2
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 claims description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 claims description 2
- 101000922348 Homo sapiens C-X-C chemokine receptor type 4 Proteins 0.000 claims description 2
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 claims description 2
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 claims description 2
- 101000761179 Homo sapiens Caspase recruitment domain-containing protein 11 Proteins 0.000 claims description 2
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 claims description 2
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 claims description 2
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 claims description 2
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 claims description 2
- 101001047640 Homo sapiens Linker for activation of T-cells family member 1 Proteins 0.000 claims description 2
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 claims description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 claims description 2
- 101000633780 Homo sapiens Signaling lymphocytic activation molecule Proteins 0.000 claims description 2
- 101000914496 Homo sapiens T-cell antigen CD7 Proteins 0.000 claims description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 claims description 2
- 101000648507 Homo sapiens Tumor necrosis factor receptor superfamily member 14 Proteins 0.000 claims description 2
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 claims description 2
- 108010018951 Interleukin-8B Receptors Proteins 0.000 claims description 2
- 102000017578 LAG3 Human genes 0.000 claims description 2
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 claims description 2
- 102100034709 Lymphocyte cytosolic protein 2 Human genes 0.000 claims description 2
- 101710195102 Lymphocyte cytosolic protein 2 Proteins 0.000 claims description 2
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 claims description 2
- 102000010168 Myeloid Differentiation Factor 88 Human genes 0.000 claims description 2
- 108010077432 Myeloid Differentiation Factor 88 Proteins 0.000 claims description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 claims description 2
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 claims description 2
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 claims description 2
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 claims description 2
- 108020004459 Small interfering RNA Proteins 0.000 claims description 2
- 102100027208 T-cell antigen CD7 Human genes 0.000 claims description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 claims description 2
- 102000011408 Tripartite Motif Proteins Human genes 0.000 claims description 2
- 108010023649 Tripartite Motif Proteins Proteins 0.000 claims description 2
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 claims description 2
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims description 2
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 claims description 2
- 239000000611 antibody drug conjugate Substances 0.000 claims description 2
- 229940049595 antibody-drug conjugate Drugs 0.000 claims description 2
- 239000002246 antineoplastic agent Substances 0.000 claims description 2
- 229940041181 antineoplastic drug Drugs 0.000 claims description 2
- 239000003795 chemical substances by application Substances 0.000 claims description 2
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 claims description 2
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 claims description 2
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 claims description 2
- 101000702132 Homo sapiens Protein spinster homolog 1 Proteins 0.000 claims 1
- 102100024032 Linker for activation of T-cells family member 1 Human genes 0.000 claims 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 claims 1
- 101001038499 Yarrowia lipolytica (strain CLIB 122 / E 150) Lysine acetyltransferase Proteins 0.000 claims 1
- 239000012642 immune effector Substances 0.000 abstract description 11
- 229940121354 immunomodulator Drugs 0.000 abstract description 11
- 230000008685 targeting Effects 0.000 abstract description 9
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 45
- 108010001064 glycyl-glycyl-glycyl-glycine Proteins 0.000 description 43
- 239000012634 fragment Substances 0.000 description 42
- 108020004414 DNA Proteins 0.000 description 37
- SOEGEPHNZOISMT-BYPYZUCNSA-N Gly-Ser-Gly Chemical compound NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O SOEGEPHNZOISMT-BYPYZUCNSA-N 0.000 description 37
- 241000880493 Leptailurus serval Species 0.000 description 32
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 32
- OYTPNWYZORARHL-XHNCKOQMSA-N Gln-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)N)N OYTPNWYZORARHL-XHNCKOQMSA-N 0.000 description 31
- 239000002773 nucleotide Substances 0.000 description 31
- 125000003729 nucleotide group Chemical group 0.000 description 31
- 108010087924 alanylproline Proteins 0.000 description 29
- 108010069205 aspartyl-phenylalanine Proteins 0.000 description 29
- MBLJBGZWLHTJBH-SZMVWBNQSA-N Trp-Val-Arg Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)=CNC2=C1 MBLJBGZWLHTJBH-SZMVWBNQSA-N 0.000 description 28
- PDUHNKAFQXQNLH-ZETCQYMHSA-N Gly-Lys-Gly Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)NCC(O)=O PDUHNKAFQXQNLH-ZETCQYMHSA-N 0.000 description 27
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 27
- KIZIOFNVSOSKJI-CIUDSAMLSA-N Leu-Ser-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N KIZIOFNVSOSKJI-CIUDSAMLSA-N 0.000 description 26
- OWFGFHQMSBTKLX-UFYCRDLUSA-N Val-Tyr-Tyr Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O)N OWFGFHQMSBTKLX-UFYCRDLUSA-N 0.000 description 26
- QYSFWUIXDFJUDW-DCAQKATOSA-N Ser-Leu-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O QYSFWUIXDFJUDW-DCAQKATOSA-N 0.000 description 25
- 239000013612 plasmid Substances 0.000 description 25
- MNQMTYSEKZHIDF-GCJQMDKQSA-N Asp-Thr-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O MNQMTYSEKZHIDF-GCJQMDKQSA-N 0.000 description 23
- YQPFCZVKMUVZIN-AUTRQRHGSA-N Glu-Val-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O YQPFCZVKMUVZIN-AUTRQRHGSA-N 0.000 description 23
- SBANPBVRHYIMRR-UHFFFAOYSA-N Leu-Ser-Pro Natural products CC(C)CC(N)C(=O)NC(CO)C(=O)N1CCCC1C(O)=O SBANPBVRHYIMRR-UHFFFAOYSA-N 0.000 description 23
- QEDMOZUJTGEIBF-FXQIFTODSA-N Ser-Arg-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(O)=O QEDMOZUJTGEIBF-FXQIFTODSA-N 0.000 description 23
- 108010069020 alanyl-prolyl-glycine Proteins 0.000 description 23
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 23
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 22
- BUDNAJYVCUHLSV-ZLUOBGJFSA-N Ala-Asp-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O BUDNAJYVCUHLSV-ZLUOBGJFSA-N 0.000 description 22
- AWNAEZICPNGAJK-FXQIFTODSA-N Ala-Met-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(O)=O AWNAEZICPNGAJK-FXQIFTODSA-N 0.000 description 22
- VKKYFICVTYKFIO-CIUDSAMLSA-N Arg-Ala-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCN=C(N)N VKKYFICVTYKFIO-CIUDSAMLSA-N 0.000 description 22
- MKJBPDLENBUHQU-CIUDSAMLSA-N Asn-Ser-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O MKJBPDLENBUHQU-CIUDSAMLSA-N 0.000 description 22
- UGXYFDQFLVCDFC-CIUDSAMLSA-N Asn-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O UGXYFDQFLVCDFC-CIUDSAMLSA-N 0.000 description 22
- JBDLMLZNDRLDIX-HJGDQZAQSA-N Asn-Thr-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O JBDLMLZNDRLDIX-HJGDQZAQSA-N 0.000 description 22
- FQCILXROGNOZON-YUMQZZPRSA-N Gln-Pro-Gly Chemical compound NC(=O)CC[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O FQCILXROGNOZON-YUMQZZPRSA-N 0.000 description 22
- MIIVFRCYJABHTQ-ONGXEEELSA-N Gly-Leu-Val Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O MIIVFRCYJABHTQ-ONGXEEELSA-N 0.000 description 22
- WNZOCXUOGVYYBJ-CDMKHQONSA-N Gly-Phe-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)CN)O WNZOCXUOGVYYBJ-CDMKHQONSA-N 0.000 description 22
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 22
- AXZGZMGRBDQTEY-SRVKXCTJSA-N Leu-Gln-Met Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(O)=O AXZGZMGRBDQTEY-SRVKXCTJSA-N 0.000 description 22
- FEHQLKKBVJHSEC-SZMVWBNQSA-N Leu-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC(C)C)C(O)=O)=CNC2=C1 FEHQLKKBVJHSEC-SZMVWBNQSA-N 0.000 description 22
- QNBVTHNJGCOVFA-AVGNSLFASA-N Leu-Leu-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CCC(O)=O QNBVTHNJGCOVFA-AVGNSLFASA-N 0.000 description 22
- GQZMPWBZQALKJO-UWVGGRQHSA-N Lys-Gly-Arg Chemical compound [H]N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O GQZMPWBZQALKJO-UWVGGRQHSA-N 0.000 description 22
- FGWUALWGCZJQDJ-URLPEUOOSA-N Phe-Thr-Ile Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O FGWUALWGCZJQDJ-URLPEUOOSA-N 0.000 description 22
- WTWGOQRNRFHFQD-JBDRJPRFSA-N Ser-Ala-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O WTWGOQRNRFHFQD-JBDRJPRFSA-N 0.000 description 22
- UIGMAMGZOJVTDN-WHFBIAKZSA-N Ser-Gly-Ser Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O UIGMAMGZOJVTDN-WHFBIAKZSA-N 0.000 description 22
- 108010008685 alanyl-glutamyl-aspartic acid Proteins 0.000 description 22
- 108010008355 arginyl-glutamine Proteins 0.000 description 22
- 108010020755 prolyl-glycyl-glycine Proteins 0.000 description 22
- 108010078144 glutaminyl-glycine Proteins 0.000 description 21
- 108010035534 tyrosyl-leucyl-alanine Proteins 0.000 description 21
- 241001515965 unidentified phage Species 0.000 description 21
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 20
- 108010089804 glycyl-threonine Proteins 0.000 description 20
- 235000018102 proteins Nutrition 0.000 description 20
- 108010068380 arginylarginine Proteins 0.000 description 19
- 239000000203 mixture Substances 0.000 description 19
- 108010083476 phenylalanyltryptophan Proteins 0.000 description 19
- 108010070643 prolylglutamic acid Proteins 0.000 description 19
- 239000013598 vector Substances 0.000 description 19
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 18
- 241000700159 Rattus Species 0.000 description 18
- 235000001014 amino acid Nutrition 0.000 description 18
- YWAQATDNEKZFFK-BYPYZUCNSA-N Gly-Gly-Ser Chemical compound NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O YWAQATDNEKZFFK-BYPYZUCNSA-N 0.000 description 17
- XOWMDXHFSBCAKQ-SRVKXCTJSA-N Leu-Ser-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC(C)C XOWMDXHFSBCAKQ-SRVKXCTJSA-N 0.000 description 17
- RHAPJNVNWDBFQI-BQBZGAKWSA-N Ser-Pro-Gly Chemical compound OC[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O RHAPJNVNWDBFQI-BQBZGAKWSA-N 0.000 description 17
- 108010081404 acein-2 Proteins 0.000 description 17
- 230000031146 intracellular signal transduction Effects 0.000 description 17
- ZDILXFDENZVOTL-BPNCWPANSA-N Ala-Val-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ZDILXFDENZVOTL-BPNCWPANSA-N 0.000 description 16
- IASNWHAGGYTEKX-IUCAKERBSA-N Arg-Arg-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(O)=O IASNWHAGGYTEKX-IUCAKERBSA-N 0.000 description 16
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 16
- 206010035226 Plasma cell myeloma Diseases 0.000 description 16
- QOIKZODVIPOPDD-AVGNSLFASA-N Tyr-Cys-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(O)=O QOIKZODVIPOPDD-AVGNSLFASA-N 0.000 description 16
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 16
- 108010050848 glycylleucine Proteins 0.000 description 16
- OTOXOKCIIQLMFH-KZVJFYERSA-N Arg-Ala-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCN=C(N)N OTOXOKCIIQLMFH-KZVJFYERSA-N 0.000 description 15
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 15
- YOOAQCZYZHGUAZ-KATARQTJSA-N Thr-Leu-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YOOAQCZYZHGUAZ-KATARQTJSA-N 0.000 description 15
- 150000001413 amino acids Chemical class 0.000 description 15
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 15
- 108090000790 Enzymes Proteins 0.000 description 14
- 102000004190 Enzymes Human genes 0.000 description 14
- BYYNJRSNDARRBX-YFKPBYRVSA-N Gly-Gln-Gly Chemical compound NCC(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O BYYNJRSNDARRBX-YFKPBYRVSA-N 0.000 description 14
- IBMVEYRWAWIOTN-UHFFFAOYSA-N L-Leucyl-L-Arginyl-L-Proline Natural products CC(C)CC(N)C(=O)NC(CCCN=C(N)N)C(=O)N1CCCC1C(O)=O IBMVEYRWAWIOTN-UHFFFAOYSA-N 0.000 description 14
- MCIXMYKSPQUMJG-SRVKXCTJSA-N Phe-Ser-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O MCIXMYKSPQUMJG-SRVKXCTJSA-N 0.000 description 14
- WTMPKZWHRCMMMT-KZVJFYERSA-N Thr-Pro-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O WTMPKZWHRCMMMT-KZVJFYERSA-N 0.000 description 14
- YOPQYBJJNSIQGZ-JNPHEJMOSA-N Thr-Tyr-Tyr Chemical compound C([C@H](NC(=O)[C@@H](N)[C@H](O)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 YOPQYBJJNSIQGZ-JNPHEJMOSA-N 0.000 description 14
- 229940024606 amino acid Drugs 0.000 description 14
- 108010029539 arginyl-prolyl-proline Proteins 0.000 description 14
- 108010060035 arginylproline Proteins 0.000 description 14
- 108010017391 lysylvaline Proteins 0.000 description 14
- 239000006228 supernatant Substances 0.000 description 14
- 238000002965 ELISA Methods 0.000 description 13
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 13
- JLMZKEQFMVORMA-SRVKXCTJSA-N Pro-Pro-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 JLMZKEQFMVORMA-SRVKXCTJSA-N 0.000 description 13
- 108010076504 Protein Sorting Signals Proteins 0.000 description 13
- SVGAWGVHFIYAEE-JSGCOSHPSA-N Trp-Gly-Gln Chemical compound C1=CC=C2C(C[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O)=CNC2=C1 SVGAWGVHFIYAEE-JSGCOSHPSA-N 0.000 description 13
- GULIUBBXCYPDJU-CQDKDKBSSA-N Tyr-Leu-Ala Chemical compound [O-]C(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]([NH3+])CC1=CC=C(O)C=C1 GULIUBBXCYPDJU-CQDKDKBSSA-N 0.000 description 13
- PZTZYZUTCPZWJH-FXQIFTODSA-N Val-Ser-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PZTZYZUTCPZWJH-FXQIFTODSA-N 0.000 description 13
- 108010076324 alanyl-glycyl-glycine Proteins 0.000 description 13
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 13
- 108010073472 leucyl-prolyl-proline Proteins 0.000 description 13
- 108010061238 threonyl-glycine Proteins 0.000 description 13
- HKZAAJSTFUZYTO-LURJTMIESA-N (2s)-2-[[2-[[2-[[2-[(2-aminoacetyl)amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoic acid Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O HKZAAJSTFUZYTO-LURJTMIESA-N 0.000 description 12
- MDNAVFBZPROEHO-DCAQKATOSA-N Ala-Lys-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O MDNAVFBZPROEHO-DCAQKATOSA-N 0.000 description 12
- MDNAVFBZPROEHO-UHFFFAOYSA-N Ala-Lys-Val Natural products CC(C)C(C(O)=O)NC(=O)C(NC(=O)C(C)N)CCCCN MDNAVFBZPROEHO-UHFFFAOYSA-N 0.000 description 12
- YFHATWYGAAXQCF-JYJNAYRXSA-N Arg-Pro-Phe Chemical compound NC(N)=NCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 YFHATWYGAAXQCF-JYJNAYRXSA-N 0.000 description 12
- GYWQGGUCMDCUJE-DLOVCJGASA-N Asp-Phe-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(O)=O GYWQGGUCMDCUJE-DLOVCJGASA-N 0.000 description 12
- USNJAPJZSGTTPX-XVSYOHENSA-N Asp-Phe-Thr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O USNJAPJZSGTTPX-XVSYOHENSA-N 0.000 description 12
- SZQCDCKIGWQAQN-FXQIFTODSA-N Cys-Arg-Ala Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O SZQCDCKIGWQAQN-FXQIFTODSA-N 0.000 description 12
- XZLLTYBONVKGLO-SDDRHHMPSA-N Gln-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)N)N)C(=O)O XZLLTYBONVKGLO-SDDRHHMPSA-N 0.000 description 12
- AVZHGSCDKIQZPQ-CIUDSAMLSA-N Glu-Arg-Ala Chemical compound C[C@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CCC(O)=O)C(O)=O AVZHGSCDKIQZPQ-CIUDSAMLSA-N 0.000 description 12
- XHVONGZZVUUORG-WEDXCCLWSA-N Gly-Thr-Lys Chemical compound NCC(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CCCCN XHVONGZZVUUORG-WEDXCCLWSA-N 0.000 description 12
- PRTZQMBYUZFSFA-XEGUGMAKSA-N Ile-Tyr-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)NCC(=O)O)N PRTZQMBYUZFSFA-XEGUGMAKSA-N 0.000 description 12
- QESXLSQLQHHTIX-RHYQMDGZSA-N Leu-Val-Thr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QESXLSQLQHHTIX-RHYQMDGZSA-N 0.000 description 12
- WUGMRIBZSVSJNP-UHFFFAOYSA-N N-L-alanyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)C(N)C)C(O)=O)=CNC2=C1 WUGMRIBZSVSJNP-UHFFFAOYSA-N 0.000 description 12
- 108010079364 N-glycylalanine Proteins 0.000 description 12
- CUMXHKAOHNWRFQ-BZSNNMDCSA-N Phe-Asp-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 CUMXHKAOHNWRFQ-BZSNNMDCSA-N 0.000 description 12
- YYKZDTVQHTUKDW-RYUDHWBXSA-N Phe-Gly-Gln Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)NCC(=O)N[C@@H](CCC(=O)N)C(=O)O)N YYKZDTVQHTUKDW-RYUDHWBXSA-N 0.000 description 12
- MGDFPGCFVJFITQ-CIUDSAMLSA-N Pro-Glu-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O MGDFPGCFVJFITQ-CIUDSAMLSA-N 0.000 description 12
- SFTZWNJFZYOLBD-ZDLURKLDSA-N Ser-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CO SFTZWNJFZYOLBD-ZDLURKLDSA-N 0.000 description 12
- KZSYAEWQMJEGRZ-RHYQMDGZSA-N Thr-Leu-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O KZSYAEWQMJEGRZ-RHYQMDGZSA-N 0.000 description 12
- MNYNCKZAEIAONY-XGEHTFHBSA-N Thr-Val-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O MNYNCKZAEIAONY-XGEHTFHBSA-N 0.000 description 12
- OGXQLUCMJZSJPW-LYSGOOTNSA-N Trp-Gly-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CC1=CNC2=CC=CC=C21)N)O OGXQLUCMJZSJPW-LYSGOOTNSA-N 0.000 description 12
- PKZIWSHDJYIPRH-JBACZVJFSA-N Trp-Tyr-Gln Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O PKZIWSHDJYIPRH-JBACZVJFSA-N 0.000 description 12
- 238000001514 detection method Methods 0.000 description 12
- 108010015792 glycyllysine Proteins 0.000 description 12
- 108010051242 phenylalanylserine Proteins 0.000 description 12
- YYAVDNKUWLAFCV-ACZMJKKPSA-N Ala-Ser-Gln Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O YYAVDNKUWLAFCV-ACZMJKKPSA-N 0.000 description 11
- NCQMBSJGJMYKCK-ZLUOBGJFSA-N Ala-Ser-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O NCQMBSJGJMYKCK-ZLUOBGJFSA-N 0.000 description 11
- BAYQNCWLXIDLHX-ONGXEEELSA-N Gly-Val-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)CN BAYQNCWLXIDLHX-ONGXEEELSA-N 0.000 description 11
- 208000034578 Multiple myelomas Diseases 0.000 description 11
- WDXYVIIVDIDOSX-DCAQKATOSA-N Ser-Arg-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)CCCN=C(N)N WDXYVIIVDIDOSX-DCAQKATOSA-N 0.000 description 11
- 108010047857 aspartylglycine Proteins 0.000 description 11
- 239000012636 effector Substances 0.000 description 11
- 108010050475 glycyl-leucyl-tyrosine Proteins 0.000 description 11
- 230000004048 modification Effects 0.000 description 11
- 238000012986 modification Methods 0.000 description 11
- 108010000998 wheylin-2 peptide Proteins 0.000 description 11
- VCJCPARXDBEGNE-GUBZILKMSA-N Asn-Pro-Pro Chemical compound NC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 VCJCPARXDBEGNE-GUBZILKMSA-N 0.000 description 10
- HTSSXFASOUSJQG-IHPCNDPISA-N Asp-Tyr-Trp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O HTSSXFASOUSJQG-IHPCNDPISA-N 0.000 description 10
- OTQSTOXRUBVWAP-NRPADANISA-N Gln-Ser-Val Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O OTQSTOXRUBVWAP-NRPADANISA-N 0.000 description 10
- QXQDADBVIBLBHN-FHWLQOOXSA-N Gln-Tyr-Phe Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O QXQDADBVIBLBHN-FHWLQOOXSA-N 0.000 description 10
- BKMOHWJHXQLFEX-IRIUXVKKSA-N Glu-Tyr-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CCC(=O)O)N)O BKMOHWJHXQLFEX-IRIUXVKKSA-N 0.000 description 10
- DHDOADIPGZTAHT-YUMQZZPRSA-N Gly-Glu-Arg Chemical compound NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCN=C(N)N DHDOADIPGZTAHT-YUMQZZPRSA-N 0.000 description 10
- 108060003951 Immunoglobulin Proteins 0.000 description 10
- WUHBLPVELFTPQK-KKUMJFAQSA-N Leu-Tyr-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O WUHBLPVELFTPQK-KKUMJFAQSA-N 0.000 description 10
- 108010002311 N-glycylglutamic acid Proteins 0.000 description 10
- CGBYDGAJHSOGFQ-LPEHRKFASA-N Pro-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@@H]2CCCN2 CGBYDGAJHSOGFQ-LPEHRKFASA-N 0.000 description 10
- XQJCEKXQUJQNNK-ZLUOBGJFSA-N Ser-Ser-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O XQJCEKXQUJQNNK-ZLUOBGJFSA-N 0.000 description 10
- FQPDRTDDEZXCEC-SVSWQMSJSA-N Thr-Ile-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O FQPDRTDDEZXCEC-SVSWQMSJSA-N 0.000 description 10
- PEVVXUGSAKEPEN-AVGNSLFASA-N Tyr-Asn-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O PEVVXUGSAKEPEN-AVGNSLFASA-N 0.000 description 10
- 108020001507 fusion proteins Proteins 0.000 description 10
- 102000037865 fusion proteins Human genes 0.000 description 10
- 108010006664 gamma-glutamyl-glycyl-glycine Proteins 0.000 description 10
- 102000018358 immunoglobulin Human genes 0.000 description 10
- 108010003700 lysyl aspartic acid Proteins 0.000 description 10
- 108010026333 seryl-proline Proteins 0.000 description 10
- 108010038745 tryptophylglycine Proteins 0.000 description 10
- YEELWQSXYBJVSV-UWJYBYFXSA-N Ala-Cys-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O YEELWQSXYBJVSV-UWJYBYFXSA-N 0.000 description 9
- OTZMRMHZCMZOJZ-SRVKXCTJSA-N Arg-Leu-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O OTZMRMHZCMZOJZ-SRVKXCTJSA-N 0.000 description 9
- JEXPNDORFYHJTM-IHRRRGAJSA-N Arg-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCCN=C(N)N JEXPNDORFYHJTM-IHRRRGAJSA-N 0.000 description 9
- AOHKLEBWKMKITA-IHRRRGAJSA-N Arg-Phe-Ser Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N AOHKLEBWKMKITA-IHRRRGAJSA-N 0.000 description 9
- XTZDZAXYPDISRR-MNXVOIDGSA-N Glu-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N XTZDZAXYPDISRR-MNXVOIDGSA-N 0.000 description 9
- FGPLUIQCSKGLTI-WDSKDSINSA-N Gly-Ser-Glu Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O FGPLUIQCSKGLTI-WDSKDSINSA-N 0.000 description 9
- OWSWUWDMSNXTNE-GMOBBJLQSA-N Ile-Pro-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)O)N OWSWUWDMSNXTNE-GMOBBJLQSA-N 0.000 description 9
- UYODHPPSCXBNCS-XUXIUFHCSA-N Ile-Val-Leu Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC(C)C UYODHPPSCXBNCS-XUXIUFHCSA-N 0.000 description 9
- KYIIALJHAOIAHF-KKUMJFAQSA-N Leu-Leu-His Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 KYIIALJHAOIAHF-KKUMJFAQSA-N 0.000 description 9
- AFXCXDQNRXTSBD-FJXKBIBVSA-N Pro-Gly-Thr Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O AFXCXDQNRXTSBD-FJXKBIBVSA-N 0.000 description 9
- NNFMANHDYSVNIO-DCAQKATOSA-N Ser-Lys-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O NNFMANHDYSVNIO-DCAQKATOSA-N 0.000 description 9
- LIXBDERDAGNVAV-XKBZYTNZSA-N Thr-Gln-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O LIXBDERDAGNVAV-XKBZYTNZSA-N 0.000 description 9
- AEFJNECXZCODJM-UWVGGRQHSA-N Val-Val-Gly Chemical compound CC(C)[C@H]([NH3+])C(=O)N[C@@H](C(C)C)C(=O)NCC([O-])=O AEFJNECXZCODJM-UWVGGRQHSA-N 0.000 description 9
- 125000000539 amino acid group Chemical group 0.000 description 9
- 238000010276 construction Methods 0.000 description 9
- 230000003013 cytotoxicity Effects 0.000 description 9
- 231100000135 cytotoxicity Toxicity 0.000 description 9
- 230000004927 fusion Effects 0.000 description 9
- 108010078326 glycyl-glycyl-valine Proteins 0.000 description 9
- 238000000338 in vitro Methods 0.000 description 9
- MFAMTAVAFBPXDC-LPEHRKFASA-N Arg-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O MFAMTAVAFBPXDC-LPEHRKFASA-N 0.000 description 8
- HQIZDMIGUJOSNI-IUCAKERBSA-N Arg-Gly-Arg Chemical compound N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O HQIZDMIGUJOSNI-IUCAKERBSA-N 0.000 description 8
- YCYXHLZRUSJITQ-SRVKXCTJSA-N Arg-Pro-Pro Chemical compound NC(=N)NCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 YCYXHLZRUSJITQ-SRVKXCTJSA-N 0.000 description 8
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 8
- AFWYPMDMDYCKMD-KBPBESRZSA-N Gly-Leu-Tyr Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 AFWYPMDMDYCKMD-KBPBESRZSA-N 0.000 description 8
- 101000801255 Homo sapiens Tumor necrosis factor receptor superfamily member 17 Proteins 0.000 description 8
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 8
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 8
- 102000014150 Interferons Human genes 0.000 description 8
- 108010050904 Interferons Proteins 0.000 description 8
- MYGQXVYRZMKRDB-SRVKXCTJSA-N Leu-Asp-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN MYGQXVYRZMKRDB-SRVKXCTJSA-N 0.000 description 8
- SBANPBVRHYIMRR-GARJFASQSA-N Leu-Ser-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@@H]1C(=O)O)N SBANPBVRHYIMRR-GARJFASQSA-N 0.000 description 8
- 229920002873 Polyethylenimine Polymers 0.000 description 8
- DZZCICYRSZASNF-FXQIFTODSA-N Pro-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1 DZZCICYRSZASNF-FXQIFTODSA-N 0.000 description 8
- LNLNHXIQPGKRJQ-SRVKXCTJSA-N Pro-Arg-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H]1CCCN1 LNLNHXIQPGKRJQ-SRVKXCTJSA-N 0.000 description 8
- CHYAYDLYYIJCKY-OSUNSFLBSA-N Pro-Thr-Ile Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O CHYAYDLYYIJCKY-OSUNSFLBSA-N 0.000 description 8
- BLPYXIXXCFVIIF-FXQIFTODSA-N Ser-Cys-Arg Chemical compound C(C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CO)N)CN=C(N)N BLPYXIXXCFVIIF-FXQIFTODSA-N 0.000 description 8
- BRGQQXQKPUCUJQ-KBIXCLLPSA-N Ser-Glu-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O BRGQQXQKPUCUJQ-KBIXCLLPSA-N 0.000 description 8
- MEBDIIKMUUNBSB-RPTUDFQQSA-N Thr-Phe-Tyr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O MEBDIIKMUUNBSB-RPTUDFQQSA-N 0.000 description 8
- HTONZBWRYUKUKC-RCWTZXSCSA-N Val-Thr-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O HTONZBWRYUKUKC-RCWTZXSCSA-N 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 8
- 108010010147 glycylglutamine Proteins 0.000 description 8
- 102000046935 human TNFRSF17 Human genes 0.000 description 8
- 239000002609 medium Substances 0.000 description 8
- 108090000765 processed proteins & peptides Proteins 0.000 description 8
- 230000011664 signaling Effects 0.000 description 8
- DPNZTBKGAUAZQU-DLOVCJGASA-N Ala-Leu-His Chemical compound C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N DPNZTBKGAUAZQU-DLOVCJGASA-N 0.000 description 7
- WOZDCBHUGJVJPL-AVGNSLFASA-N Arg-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N WOZDCBHUGJVJPL-AVGNSLFASA-N 0.000 description 7
- JREOBWLIZLXRIS-GUBZILKMSA-N Asn-Glu-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O JREOBWLIZLXRIS-GUBZILKMSA-N 0.000 description 7
- MRQQMVZUHXUPEV-IHRRRGAJSA-N Asp-Arg-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O MRQQMVZUHXUPEV-IHRRRGAJSA-N 0.000 description 7
- 102100027286 Fanconi anemia group C protein Human genes 0.000 description 7
- INGJLBQKTRJLFO-UKJIMTQDSA-N Glu-Ile-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCC(O)=O INGJLBQKTRJLFO-UKJIMTQDSA-N 0.000 description 7
- QMOSCLNJVKSHHU-YUMQZZPRSA-N Glu-Met-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)NCC(O)=O QMOSCLNJVKSHHU-YUMQZZPRSA-N 0.000 description 7
- CCQOOWAONKGYKQ-BYPYZUCNSA-N Gly-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)CN CCQOOWAONKGYKQ-BYPYZUCNSA-N 0.000 description 7
- DMSVBUWGDLYNLC-IAVJCBSLSA-N Ile-Ile-Phe Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 DMSVBUWGDLYNLC-IAVJCBSLSA-N 0.000 description 7
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 7
- JKGHDYGZRDWHGA-SRVKXCTJSA-N Leu-Asn-Leu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O JKGHDYGZRDWHGA-SRVKXCTJSA-N 0.000 description 7
- LCNASHSOFMRYFO-WDCWCFNPSA-N Leu-Thr-Gln Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(N)=O LCNASHSOFMRYFO-WDCWCFNPSA-N 0.000 description 7
- VCYJKOLZYPYGJV-AVGNSLFASA-N Pro-Arg-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(O)=O VCYJKOLZYPYGJV-AVGNSLFASA-N 0.000 description 7
- XJDMUQCLVSCRSJ-VZFHVOOUSA-N Ser-Thr-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O XJDMUQCLVSCRSJ-VZFHVOOUSA-N 0.000 description 7
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 7
- ZSPQUTWLWGWTPS-HJGDQZAQSA-N Thr-Lys-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O ZSPQUTWLWGWTPS-HJGDQZAQSA-N 0.000 description 7
- COYHRQWNJDJCNA-NUJDXYNKSA-N Thr-Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O COYHRQWNJDJCNA-NUJDXYNKSA-N 0.000 description 7
- QUILOGWWLXMSAT-IHRRRGAJSA-N Tyr-Gln-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O QUILOGWWLXMSAT-IHRRRGAJSA-N 0.000 description 7
- JFAWZADYPRMRCO-UBHSHLNASA-N Val-Ala-Phe Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 JFAWZADYPRMRCO-UBHSHLNASA-N 0.000 description 7
- SYSWVVCYSXBVJG-RHYQMDGZSA-N Val-Leu-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C(C)C)N)O SYSWVVCYSXBVJG-RHYQMDGZSA-N 0.000 description 7
- 108010062796 arginyllysine Proteins 0.000 description 7
- 108010049041 glutamylalanine Proteins 0.000 description 7
- 238000002347 injection Methods 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- 238000004806 packaging method and process Methods 0.000 description 7
- 229920001184 polypeptide Polymers 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 102000004196 processed proteins & peptides Human genes 0.000 description 7
- 230000009466 transformation Effects 0.000 description 7
- 108010073969 valyllysine Proteins 0.000 description 7
- VBDMWOKJZDCFJM-FXQIFTODSA-N Ala-Ala-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](C)N VBDMWOKJZDCFJM-FXQIFTODSA-N 0.000 description 6
- FUSPCLTUKXQREV-ACZMJKKPSA-N Ala-Glu-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(O)=O FUSPCLTUKXQREV-ACZMJKKPSA-N 0.000 description 6
- IPZQNYYAYVRKKK-FXQIFTODSA-N Ala-Pro-Ala Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O IPZQNYYAYVRKKK-FXQIFTODSA-N 0.000 description 6
- MTDDMSUUXNQMKK-BPNCWPANSA-N Ala-Tyr-Arg Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N MTDDMSUUXNQMKK-BPNCWPANSA-N 0.000 description 6
- OQCWXQJLCDPRHV-UWVGGRQHSA-N Arg-Gly-Leu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC(C)C)C(O)=O OQCWXQJLCDPRHV-UWVGGRQHSA-N 0.000 description 6
- ZPWMEWYQBWSGAO-ZJDVBMNYSA-N Arg-Thr-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O ZPWMEWYQBWSGAO-ZJDVBMNYSA-N 0.000 description 6
- QCVXMEHGFUMKCO-YUMQZZPRSA-N Asp-Gly-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC(O)=O QCVXMEHGFUMKCO-YUMQZZPRSA-N 0.000 description 6
- FQHBAQLBIXLWAG-DCAQKATOSA-N Asp-Lys-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)N FQHBAQLBIXLWAG-DCAQKATOSA-N 0.000 description 6
- AHWRSSLYSGLBGD-CIUDSAMLSA-N Asp-Pro-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O AHWRSSLYSGLBGD-CIUDSAMLSA-N 0.000 description 6
- KCJJFESQRXGTGC-BQBZGAKWSA-N Gln-Glu-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O KCJJFESQRXGTGC-BQBZGAKWSA-N 0.000 description 6
- UTKICHUQEQBDGC-ACZMJKKPSA-N Glu-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N UTKICHUQEQBDGC-ACZMJKKPSA-N 0.000 description 6
- BUZMZDDKFCSKOT-CIUDSAMLSA-N Glu-Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O BUZMZDDKFCSKOT-CIUDSAMLSA-N 0.000 description 6
- BUAKRRKDHSSIKK-IHRRRGAJSA-N Glu-Glu-Tyr Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 BUAKRRKDHSSIKK-IHRRRGAJSA-N 0.000 description 6
- WDEHMRNSGHVNOH-VHSXEESVSA-N Gly-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)CN)C(=O)O WDEHMRNSGHVNOH-VHSXEESVSA-N 0.000 description 6
- 239000004471 Glycine Substances 0.000 description 6
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 6
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 6
- XIRYQRLFHWWWTC-QEJZJMRPSA-N Leu-Ala-Phe Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 XIRYQRLFHWWWTC-QEJZJMRPSA-N 0.000 description 6
- IBMVEYRWAWIOTN-RWMBFGLXSA-N Leu-Arg-Pro Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@@H]1C(O)=O IBMVEYRWAWIOTN-RWMBFGLXSA-N 0.000 description 6
- NCTDKZKNBDZDOL-GARJFASQSA-N Lys-Asn-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)N)NC(=O)[C@H](CCCCN)N)C(=O)O NCTDKZKNBDZDOL-GARJFASQSA-N 0.000 description 6
- UETQMSASAVBGJY-QWRGUYRKSA-N Lys-Gly-His Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CNC=N1 UETQMSASAVBGJY-QWRGUYRKSA-N 0.000 description 6
- WEDZFLRYSIDIRX-IHRRRGAJSA-N Phe-Ser-Arg Chemical compound NC(=N)NCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=CC=C1 WEDZFLRYSIDIRX-IHRRRGAJSA-N 0.000 description 6
- ICTZKEXYDDZZFP-SRVKXCTJSA-N Pro-Arg-Pro Chemical compound N([C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(O)=O)C(=O)[C@@H]1CCCN1 ICTZKEXYDDZZFP-SRVKXCTJSA-N 0.000 description 6
- FKYKZHOKDOPHSA-DCAQKATOSA-N Pro-Leu-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O FKYKZHOKDOPHSA-DCAQKATOSA-N 0.000 description 6
- AIOWVDNPESPXRB-YTWAJWBKSA-N Pro-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@@H]2CCCN2)O AIOWVDNPESPXRB-YTWAJWBKSA-N 0.000 description 6
- LVVBAKCGXXUHFO-ZLUOBGJFSA-N Ser-Ala-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O LVVBAKCGXXUHFO-ZLUOBGJFSA-N 0.000 description 6
- GXXTUIUYTWGPMV-FXQIFTODSA-N Ser-Arg-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O GXXTUIUYTWGPMV-FXQIFTODSA-N 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- BZTSQFWJNJYZSX-JRQIVUDYSA-N Thr-Tyr-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O BZTSQFWJNJYZSX-JRQIVUDYSA-N 0.000 description 6
- NMKJPMCEKQHRPD-IRXDYDNUSA-N Tyr-Gly-Tyr Chemical compound C([C@H](N)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 NMKJPMCEKQHRPD-IRXDYDNUSA-N 0.000 description 6
- QFXVAFIHVWXXBJ-AVGNSLFASA-N Tyr-Ser-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O QFXVAFIHVWXXBJ-AVGNSLFASA-N 0.000 description 6
- ZIGZPYJXIWLQFC-QTKMDUPCSA-N Val-His-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](C(C)C)N)O ZIGZPYJXIWLQFC-QTKMDUPCSA-N 0.000 description 6
- 239000000872 buffer Substances 0.000 description 6
- 208000015181 infectious disease Diseases 0.000 description 6
- 229940079322 interferon Drugs 0.000 description 6
- 230000002147 killing effect Effects 0.000 description 6
- 108010076756 leucyl-alanyl-phenylalanine Proteins 0.000 description 6
- 238000005259 measurement Methods 0.000 description 6
- 108010077112 prolyl-proline Proteins 0.000 description 6
- 238000006467 substitution reaction Methods 0.000 description 6
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 6
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 5
- WJRXVTCKASUIFF-FXQIFTODSA-N Ala-Cys-Arg Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O WJRXVTCKASUIFF-FXQIFTODSA-N 0.000 description 5
- PMQXMXAASGFUDX-SRVKXCTJSA-N Ala-Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@H](C)N)CCCCN PMQXMXAASGFUDX-SRVKXCTJSA-N 0.000 description 5
- GIVATXIGCXFQQA-FXQIFTODSA-N Arg-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCN=C(N)N GIVATXIGCXFQQA-FXQIFTODSA-N 0.000 description 5
- DIIGDGJKTMLQQW-IHRRRGAJSA-N Arg-Lys-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCN=C(N)N)N DIIGDGJKTMLQQW-IHRRRGAJSA-N 0.000 description 5
- BTJVOUQWFXABOI-IHRRRGAJSA-N Arg-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCNC(N)=N BTJVOUQWFXABOI-IHRRRGAJSA-N 0.000 description 5
- XSPKAHFVDKRGRL-DCAQKATOSA-N Arg-Pro-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O XSPKAHFVDKRGRL-DCAQKATOSA-N 0.000 description 5
- QCTOLCVIGRLMQS-HRCADAONSA-N Arg-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O QCTOLCVIGRLMQS-HRCADAONSA-N 0.000 description 5
- WPOLSNAQGVHROR-GUBZILKMSA-N Asn-Gln-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC(=O)N)N WPOLSNAQGVHROR-GUBZILKMSA-N 0.000 description 5
- UZFHNLYQWMGUHU-DCAQKATOSA-N Asp-Lys-Arg Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O UZFHNLYQWMGUHU-DCAQKATOSA-N 0.000 description 5
- GIKOVDMXBAFXDF-NHCYSSNCSA-N Asp-Val-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O GIKOVDMXBAFXDF-NHCYSSNCSA-N 0.000 description 5
- 241000282693 Cercopithecidae Species 0.000 description 5
- 108091007741 Chimeric antigen receptor T cells Proteins 0.000 description 5
- KABHAOSDMIYXTR-GUBZILKMSA-N Cys-Glu-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)N KABHAOSDMIYXTR-GUBZILKMSA-N 0.000 description 5
- KVYVOGYEMPEXBT-GUBZILKMSA-N Gln-Ala-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O KVYVOGYEMPEXBT-GUBZILKMSA-N 0.000 description 5
- TWHDOEYLXXQYOZ-FXQIFTODSA-N Gln-Asn-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N TWHDOEYLXXQYOZ-FXQIFTODSA-N 0.000 description 5
- MADFVRSKEIEZHZ-DCAQKATOSA-N Gln-Gln-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)N)N MADFVRSKEIEZHZ-DCAQKATOSA-N 0.000 description 5
- FGYPOQPQTUNESW-IUCAKERBSA-N Gln-Gly-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CCC(=O)N)N FGYPOQPQTUNESW-IUCAKERBSA-N 0.000 description 5
- SYZZMPFLOLSMHL-XHNCKOQMSA-N Gln-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)N)N)C(=O)O SYZZMPFLOLSMHL-XHNCKOQMSA-N 0.000 description 5
- NKLRYVLERDYDBI-FXQIFTODSA-N Glu-Glu-Asp Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O NKLRYVLERDYDBI-FXQIFTODSA-N 0.000 description 5
- VMKCPNBBPGGQBJ-GUBZILKMSA-N Glu-Leu-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)O)N VMKCPNBBPGGQBJ-GUBZILKMSA-N 0.000 description 5
- LJPIRKICOISLKN-WHFBIAKZSA-N Gly-Ala-Ser Chemical compound NCC(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O LJPIRKICOISLKN-WHFBIAKZSA-N 0.000 description 5
- KMSGYZQRXPUKGI-BYPYZUCNSA-N Gly-Gly-Asn Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC(N)=O KMSGYZQRXPUKGI-BYPYZUCNSA-N 0.000 description 5
- YTSVAIMKVLZUDU-YUMQZZPRSA-N Gly-Leu-Asp Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O YTSVAIMKVLZUDU-YUMQZZPRSA-N 0.000 description 5
- NNCSJUBVFBDDLC-YUMQZZPRSA-N Gly-Leu-Ser Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O NNCSJUBVFBDDLC-YUMQZZPRSA-N 0.000 description 5
- ZWRDOVYMQAAISL-UWVGGRQHSA-N Gly-Met-Lys Chemical compound CSCC[C@H](NC(=O)CN)C(=O)N[C@H](C(O)=O)CCCCN ZWRDOVYMQAAISL-UWVGGRQHSA-N 0.000 description 5
- GLACUWHUYFBSPJ-FJXKBIBVSA-N Gly-Pro-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)CN GLACUWHUYFBSPJ-FJXKBIBVSA-N 0.000 description 5
- FCPSGEVYIVXPPO-QTKMDUPCSA-N His-Thr-Arg Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FCPSGEVYIVXPPO-QTKMDUPCSA-N 0.000 description 5
- 241001272567 Hominoidea Species 0.000 description 5
- 108010065920 Insulin Lispro Proteins 0.000 description 5
- 241000713666 Lentivirus Species 0.000 description 5
- FQZPTCNSNPWHLJ-AVGNSLFASA-N Leu-Gln-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(O)=O FQZPTCNSNPWHLJ-AVGNSLFASA-N 0.000 description 5
- BABSVXFGKFLIGW-UWVGGRQHSA-N Leu-Gly-Arg Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCNC(N)=N BABSVXFGKFLIGW-UWVGGRQHSA-N 0.000 description 5
- GAOJCVKPIGHTGO-UWVGGRQHSA-N Lys-Arg-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O GAOJCVKPIGHTGO-UWVGGRQHSA-N 0.000 description 5
- PDIDTSZKKFEDMB-UWVGGRQHSA-N Lys-Pro-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O PDIDTSZKKFEDMB-UWVGGRQHSA-N 0.000 description 5
- DBOMZJOESVYERT-GUBZILKMSA-N Met-Asn-Met Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCSC)C(=O)O)N DBOMZJOESVYERT-GUBZILKMSA-N 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 102000010292 Peptide Elongation Factor 1 Human genes 0.000 description 5
- 108010077524 Peptide Elongation Factor 1 Proteins 0.000 description 5
- MDHZEOMXGNBSIL-DLOVCJGASA-N Phe-Ala-Cys Chemical compound C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N MDHZEOMXGNBSIL-DLOVCJGASA-N 0.000 description 5
- JEGFCFLCRSJCMA-IHRRRGAJSA-N Phe-Arg-Ser Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)O)N JEGFCFLCRSJCMA-IHRRRGAJSA-N 0.000 description 5
- LCRSGSIRKLXZMZ-BPNCWPANSA-N Pro-Ala-Tyr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LCRSGSIRKLXZMZ-BPNCWPANSA-N 0.000 description 5
- SSSFPISOZOLQNP-GUBZILKMSA-N Pro-Arg-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(O)=O SSSFPISOZOLQNP-GUBZILKMSA-N 0.000 description 5
- JARJPEMLQAWNBR-GUBZILKMSA-N Pro-Asp-Arg Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O JARJPEMLQAWNBR-GUBZILKMSA-N 0.000 description 5
- 241000283984 Rodentia Species 0.000 description 5
- HEQPKICPPDOSIN-SRVKXCTJSA-N Ser-Asp-Tyr Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 HEQPKICPPDOSIN-SRVKXCTJSA-N 0.000 description 5
- MUARUIBTKQJKFY-WHFBIAKZSA-N Ser-Gly-Asp Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O MUARUIBTKQJKFY-WHFBIAKZSA-N 0.000 description 5
- YUJLIIRMIAGMCQ-CIUDSAMLSA-N Ser-Leu-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YUJLIIRMIAGMCQ-CIUDSAMLSA-N 0.000 description 5
- SRSPTFBENMJHMR-WHFBIAKZSA-N Ser-Ser-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SRSPTFBENMJHMR-WHFBIAKZSA-N 0.000 description 5
- OOEUVMFKKZYSRX-LEWSCRJBSA-N Tyr-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N OOEUVMFKKZYSRX-LEWSCRJBSA-N 0.000 description 5
- CKHQKYHIZCRTAP-SOUVJXGZSA-N Tyr-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC2=CC=C(C=C2)O)N)C(=O)O CKHQKYHIZCRTAP-SOUVJXGZSA-N 0.000 description 5
- DIOSYUIWOQCXNR-ONGXEEELSA-N Val-Lys-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O DIOSYUIWOQCXNR-ONGXEEELSA-N 0.000 description 5
- 238000004458 analytical method Methods 0.000 description 5
- 108010077245 asparaginyl-proline Proteins 0.000 description 5
- 108010068265 aspartyltyrosine Proteins 0.000 description 5
- 108010079547 glutamylmethionine Proteins 0.000 description 5
- 108010018006 histidylserine Proteins 0.000 description 5
- 108010078274 isoleucylvaline Proteins 0.000 description 5
- 108010057821 leucylproline Proteins 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 201000000050 myeloid neoplasm Diseases 0.000 description 5
- 108010079317 prolyl-tyrosine Proteins 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 230000004936 stimulating effect Effects 0.000 description 5
- 238000007920 subcutaneous administration Methods 0.000 description 5
- 108010044292 tryptophyltyrosine Proteins 0.000 description 5
- NHCPCLJZRSIDHS-ZLUOBGJFSA-N Ala-Asp-Ala Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O NHCPCLJZRSIDHS-ZLUOBGJFSA-N 0.000 description 4
- NJIFPLAJSVUQOZ-JBDRJPRFSA-N Ala-Cys-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](C)N NJIFPLAJSVUQOZ-JBDRJPRFSA-N 0.000 description 4
- OYJCVIGKMXUVKB-GARJFASQSA-N Ala-Leu-Pro Chemical compound C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@@H]1C(=O)O)N OYJCVIGKMXUVKB-GARJFASQSA-N 0.000 description 4
- MAZZQZWCCYJQGZ-GUBZILKMSA-N Ala-Pro-Arg Chemical compound [H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O MAZZQZWCCYJQGZ-GUBZILKMSA-N 0.000 description 4
- WNHNMKOFKCHKKD-BFHQHQDPSA-N Ala-Thr-Gly Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O WNHNMKOFKCHKKD-BFHQHQDPSA-N 0.000 description 4
- IOFVWPYSRSCWHI-JXUBOQSCSA-N Ala-Thr-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C)N IOFVWPYSRSCWHI-JXUBOQSCSA-N 0.000 description 4
- QDGMZAOSMNGBLP-MRFFXTKBSA-N Ala-Trp-Tyr Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)N QDGMZAOSMNGBLP-MRFFXTKBSA-N 0.000 description 4
- QRIYOHQJRDHFKF-UWJYBYFXSA-N Ala-Tyr-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CC=C(O)C=C1 QRIYOHQJRDHFKF-UWJYBYFXSA-N 0.000 description 4
- UXJCMQFPDWCHKX-DCAQKATOSA-N Arg-Arg-Glu Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(O)=O)C(O)=O UXJCMQFPDWCHKX-DCAQKATOSA-N 0.000 description 4
- SSZGOKWBHLOCHK-DCAQKATOSA-N Arg-Lys-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCN=C(N)N SSZGOKWBHLOCHK-DCAQKATOSA-N 0.000 description 4
- LXMKTIZAGIBQRX-HRCADAONSA-N Arg-Phe-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=CC=C2)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O LXMKTIZAGIBQRX-HRCADAONSA-N 0.000 description 4
- VUGWHBXPMAHEGZ-SRVKXCTJSA-N Arg-Pro-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CCCN=C(N)N VUGWHBXPMAHEGZ-SRVKXCTJSA-N 0.000 description 4
- KXOPYFNQLVUOAQ-FXQIFTODSA-N Arg-Ser-Ala Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O KXOPYFNQLVUOAQ-FXQIFTODSA-N 0.000 description 4
- BFDDUDQCPJWQRQ-IHRRRGAJSA-N Arg-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)O BFDDUDQCPJWQRQ-IHRRRGAJSA-N 0.000 description 4
- XWGJDUSDTRPQRK-ZLUOBGJFSA-N Asn-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(N)=O XWGJDUSDTRPQRK-ZLUOBGJFSA-N 0.000 description 4
- VITDJIPIJZAVGC-VEVYYDQMSA-N Asn-Met-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VITDJIPIJZAVGC-VEVYYDQMSA-N 0.000 description 4
- XMHFCUKJRCQXGI-CIUDSAMLSA-N Asn-Pro-Gln Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CC(=O)N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O XMHFCUKJRCQXGI-CIUDSAMLSA-N 0.000 description 4
- PBVLJOIPOGUQQP-CIUDSAMLSA-N Asp-Ala-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O PBVLJOIPOGUQQP-CIUDSAMLSA-N 0.000 description 4
- XPGVTUBABLRGHY-BIIVOSGPSA-N Asp-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC(=O)O)N XPGVTUBABLRGHY-BIIVOSGPSA-N 0.000 description 4
- KOWYNSKRPUWSFG-IHPCNDPISA-N Asp-Phe-Trp Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)O)NC(=O)[C@H](CC(=O)O)N KOWYNSKRPUWSFG-IHPCNDPISA-N 0.000 description 4
- JDDYEZGPYBBPBN-JRQIVUDYSA-N Asp-Thr-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JDDYEZGPYBBPBN-JRQIVUDYSA-N 0.000 description 4
- WOKXEQLPBLLWHC-IHRRRGAJSA-N Asp-Tyr-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 WOKXEQLPBLLWHC-IHRRRGAJSA-N 0.000 description 4
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 4
- BPHKULHWEIUDOB-FXQIFTODSA-N Cys-Gln-Gln Chemical compound SC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O BPHKULHWEIUDOB-FXQIFTODSA-N 0.000 description 4
- KWUSGAIFNHQCBY-DCAQKATOSA-N Gln-Arg-Arg Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O KWUSGAIFNHQCBY-DCAQKATOSA-N 0.000 description 4
- PHZYLYASFWHLHJ-FXQIFTODSA-N Gln-Asn-Glu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O PHZYLYASFWHLHJ-FXQIFTODSA-N 0.000 description 4
- MFLMFRZBAJSGHK-ACZMJKKPSA-N Gln-Cys-Ser Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)O)N MFLMFRZBAJSGHK-ACZMJKKPSA-N 0.000 description 4
- CLPQUWHBWXFJOX-BQBZGAKWSA-N Gln-Gly-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O CLPQUWHBWXFJOX-BQBZGAKWSA-N 0.000 description 4
- JXFLPKSDLDEOQK-JHEQGTHGSA-N Gln-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CCC(N)=O JXFLPKSDLDEOQK-JHEQGTHGSA-N 0.000 description 4
- STHSGOZLFLFGSS-SUSMZKCASA-N Gln-Thr-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O STHSGOZLFLFGSS-SUSMZKCASA-N 0.000 description 4
- KBKGRMNVKPSQIF-XDTLVQLUSA-N Glu-Ala-Tyr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O KBKGRMNVKPSQIF-XDTLVQLUSA-N 0.000 description 4
- PAQUJCSYVIBPLC-AVGNSLFASA-N Glu-Asp-Phe Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 PAQUJCSYVIBPLC-AVGNSLFASA-N 0.000 description 4
- SJPMNHCEWPTRBR-BQBZGAKWSA-N Glu-Glu-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O SJPMNHCEWPTRBR-BQBZGAKWSA-N 0.000 description 4
- OAGVHWYIBZMWLA-YFKPBYRVSA-N Glu-Gly-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)NCC(=O)NCC(O)=O OAGVHWYIBZMWLA-YFKPBYRVSA-N 0.000 description 4
- ITBHUUMCJJQUSC-LAEOZQHASA-N Glu-Ile-Gly Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(O)=O ITBHUUMCJJQUSC-LAEOZQHASA-N 0.000 description 4
- DNPCBMNFQVTHMA-DCAQKATOSA-N Glu-Leu-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O DNPCBMNFQVTHMA-DCAQKATOSA-N 0.000 description 4
- DXVOKNVIKORTHQ-GUBZILKMSA-N Glu-Pro-Glu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O DXVOKNVIKORTHQ-GUBZILKMSA-N 0.000 description 4
- HHSKZJZWQFPSKN-AVGNSLFASA-N Glu-Tyr-Asp Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O HHSKZJZWQFPSKN-AVGNSLFASA-N 0.000 description 4
- JRDYDYXZKFNNRQ-XPUUQOCRSA-N Gly-Ala-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN JRDYDYXZKFNNRQ-XPUUQOCRSA-N 0.000 description 4
- UPOJUWHGMDJUQZ-IUCAKERBSA-N Gly-Arg-Arg Chemical compound NC(=N)NCCC[C@H](NC(=O)CN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O UPOJUWHGMDJUQZ-IUCAKERBSA-N 0.000 description 4
- QITBQGJOXQYMOA-ZETCQYMHSA-N Gly-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)CN QITBQGJOXQYMOA-ZETCQYMHSA-N 0.000 description 4
- VAXIVIPMCTYSHI-YUMQZZPRSA-N Gly-His-Asp Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)CN VAXIVIPMCTYSHI-YUMQZZPRSA-N 0.000 description 4
- NVTPVQLIZCOJFK-FOHZUACHSA-N Gly-Thr-Asp Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O NVTPVQLIZCOJFK-FOHZUACHSA-N 0.000 description 4
- ZZWUYQXMIFTIIY-WEDXCCLWSA-N Gly-Thr-Leu Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O ZZWUYQXMIFTIIY-WEDXCCLWSA-N 0.000 description 4
- LYZYGGWCBLBDMC-QWHCGFSZSA-N Gly-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)CN)C(=O)O LYZYGGWCBLBDMC-QWHCGFSZSA-N 0.000 description 4
- LSQHWKPPOFDHHZ-YUMQZZPRSA-N His-Asp-Gly Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)O)N LSQHWKPPOFDHHZ-YUMQZZPRSA-N 0.000 description 4
- NKRWVZQTPXPNRZ-SRVKXCTJSA-N His-Met-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@@H](N)CC1=CN=CN1 NKRWVZQTPXPNRZ-SRVKXCTJSA-N 0.000 description 4
- LWWILHPVAKKLQS-QXEWZRGKSA-N Ile-Gly-Met Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)N[C@@H](CCSC)C(=O)O)N LWWILHPVAKKLQS-QXEWZRGKSA-N 0.000 description 4
- NZGTYCMLUGYMCV-XUXIUFHCSA-N Ile-Lys-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N NZGTYCMLUGYMCV-XUXIUFHCSA-N 0.000 description 4
- JHNJNTMTZHEDLJ-NAKRPEOUSA-N Ile-Ser-Arg Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O JHNJNTMTZHEDLJ-NAKRPEOUSA-N 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- HXWALXSAVBLTPK-NUTKFTJISA-N Leu-Ala-Trp Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC(C)C)N HXWALXSAVBLTPK-NUTKFTJISA-N 0.000 description 4
- CNNQBZRGQATKNY-DCAQKATOSA-N Leu-Arg-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CS)C(=O)O)N CNNQBZRGQATKNY-DCAQKATOSA-N 0.000 description 4
- OGUUKPXUTHOIAV-SDDRHHMPSA-N Leu-Glu-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N1CCC[C@@H]1C(=O)O)N OGUUKPXUTHOIAV-SDDRHHMPSA-N 0.000 description 4
- MPSBSKHOWJQHBS-IHRRRGAJSA-N Leu-His-Met Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CCSC)C(=O)O)N MPSBSKHOWJQHBS-IHRRRGAJSA-N 0.000 description 4
- OYQUOLRTJHWVSQ-SRVKXCTJSA-N Leu-His-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O OYQUOLRTJHWVSQ-SRVKXCTJSA-N 0.000 description 4
- NRFGTHFONZYFNY-MGHWNKPDSA-N Leu-Ile-Tyr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 NRFGTHFONZYFNY-MGHWNKPDSA-N 0.000 description 4
- FAELBUXXFQLUAX-AJNGGQMLSA-N Leu-Leu-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(C)C FAELBUXXFQLUAX-AJNGGQMLSA-N 0.000 description 4
- DPURXCQCHSQPAN-AVGNSLFASA-N Leu-Pro-Pro Chemical compound CC(C)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 DPURXCQCHSQPAN-AVGNSLFASA-N 0.000 description 4
- VHTIZYYHIUHMCA-JYJNAYRXSA-N Leu-Tyr-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O VHTIZYYHIUHMCA-JYJNAYRXSA-N 0.000 description 4
- LMVOVCYVZBBWQB-SRVKXCTJSA-N Lys-Asp-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN LMVOVCYVZBBWQB-SRVKXCTJSA-N 0.000 description 4
- KWUKZRFFKPLUPE-HJGDQZAQSA-N Lys-Asp-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O KWUKZRFFKPLUPE-HJGDQZAQSA-N 0.000 description 4
- LUAJJLPHUXPQLH-KKUMJFAQSA-N Lys-Phe-Ser Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CCCCN)N LUAJJLPHUXPQLH-KKUMJFAQSA-N 0.000 description 4
- UGCIQUYEJIEHKX-GVXVVHGQSA-N Lys-Val-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O UGCIQUYEJIEHKX-GVXVVHGQSA-N 0.000 description 4
- ONGCSGVHCSAATF-CIUDSAMLSA-N Met-Ala-Glu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(O)=O ONGCSGVHCSAATF-CIUDSAMLSA-N 0.000 description 4
- GAELMDJMQDUDLJ-BQBZGAKWSA-N Met-Ala-Gly Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O GAELMDJMQDUDLJ-BQBZGAKWSA-N 0.000 description 4
- YLLWCSDBVGZLOW-CIUDSAMLSA-N Met-Gln-Ala Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(O)=O YLLWCSDBVGZLOW-CIUDSAMLSA-N 0.000 description 4
- ZIIMORLEZLVRIP-SRVKXCTJSA-N Met-Leu-Gln Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O ZIIMORLEZLVRIP-SRVKXCTJSA-N 0.000 description 4
- AXHNAGAYRGCDLG-UWVGGRQHSA-N Met-Lys-Gly Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O AXHNAGAYRGCDLG-UWVGGRQHSA-N 0.000 description 4
- WYBVBIHNJWOLCJ-UHFFFAOYSA-N N-L-arginyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCCN=C(N)N WYBVBIHNJWOLCJ-UHFFFAOYSA-N 0.000 description 4
- IEOHQGFKHXUALJ-JYJNAYRXSA-N Phe-Met-Arg Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O IEOHQGFKHXUALJ-JYJNAYRXSA-N 0.000 description 4
- BPCLGWHVPVTTFM-QWRGUYRKSA-N Phe-Ser-Gly Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)NCC(O)=O BPCLGWHVPVTTFM-QWRGUYRKSA-N 0.000 description 4
- KLYYKKGCPOGDPE-OEAJRASXSA-N Phe-Thr-Leu Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O KLYYKKGCPOGDPE-OEAJRASXSA-N 0.000 description 4
- DIZLUAZLNDFDPR-CIUDSAMLSA-N Pro-Cys-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1 DIZLUAZLNDFDPR-CIUDSAMLSA-N 0.000 description 4
- UPJGUQPLYWTISV-GUBZILKMSA-N Pro-Gln-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O UPJGUQPLYWTISV-GUBZILKMSA-N 0.000 description 4
- FRKBNXCFJBPJOL-GUBZILKMSA-N Pro-Glu-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O FRKBNXCFJBPJOL-GUBZILKMSA-N 0.000 description 4
- JMVQDLDPDBXAAX-YUMQZZPRSA-N Pro-Gly-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 JMVQDLDPDBXAAX-YUMQZZPRSA-N 0.000 description 4
- VYWNORHENYEQDW-YUMQZZPRSA-N Pro-Gly-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 VYWNORHENYEQDW-YUMQZZPRSA-N 0.000 description 4
- CGSOWZUPLOKYOR-AVGNSLFASA-N Pro-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 CGSOWZUPLOKYOR-AVGNSLFASA-N 0.000 description 4
- UGDMQJSXSSZUKL-IHRRRGAJSA-N Pro-Ser-Tyr Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O UGDMQJSXSSZUKL-IHRRRGAJSA-N 0.000 description 4
- JXVXYRZQIUPYSA-NHCYSSNCSA-N Pro-Val-Gln Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O JXVXYRZQIUPYSA-NHCYSSNCSA-N 0.000 description 4
- 241000508269 Psidium Species 0.000 description 4
- QVOGDCQNGLBNCR-FXQIFTODSA-N Ser-Arg-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(O)=O QVOGDCQNGLBNCR-FXQIFTODSA-N 0.000 description 4
- BQWCDDAISCPDQV-XHNCKOQMSA-N Ser-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CO)N)C(=O)O BQWCDDAISCPDQV-XHNCKOQMSA-N 0.000 description 4
- KQNDIKOYWZTZIX-FXQIFTODSA-N Ser-Ser-Arg Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCNC(N)=N KQNDIKOYWZTZIX-FXQIFTODSA-N 0.000 description 4
- WLJPJRGQRNCIQS-ZLUOBGJFSA-N Ser-Ser-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O WLJPJRGQRNCIQS-ZLUOBGJFSA-N 0.000 description 4
- OLKICIBQRVSQMA-SRVKXCTJSA-N Ser-Ser-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O OLKICIBQRVSQMA-SRVKXCTJSA-N 0.000 description 4
- PLQWGQUNUPMNOD-KKUMJFAQSA-N Ser-Tyr-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(O)=O PLQWGQUNUPMNOD-KKUMJFAQSA-N 0.000 description 4
- JGUWRQWULDWNCM-FXQIFTODSA-N Ser-Val-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O JGUWRQWULDWNCM-FXQIFTODSA-N 0.000 description 4
- SWIKDOUVROTZCW-GCJQMDKQSA-N Thr-Asn-Ala Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](C)C(=O)O)N)O SWIKDOUVROTZCW-GCJQMDKQSA-N 0.000 description 4
- KRPKYGOFYUNIGM-XVSYOHENSA-N Thr-Asp-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N)O KRPKYGOFYUNIGM-XVSYOHENSA-N 0.000 description 4
- UTCFSBBXPWKLTG-XKBZYTNZSA-N Thr-Cys-Gln Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N)O UTCFSBBXPWKLTG-XKBZYTNZSA-N 0.000 description 4
- IMULJHHGAUZZFE-MBLNEYKQSA-N Thr-Gly-Ile Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(O)=O IMULJHHGAUZZFE-MBLNEYKQSA-N 0.000 description 4
- VRUFCJZQDACGLH-UVOCVTCTSA-N Thr-Leu-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VRUFCJZQDACGLH-UVOCVTCTSA-N 0.000 description 4
- DXPURPNJDFCKKO-RHYQMDGZSA-N Thr-Lys-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)[C@@H](C)O)C(O)=O DXPURPNJDFCKKO-RHYQMDGZSA-N 0.000 description 4
- BIBYEFRASCNLAA-CDMKHQONSA-N Thr-Phe-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CC1=CC=CC=C1 BIBYEFRASCNLAA-CDMKHQONSA-N 0.000 description 4
- MUAFDCVOHYAFNG-RCWTZXSCSA-N Thr-Pro-Arg Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O MUAFDCVOHYAFNG-RCWTZXSCSA-N 0.000 description 4
- MFMGPEKYBXFIRF-SUSMZKCASA-N Thr-Thr-Gln Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O MFMGPEKYBXFIRF-SUSMZKCASA-N 0.000 description 4
- 102100040247 Tumor necrosis factor Human genes 0.000 description 4
- GAYLGYUVTDMLKC-UWJYBYFXSA-N Tyr-Asp-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 GAYLGYUVTDMLKC-UWJYBYFXSA-N 0.000 description 4
- RYSNTWVRSLCAJZ-RYUDHWBXSA-N Tyr-Gln-Gly Chemical compound OC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 RYSNTWVRSLCAJZ-RYUDHWBXSA-N 0.000 description 4
- CNLKDWSAORJEMW-KWQFWETISA-N Tyr-Gly-Ala Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](C)C(O)=O CNLKDWSAORJEMW-KWQFWETISA-N 0.000 description 4
- AZZLDIDWPZLCCW-ZEWNOJEFSA-N Tyr-Ile-Phe Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O AZZLDIDWPZLCCW-ZEWNOJEFSA-N 0.000 description 4
- LMKKMCGTDANZTR-BZSNNMDCSA-N Tyr-Phe-Asp Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(O)=O)C(O)=O)C1=CC=C(O)C=C1 LMKKMCGTDANZTR-BZSNNMDCSA-N 0.000 description 4
- LDKDSFQSEUOCOO-RPTUDFQQSA-N Tyr-Thr-Phe Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O LDKDSFQSEUOCOO-RPTUDFQQSA-N 0.000 description 4
- APQIVBCUIUDSMB-OSUNSFLBSA-N Val-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C(C)C)N APQIVBCUIUDSMB-OSUNSFLBSA-N 0.000 description 4
- HPANGHISDXDUQY-ULQDDVLXSA-N Val-Lys-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N HPANGHISDXDUQY-ULQDDVLXSA-N 0.000 description 4
- PQSNETRGCRUOGP-KKHAAJSZSA-N Val-Thr-Asn Chemical compound CC(C)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CC(N)=O PQSNETRGCRUOGP-KKHAAJSZSA-N 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 108010041407 alanylaspartic acid Proteins 0.000 description 4
- 230000003321 amplification Effects 0.000 description 4
- 235000009582 asparagine Nutrition 0.000 description 4
- 229960001230 asparagine Drugs 0.000 description 4
- 230000022534 cell killing Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 238000012217 deletion Methods 0.000 description 4
- 230000037430 deletion Effects 0.000 description 4
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 4
- 108010030074 endodeoxyribonuclease MluI Proteins 0.000 description 4
- 239000012091 fetal bovine serum Substances 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 108010019832 glycyl-asparaginyl-glycine Proteins 0.000 description 4
- 108010020688 glycylhistidine Proteins 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 108010040030 histidinoalanine Proteins 0.000 description 4
- 230000004068 intracellular signaling Effects 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 238000003199 nucleic acid amplification method Methods 0.000 description 4
- 210000005259 peripheral blood Anatomy 0.000 description 4
- 239000011886 peripheral blood Substances 0.000 description 4
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 4
- 230000035755 proliferation Effects 0.000 description 4
- 108010004914 prolylarginine Proteins 0.000 description 4
- 108010090894 prolylleucine Proteins 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000019491 signal transduction Effects 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 210000001519 tissue Anatomy 0.000 description 4
- 238000011144 upstream manufacturing Methods 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- RLMISHABBKUNFO-WHFBIAKZSA-N Ala-Ala-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O RLMISHABBKUNFO-WHFBIAKZSA-N 0.000 description 3
- DAEFQZCYZKRTLR-ZLUOBGJFSA-N Ala-Cys-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(O)=O)C(O)=O DAEFQZCYZKRTLR-ZLUOBGJFSA-N 0.000 description 3
- VGPWRRFOPXVGOH-BYPYZUCNSA-N Ala-Gly-Gly Chemical compound C[C@H](N)C(=O)NCC(=O)NCC(O)=O VGPWRRFOPXVGOH-BYPYZUCNSA-N 0.000 description 3
- VNYMOTCMNHJGTG-JBDRJPRFSA-N Ala-Ile-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O VNYMOTCMNHJGTG-JBDRJPRFSA-N 0.000 description 3
- SAHQGRZIQVEJPF-JXUBOQSCSA-N Ala-Thr-Lys Chemical compound C[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CCCCN SAHQGRZIQVEJPF-JXUBOQSCSA-N 0.000 description 3
- BHFOJPDOQPWJRN-XDTLVQLUSA-N Ala-Tyr-Gln Chemical compound C[C@H](N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(N)=O)C(O)=O BHFOJPDOQPWJRN-XDTLVQLUSA-N 0.000 description 3
- CLOMBHBBUKAUBP-LSJOCFKGSA-N Ala-Val-His Chemical compound C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N CLOMBHBBUKAUBP-LSJOCFKGSA-N 0.000 description 3
- XPSGESXVBSQZPL-SRVKXCTJSA-N Arg-Arg-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O XPSGESXVBSQZPL-SRVKXCTJSA-N 0.000 description 3
- HJVGMOYJDDXLMI-AVGNSLFASA-N Arg-Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CCCNC(N)=N HJVGMOYJDDXLMI-AVGNSLFASA-N 0.000 description 3
- PNQWAUXQDBIJDY-GUBZILKMSA-N Arg-Glu-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O PNQWAUXQDBIJDY-GUBZILKMSA-N 0.000 description 3
- PHHRSPBBQUFULD-UWVGGRQHSA-N Arg-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CCCN=C(N)N)N PHHRSPBBQUFULD-UWVGGRQHSA-N 0.000 description 3
- 108010051330 Arg-Pro-Gly-Pro Proteins 0.000 description 3
- WIDVAWAQBRAKTI-YUMQZZPRSA-N Asn-Leu-Gly Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O WIDVAWAQBRAKTI-YUMQZZPRSA-N 0.000 description 3
- BIVYLQMZPHDUIH-WHFBIAKZSA-N Asp-Gly-Cys Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CS)C(=O)O)N)C(=O)O BIVYLQMZPHDUIH-WHFBIAKZSA-N 0.000 description 3
- RTXQQDVBACBSCW-CFMVVWHZSA-N Asp-Ile-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O RTXQQDVBACBSCW-CFMVVWHZSA-N 0.000 description 3
- 101100505161 Caenorhabditis elegans mel-32 gene Proteins 0.000 description 3
- 101100315624 Caenorhabditis elegans tyr-1 gene Proteins 0.000 description 3
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 3
- JTNKVWLMDHIUOG-IHRRRGAJSA-N Cys-Arg-Phe Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O JTNKVWLMDHIUOG-IHRRRGAJSA-N 0.000 description 3
- QLCPDGRAEJSYQM-LPEHRKFASA-N Cys-Arg-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CS)N)C(=O)O QLCPDGRAEJSYQM-LPEHRKFASA-N 0.000 description 3
- BCWIFCLVCRAIQK-ZLUOBGJFSA-N Cys-Ser-Cys Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CS)N)O BCWIFCLVCRAIQK-ZLUOBGJFSA-N 0.000 description 3
- LOJYQMFIIJVETK-WDSKDSINSA-N Gln-Gln Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(O)=O LOJYQMFIIJVETK-WDSKDSINSA-N 0.000 description 3
- NVEASDQHBRZPSU-BQBZGAKWSA-N Gln-Gln-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O NVEASDQHBRZPSU-BQBZGAKWSA-N 0.000 description 3
- HSHCEAUPUPJPTE-JYJNAYRXSA-N Gln-Leu-Tyr Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@H](CCC(=O)N)N HSHCEAUPUPJPTE-JYJNAYRXSA-N 0.000 description 3
- TWIAMTNJOMRDAK-GUBZILKMSA-N Gln-Lys-Asp Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O TWIAMTNJOMRDAK-GUBZILKMSA-N 0.000 description 3
- XQDGOJPVMSWZSO-SRVKXCTJSA-N Gln-Pro-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCC(=O)N)N XQDGOJPVMSWZSO-SRVKXCTJSA-N 0.000 description 3
- MQJDLNRXBOELJW-KKUMJFAQSA-N Gln-Pro-Phe Chemical compound N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(O)=O MQJDLNRXBOELJW-KKUMJFAQSA-N 0.000 description 3
- WOMUDRVDJMHTCV-DCAQKATOSA-N Glu-Arg-Arg Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O WOMUDRVDJMHTCV-DCAQKATOSA-N 0.000 description 3
- LRPXYSGPOBVBEH-IUCAKERBSA-N Glu-Gly-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(O)=O LRPXYSGPOBVBEH-IUCAKERBSA-N 0.000 description 3
- KFMBRBPXHVMDFN-UWVGGRQHSA-N Gly-Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CCCNC(N)=N KFMBRBPXHVMDFN-UWVGGRQHSA-N 0.000 description 3
- QCTLGOYODITHPQ-WHFBIAKZSA-N Gly-Cys-Ser Chemical compound [H]NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(O)=O QCTLGOYODITHPQ-WHFBIAKZSA-N 0.000 description 3
- CQZDZKRHFWJXDF-WDSKDSINSA-N Gly-Gln-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CN CQZDZKRHFWJXDF-WDSKDSINSA-N 0.000 description 3
- BULIVUZUDBHKKZ-WDSKDSINSA-N Gly-Gln-Asn Chemical compound NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O BULIVUZUDBHKKZ-WDSKDSINSA-N 0.000 description 3
- BHPQOIPBLYJNAW-NGZCFLSTSA-N Gly-Ile-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN BHPQOIPBLYJNAW-NGZCFLSTSA-N 0.000 description 3
- HDOYNXLPTRQLAD-JBDRJPRFSA-N Ile-Ala-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)O)N HDOYNXLPTRQLAD-JBDRJPRFSA-N 0.000 description 3
- LRAUKBMYHHNADU-DKIMLUQUSA-N Ile-Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)[C@@H](C)CC)CC1=CC=CC=C1 LRAUKBMYHHNADU-DKIMLUQUSA-N 0.000 description 3
- JTBFQNHKNRZJDS-SYWGBEHUSA-N Ile-Trp-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](C)C(=O)O)N JTBFQNHKNRZJDS-SYWGBEHUSA-N 0.000 description 3
- LHSGPCFBGJHPCY-UHFFFAOYSA-N L-leucine-L-tyrosine Natural products CC(C)CC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 LHSGPCFBGJHPCY-UHFFFAOYSA-N 0.000 description 3
- WNGVUZWBXZKQES-YUMQZZPRSA-N Leu-Ala-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O WNGVUZWBXZKQES-YUMQZZPRSA-N 0.000 description 3
- JQSXWJXBASFONF-KKUMJFAQSA-N Leu-Asp-Phe Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O JQSXWJXBASFONF-KKUMJFAQSA-N 0.000 description 3
- PPGBXYKMUMHFBF-KATARQTJSA-N Leu-Ser-Thr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O PPGBXYKMUMHFBF-KATARQTJSA-N 0.000 description 3
- LJBVRCDPWOJOEK-PPCPHDFISA-N Leu-Thr-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O LJBVRCDPWOJOEK-PPCPHDFISA-N 0.000 description 3
- SXOFUVGLPHCPRQ-KKUMJFAQSA-N Leu-Tyr-Cys Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CS)C(O)=O SXOFUVGLPHCPRQ-KKUMJFAQSA-N 0.000 description 3
- ARNIBBOXIAWUOP-MGHWNKPDSA-N Leu-Tyr-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O ARNIBBOXIAWUOP-MGHWNKPDSA-N 0.000 description 3
- SWWCDAGDQHTKIE-RHYQMDGZSA-N Lys-Arg-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SWWCDAGDQHTKIE-RHYQMDGZSA-N 0.000 description 3
- VSRXPEHZMHSFKU-IUCAKERBSA-N Lys-Gln-Gly Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O VSRXPEHZMHSFKU-IUCAKERBSA-N 0.000 description 3
- MQMIRLVJXQNTRJ-SDDRHHMPSA-N Lys-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCCCN)N)C(=O)O MQMIRLVJXQNTRJ-SDDRHHMPSA-N 0.000 description 3
- LCMWVZLBCUVDAZ-IUCAKERBSA-N Lys-Gly-Glu Chemical compound [NH3+]CCCC[C@H]([NH3+])C(=O)NCC(=O)N[C@H](C([O-])=O)CCC([O-])=O LCMWVZLBCUVDAZ-IUCAKERBSA-N 0.000 description 3
- AIRZWUMAHCDDHR-KKUMJFAQSA-N Lys-Leu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O AIRZWUMAHCDDHR-KKUMJFAQSA-N 0.000 description 3
- URGPVYGVWLIRGT-DCAQKATOSA-N Lys-Met-Ala Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(O)=O URGPVYGVWLIRGT-DCAQKATOSA-N 0.000 description 3
- UZWMJZSOXGOVIN-LURJTMIESA-N Met-Gly-Gly Chemical compound CSCC[C@H](N)C(=O)NCC(=O)NCC(O)=O UZWMJZSOXGOVIN-LURJTMIESA-N 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 3
- 101100342977 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) leu-1 gene Proteins 0.000 description 3
- NAXPHWZXEXNDIW-JTQLQIEISA-N Phe-Gly-Gly Chemical compound OC(=O)CNC(=O)CNC(=O)[C@@H](N)CC1=CC=CC=C1 NAXPHWZXEXNDIW-JTQLQIEISA-N 0.000 description 3
- MJAYDXWQQUOURZ-JYJNAYRXSA-N Phe-Lys-Gln Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(O)=O MJAYDXWQQUOURZ-JYJNAYRXSA-N 0.000 description 3
- BTAIJUBAGLVFKQ-BVSLBCMMSA-N Phe-Trp-Val Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](C(C)C)C(O)=O)C1=CC=CC=C1 BTAIJUBAGLVFKQ-BVSLBCMMSA-N 0.000 description 3
- IHCXPSYCHXFXKT-DCAQKATOSA-N Pro-Arg-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O IHCXPSYCHXFXKT-DCAQKATOSA-N 0.000 description 3
- LHALYDBUDCWMDY-CIUDSAMLSA-N Pro-Glu-Ala Chemical compound C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1)C(O)=O LHALYDBUDCWMDY-CIUDSAMLSA-N 0.000 description 3
- DSGSTPRKNYHGCL-JYJNAYRXSA-N Pro-Phe-Met Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCSC)C(O)=O DSGSTPRKNYHGCL-JYJNAYRXSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- HBOABDXGTMMDSE-GUBZILKMSA-N Ser-Arg-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(O)=O HBOABDXGTMMDSE-GUBZILKMSA-N 0.000 description 3
- FMDHKPRACUXATF-ACZMJKKPSA-N Ser-Gln-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O FMDHKPRACUXATF-ACZMJKKPSA-N 0.000 description 3
- BPMRXBZYPGYPJN-WHFBIAKZSA-N Ser-Gly-Asn Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O BPMRXBZYPGYPJN-WHFBIAKZSA-N 0.000 description 3
- CAJFZCICSVBOJK-SHGPDSBTSA-N Thr-Ala-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAJFZCICSVBOJK-SHGPDSBTSA-N 0.000 description 3
- TWLMXDWFVNEFFK-FJXKBIBVSA-N Thr-Arg-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O TWLMXDWFVNEFFK-FJXKBIBVSA-N 0.000 description 3
- LYGKYFKSZTUXGZ-ZDLURKLDSA-N Thr-Cys-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)NCC(O)=O LYGKYFKSZTUXGZ-ZDLURKLDSA-N 0.000 description 3
- XOWKUMFHEZLKLT-CIQUZCHMSA-N Thr-Ile-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O XOWKUMFHEZLKLT-CIQUZCHMSA-N 0.000 description 3
- IIJWXEUNETVJPV-IHRRRGAJSA-N Tyr-Arg-Ser Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)O)N)O IIJWXEUNETVJPV-IHRRRGAJSA-N 0.000 description 3
- UABYBEBXFFNCIR-YDHLFZDLSA-N Tyr-Asp-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O UABYBEBXFFNCIR-YDHLFZDLSA-N 0.000 description 3
- FFCRCJZJARTYCG-KKUMJFAQSA-N Tyr-Cys-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)O)N)O FFCRCJZJARTYCG-KKUMJFAQSA-N 0.000 description 3
- VCAWFLIWYNMHQP-UKJIMTQDSA-N Val-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C(C)C)N VCAWFLIWYNMHQP-UKJIMTQDSA-N 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 230000002776 aggregation Effects 0.000 description 3
- 238000004220 aggregation Methods 0.000 description 3
- 108010005233 alanylglutamic acid Proteins 0.000 description 3
- 108010047495 alanylglycine Proteins 0.000 description 3
- 102000025171 antigen binding proteins Human genes 0.000 description 3
- 108091000831 antigen binding proteins Proteins 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 239000013613 expression plasmid Substances 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- 108010012058 leucyltyrosine Proteins 0.000 description 3
- 108010070409 phenylalanyl-glycyl-glycine Proteins 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 108010056030 retronectin Proteins 0.000 description 3
- 108010048397 seryl-lysyl-leucine Proteins 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 108010051110 tyrosyl-lysine Proteins 0.000 description 3
- CEHZCZCQHUNAJF-AVGNSLFASA-N (2s)-1-[2-[[(2s)-1-[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]acetyl]pyrrolidine-2-carboxylic acid Chemical compound NC(N)=NCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N1[C@H](C(O)=O)CCC1 CEHZCZCQHUNAJF-AVGNSLFASA-N 0.000 description 2
- RUXQNKVQSKOOBS-JURCDPSOSA-N Ala-Phe-Ile Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O RUXQNKVQSKOOBS-JURCDPSOSA-N 0.000 description 2
- OLVCTPPSXNRGKV-GUBZILKMSA-N Ala-Pro-Pro Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 OLVCTPPSXNRGKV-GUBZILKMSA-N 0.000 description 2
- 108010083359 Antigen Receptors Proteins 0.000 description 2
- 102000006306 Antigen Receptors Human genes 0.000 description 2
- TTXYKSADPSNOIF-IHRRRGAJSA-N Arg-Asp-Phe Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O TTXYKSADPSNOIF-IHRRRGAJSA-N 0.000 description 2
- HGKHPCFTRQDHCU-IUCAKERBSA-N Arg-Pro-Gly Chemical compound NC(N)=NCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O HGKHPCFTRQDHCU-IUCAKERBSA-N 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- JSHWXQIZOCVWIA-ZKWXMUAHSA-N Asp-Ser-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O JSHWXQIZOCVWIA-ZKWXMUAHSA-N 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 101100459912 Caenorhabditis elegans ncs-1 gene Proteins 0.000 description 2
- SNLOOPZHAQDMJG-CIUDSAMLSA-N Gln-Glu-Glu Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O SNLOOPZHAQDMJG-CIUDSAMLSA-N 0.000 description 2
- ZEEPYMXTJWIMSN-GUBZILKMSA-N Gln-Lys-Ser Chemical compound NCCCC[C@@H](C(=O)N[C@@H](CO)C(O)=O)NC(=O)[C@@H](N)CCC(N)=O ZEEPYMXTJWIMSN-GUBZILKMSA-N 0.000 description 2
- DCWNCMRZIZSZBL-KKUMJFAQSA-N Gln-Pro-Tyr Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CCC(=O)N)N)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)O DCWNCMRZIZSZBL-KKUMJFAQSA-N 0.000 description 2
- SGVGIVDZLSHSEN-RYUDHWBXSA-N Gln-Tyr-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(O)=O SGVGIVDZLSHSEN-RYUDHWBXSA-N 0.000 description 2
- DSPQRJXOIXHOHK-WDSKDSINSA-N Glu-Asp-Gly Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O DSPQRJXOIXHOHK-WDSKDSINSA-N 0.000 description 2
- VSRCAOIHMGCIJK-SRVKXCTJSA-N Glu-Leu-Arg Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O VSRCAOIHMGCIJK-SRVKXCTJSA-N 0.000 description 2
- XXGQRGQPGFYECI-WDSKDSINSA-N Gly-Cys-Glu Chemical compound NCC(=O)N[C@@H](CS)C(=O)N[C@H](C(O)=O)CCC(O)=O XXGQRGQPGFYECI-WDSKDSINSA-N 0.000 description 2
- PABFFPWEJMEVEC-JGVFFNPUSA-N Gly-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)CN)C(=O)O PABFFPWEJMEVEC-JGVFFNPUSA-N 0.000 description 2
- IDOGEHIWMJMAHT-BYPYZUCNSA-N Gly-Gly-Cys Chemical compound NCC(=O)NCC(=O)N[C@@H](CS)C(O)=O IDOGEHIWMJMAHT-BYPYZUCNSA-N 0.000 description 2
- LCRDMSSAKLTKBU-ZDLURKLDSA-N Gly-Ser-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)CN LCRDMSSAKLTKBU-ZDLURKLDSA-N 0.000 description 2
- ZKJZBRHRWKLVSJ-ZDLURKLDSA-N Gly-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)CN)O ZKJZBRHRWKLVSJ-ZDLURKLDSA-N 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 2
- WSWAUVHXQREQQG-JYJNAYRXSA-N His-Tyr-Gln Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O WSWAUVHXQREQQG-JYJNAYRXSA-N 0.000 description 2
- 101001002657 Homo sapiens Interleukin-2 Proteins 0.000 description 2
- 101000738335 Homo sapiens T-cell surface glycoprotein CD3 zeta chain Proteins 0.000 description 2
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 2
- DFJJAVZIHDFOGQ-MNXVOIDGSA-N Ile-Glu-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N DFJJAVZIHDFOGQ-MNXVOIDGSA-N 0.000 description 2
- KLJKJVXDHVUMMZ-KKPKCPPISA-N Ile-Phe-Trp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)O)N KLJKJVXDHVUMMZ-KKPKCPPISA-N 0.000 description 2
- VGSPNSSCMOHRRR-BJDJZHNGSA-N Ile-Ser-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)O)N VGSPNSSCMOHRRR-BJDJZHNGSA-N 0.000 description 2
- KBDIBHQICWDGDL-PPCPHDFISA-N Ile-Thr-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)O)N KBDIBHQICWDGDL-PPCPHDFISA-N 0.000 description 2
- REXAUQBGSGDEJY-IGISWZIWSA-N Ile-Tyr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)N REXAUQBGSGDEJY-IGISWZIWSA-N 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 102100025390 Integrin beta-2 Human genes 0.000 description 2
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 2
- SITWEMZOJNKJCH-UHFFFAOYSA-N L-alanine-L-arginine Natural products CC(N)C(=O)NC(C(O)=O)CCCNC(N)=N SITWEMZOJNKJCH-UHFFFAOYSA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- SENJXOPIZNYLHU-UHFFFAOYSA-N L-leucyl-L-arginine Natural products CC(C)CC(N)C(=O)NC(C(O)=O)CCCN=C(N)N SENJXOPIZNYLHU-UHFFFAOYSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- RXGLHDWAZQECBI-SRVKXCTJSA-N Leu-Leu-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O RXGLHDWAZQECBI-SRVKXCTJSA-N 0.000 description 2
- UCNNZELZXFXXJQ-BZSNNMDCSA-N Leu-Leu-Tyr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 UCNNZELZXFXXJQ-BZSNNMDCSA-N 0.000 description 2
- 102000003960 Ligases Human genes 0.000 description 2
- 108090000364 Ligases Proteins 0.000 description 2
- NQCJGQHHYZNUDK-DCAQKATOSA-N Lys-Arg-Ser Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CO)C(O)=O)CCCN=C(N)N NQCJGQHHYZNUDK-DCAQKATOSA-N 0.000 description 2
- OIYWBDBHEGAVST-BZSNNMDCSA-N Lys-His-Tyr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O OIYWBDBHEGAVST-BZSNNMDCSA-N 0.000 description 2
- HVAUKHLDSDDROB-KKUMJFAQSA-N Lys-Lys-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O HVAUKHLDSDDROB-KKUMJFAQSA-N 0.000 description 2
- SVSQSPICRKBMSZ-SRVKXCTJSA-N Lys-Pro-Gln Chemical compound [H]N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(O)=O SVSQSPICRKBMSZ-SRVKXCTJSA-N 0.000 description 2
- LUTDBHBIHHREDC-IHRRRGAJSA-N Lys-Pro-Lys Chemical compound NCCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(O)=O LUTDBHBIHHREDC-IHRRRGAJSA-N 0.000 description 2
- WQDKIVRHTQYJSN-DCAQKATOSA-N Lys-Ser-Arg Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N WQDKIVRHTQYJSN-DCAQKATOSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- ZAJNRWKGHWGPDQ-SDDRHHMPSA-N Met-Arg-Pro Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@@H]1C(=O)O)N ZAJNRWKGHWGPDQ-SDDRHHMPSA-N 0.000 description 2
- 239000012124 Opti-MEM Substances 0.000 description 2
- QARPMYDMYVLFMW-KKUMJFAQSA-N Phe-Pro-Glu Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(O)=O)C1=CC=CC=C1 QARPMYDMYVLFMW-KKUMJFAQSA-N 0.000 description 2
- 239000004698 Polyethylene Substances 0.000 description 2
- 229920002594 Polyethylene Glycol 8000 Polymers 0.000 description 2
- LSIWVWRUTKPXDS-DCAQKATOSA-N Pro-Gln-Arg Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O LSIWVWRUTKPXDS-DCAQKATOSA-N 0.000 description 2
- UAYHMOIGIQZLFR-NHCYSSNCSA-N Pro-Gln-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O UAYHMOIGIQZLFR-NHCYSSNCSA-N 0.000 description 2
- FMLRRBDLBJLJIK-DCAQKATOSA-N Pro-Leu-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1 FMLRRBDLBJLJIK-DCAQKATOSA-N 0.000 description 2
- FDMKYQQYJKYCLV-GUBZILKMSA-N Pro-Pro-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 FDMKYQQYJKYCLV-GUBZILKMSA-N 0.000 description 2
- PKHDJFHFMGQMPS-RCWTZXSCSA-N Pro-Thr-Arg Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O PKHDJFHFMGQMPS-RCWTZXSCSA-N 0.000 description 2
- DLZBBDSPTJBOOD-BPNCWPANSA-N Pro-Tyr-Ala Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O DLZBBDSPTJBOOD-BPNCWPANSA-N 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- VMLONWHIORGALA-SRVKXCTJSA-N Ser-Leu-Leu Chemical compound CC(C)C[C@@H](C([O-])=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]([NH3+])CO VMLONWHIORGALA-SRVKXCTJSA-N 0.000 description 2
- IXZHZUGGKLRHJD-DCAQKATOSA-N Ser-Leu-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O IXZHZUGGKLRHJD-DCAQKATOSA-N 0.000 description 2
- PIQRHJQWEPWFJG-UWJYBYFXSA-N Ser-Tyr-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O PIQRHJQWEPWFJG-UWJYBYFXSA-N 0.000 description 2
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 102100037906 T-cell surface glycoprotein CD3 zeta chain Human genes 0.000 description 2
- NAXBBCLCEOTAIG-RHYQMDGZSA-N Thr-Arg-Lys Chemical compound NC(N)=NCCC[C@H](NC(=O)[C@@H](N)[C@H](O)C)C(=O)N[C@@H](CCCCN)C(O)=O NAXBBCLCEOTAIG-RHYQMDGZSA-N 0.000 description 2
- VUVCRYXYUUPGSB-GLLZPBPUSA-N Thr-Gln-Glu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N)O VUVCRYXYUUPGSB-GLLZPBPUSA-N 0.000 description 2
- KPMIQCXJDVKWKO-IFFSRLJSSA-N Thr-Val-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O KPMIQCXJDVKWKO-IFFSRLJSSA-N 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- VZBWRZGNEPBRDE-HZUKXOBISA-N Trp-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CNC3=CC=CC=C32)N VZBWRZGNEPBRDE-HZUKXOBISA-N 0.000 description 2
- NMOIRIIIUVELLY-WDSOQIARSA-N Trp-Val-Leu Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(O)=O)C(C)C)=CNC2=C1 NMOIRIIIUVELLY-WDSOQIARSA-N 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 108010065323 Tumor Necrosis Factor Ligand Superfamily Member 13 Proteins 0.000 description 2
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 2
- 108091005966 Type III transmembrane proteins Proteins 0.000 description 2
- VXFXIBCCVLJCJT-JYJNAYRXSA-N Tyr-Pro-Pro Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(O)=O VXFXIBCCVLJCJT-JYJNAYRXSA-N 0.000 description 2
- VMRFIKXKOFNMHW-GUBZILKMSA-N Val-Arg-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)O)N VMRFIKXKOFNMHW-GUBZILKMSA-N 0.000 description 2
- NYTKXWLZSNRILS-IFFSRLJSSA-N Val-Gln-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C(C)C)N)O NYTKXWLZSNRILS-IFFSRLJSSA-N 0.000 description 2
- BZDGLJPROOOUOZ-XGEHTFHBSA-N Val-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](C(C)C)N)O BZDGLJPROOOUOZ-XGEHTFHBSA-N 0.000 description 2
- ZLNYBMWGPOKSLW-LSJOCFKGSA-N Val-Val-Asp Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O ZLNYBMWGPOKSLW-LSJOCFKGSA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 238000001261 affinity purification Methods 0.000 description 2
- 238000000246 agarose gel electrophoresis Methods 0.000 description 2
- 108010024078 alanyl-glycyl-serine Proteins 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 108010092854 aspartyllysine Proteins 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- YFSQMOVEGCCDJL-UHFFFAOYSA-N boron monofluoride Chemical compound F[B] YFSQMOVEGCCDJL-UHFFFAOYSA-N 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- 238000004364 calculation method Methods 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 230000009137 competitive binding Effects 0.000 description 2
- 239000012141 concentrate Substances 0.000 description 2
- 108010016616 cysteinylglycine Proteins 0.000 description 2
- 231100000599 cytotoxic agent Toxicity 0.000 description 2
- 239000002619 cytotoxin Substances 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000001647 drug administration Methods 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000012149 elution buffer Substances 0.000 description 2
- 230000008451 emotion Effects 0.000 description 2
- 239000000945 filler Substances 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 108010013768 glutamyl-aspartyl-proline Proteins 0.000 description 2
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 2
- 108010087823 glycyltyrosine Proteins 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 229940047124 interferons Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 108010044311 leucyl-glycyl-glycine Proteins 0.000 description 2
- 108010000761 leucylarginine Proteins 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 230000005291 magnetic effect Effects 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 238000006386 neutralization reaction Methods 0.000 description 2
- 238000004091 panning Methods 0.000 description 2
- 210000004180 plasmocyte Anatomy 0.000 description 2
- 238000007747 plating Methods 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 229920000136 polysorbate Polymers 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- 238000004451 qualitative analysis Methods 0.000 description 2
- 238000004445 quantitative analysis Methods 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 238000010187 selection method Methods 0.000 description 2
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 2
- 230000002269 spontaneous effect Effects 0.000 description 2
- 238000011476 stem cell transplantation Methods 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000002463 transducing effect Effects 0.000 description 2
- 238000012250 transgenic expression Methods 0.000 description 2
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 2
- 230000005760 tumorsuppression Effects 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- GJLXVWOMRRWCIB-MERZOTPQSA-N (2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-acetamido-5-(diaminomethylideneamino)pentanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanoyl]amino]-6-aminohexanamide Chemical compound C([C@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CC=C(O)C=C1 GJLXVWOMRRWCIB-MERZOTPQSA-N 0.000 description 1
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- IESDGNYHXIOKRW-YXMSTPNBSA-N (2s)-2-[[(2s)-1-[(2s)-6-amino-2-[[(2s,3r)-2-amino-3-hydroxybutanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-(diaminomethylideneamino)pentanoic acid Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O IESDGNYHXIOKRW-YXMSTPNBSA-N 0.000 description 1
- PIDRBUDUWHBYSR-UHFFFAOYSA-N 1-[2-[[2-[(2-amino-4-methylpentanoyl)amino]-4-methylpentanoyl]amino]-4-methylpentanoyl]pyrrolidine-2-carboxylic acid Chemical compound CC(C)CC(N)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)N1CCCC1C(O)=O PIDRBUDUWHBYSR-UHFFFAOYSA-N 0.000 description 1
- QMOQBVOBWVNSNO-UHFFFAOYSA-N 2-[[2-[[2-[(2-azaniumylacetyl)amino]acetyl]amino]acetyl]amino]acetate Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(O)=O QMOQBVOBWVNSNO-UHFFFAOYSA-N 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- STACJSVFHSEZJV-GHCJXIJMSA-N Ala-Asn-Ile Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O STACJSVFHSEZJV-GHCJXIJMSA-N 0.000 description 1
- IFTVANMRTIHKML-WDSKDSINSA-N Ala-Gln-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O IFTVANMRTIHKML-WDSKDSINSA-N 0.000 description 1
- NHLAEBFGWPXFGI-WHFBIAKZSA-N Ala-Gly-Asn Chemical compound C[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)N)C(=O)O)N NHLAEBFGWPXFGI-WHFBIAKZSA-N 0.000 description 1
- OBVSBEYOMDWLRJ-BFHQHQDPSA-N Ala-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N OBVSBEYOMDWLRJ-BFHQHQDPSA-N 0.000 description 1
- SMCGQGDVTPFXKB-XPUUQOCRSA-N Ala-Gly-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@H](C)N SMCGQGDVTPFXKB-XPUUQOCRSA-N 0.000 description 1
- LBYMZCVBOKYZNS-CIUDSAMLSA-N Ala-Leu-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O LBYMZCVBOKYZNS-CIUDSAMLSA-N 0.000 description 1
- SOBIAADAMRHGKH-CIUDSAMLSA-N Ala-Leu-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O SOBIAADAMRHGKH-CIUDSAMLSA-N 0.000 description 1
- SDZRIBWEVVRDQI-CIUDSAMLSA-N Ala-Lys-Asp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O SDZRIBWEVVRDQI-CIUDSAMLSA-N 0.000 description 1
- SUHLZMHFRALVSY-YUMQZZPRSA-N Ala-Lys-Gly Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)C)C(=O)NCC(O)=O SUHLZMHFRALVSY-YUMQZZPRSA-N 0.000 description 1
- OINVDEKBKBCPLX-JXUBOQSCSA-N Ala-Lys-Thr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OINVDEKBKBCPLX-JXUBOQSCSA-N 0.000 description 1
- REAQAWSENITKJL-DDWPSWQVSA-N Ala-Met-Asp-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O REAQAWSENITKJL-DDWPSWQVSA-N 0.000 description 1
- DWYROCSXOOMOEU-CIUDSAMLSA-N Ala-Met-Glu Chemical compound C[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N DWYROCSXOOMOEU-CIUDSAMLSA-N 0.000 description 1
- OSRZOHXQCUFIQG-FPMFFAJLSA-N Ala-Phe-Pro Chemical compound C([C@H](NC(=O)[C@@H]([NH3+])C)C(=O)N1[C@H](CCC1)C([O-])=O)C1=CC=CC=C1 OSRZOHXQCUFIQG-FPMFFAJLSA-N 0.000 description 1
- WQLDNOCHHRISMS-NAKRPEOUSA-N Ala-Pro-Ile Chemical compound [H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)CC)C(O)=O WQLDNOCHHRISMS-NAKRPEOUSA-N 0.000 description 1
- ADSGHMXEAZJJNF-DCAQKATOSA-N Ala-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)N ADSGHMXEAZJJNF-DCAQKATOSA-N 0.000 description 1
- MSWSRLGNLKHDEI-ACZMJKKPSA-N Ala-Ser-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O MSWSRLGNLKHDEI-ACZMJKKPSA-N 0.000 description 1
- LSMDIAAALJJLRO-XQXXSGGOSA-N Ala-Thr-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(O)=O LSMDIAAALJJLRO-XQXXSGGOSA-N 0.000 description 1
- VNFSAYFQLXPHPY-CIQUZCHMSA-N Ala-Thr-Ile Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O VNFSAYFQLXPHPY-CIQUZCHMSA-N 0.000 description 1
- AOAKQKVICDWCLB-UWJYBYFXSA-N Ala-Tyr-Asn Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N AOAKQKVICDWCLB-UWJYBYFXSA-N 0.000 description 1
- YCTIYBUTCKNOTI-UWJYBYFXSA-N Ala-Tyr-Asp Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N YCTIYBUTCKNOTI-UWJYBYFXSA-N 0.000 description 1
- DHONNEYAZPNGSG-UBHSHLNASA-N Ala-Val-Phe Chemical compound C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 DHONNEYAZPNGSG-UBHSHLNASA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- VBFJESQBIWCWRL-DCAQKATOSA-N Arg-Ala-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCNC(N)=N VBFJESQBIWCWRL-DCAQKATOSA-N 0.000 description 1
- DBKNLHKEVPZVQC-LPEHRKFASA-N Arg-Ala-Pro Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@@H]1C(O)=O DBKNLHKEVPZVQC-LPEHRKFASA-N 0.000 description 1
- OZNSCVPYWZRQPY-CIUDSAMLSA-N Arg-Asp-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O OZNSCVPYWZRQPY-CIUDSAMLSA-N 0.000 description 1
- XTGGTAWGUFXJSV-NAKRPEOUSA-N Arg-Cys-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CCCN=C(N)N)N XTGGTAWGUFXJSV-NAKRPEOUSA-N 0.000 description 1
- YQGZIRIYGHNSQO-ZPFDUUQYSA-N Arg-Ile-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N YQGZIRIYGHNSQO-ZPFDUUQYSA-N 0.000 description 1
- BNYNOWJESJJIOI-XUXIUFHCSA-N Arg-Lys-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCN=C(N)N)N BNYNOWJESJJIOI-XUXIUFHCSA-N 0.000 description 1
- VENMDXUVHSKEIN-GUBZILKMSA-N Arg-Ser-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O VENMDXUVHSKEIN-GUBZILKMSA-N 0.000 description 1
- JOTRDIXZHNQYGP-DCAQKATOSA-N Arg-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCN=C(N)N)N JOTRDIXZHNQYGP-DCAQKATOSA-N 0.000 description 1
- JQHASVQBAKRJKD-GUBZILKMSA-N Arg-Ser-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCN=C(N)N)N JQHASVQBAKRJKD-GUBZILKMSA-N 0.000 description 1
- OQPAZKMGCWPERI-GUBZILKMSA-N Arg-Ser-Val Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O OQPAZKMGCWPERI-GUBZILKMSA-N 0.000 description 1
- ZJBUILVYSXQNSW-YTWAJWBKSA-N Arg-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)O ZJBUILVYSXQNSW-YTWAJWBKSA-N 0.000 description 1
- IZSMEUDYADKZTJ-KJEVXHAQSA-N Arg-Tyr-Thr Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IZSMEUDYADKZTJ-KJEVXHAQSA-N 0.000 description 1
- SLKLLQWZQHXYSV-CIUDSAMLSA-N Asn-Ala-Lys Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(O)=O SLKLLQWZQHXYSV-CIUDSAMLSA-N 0.000 description 1
- IARGXWMWRFOQPG-GCJQMDKQSA-N Asn-Ala-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IARGXWMWRFOQPG-GCJQMDKQSA-N 0.000 description 1
- DAPLJWATMAXPPZ-CIUDSAMLSA-N Asn-Asn-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CC(N)=O DAPLJWATMAXPPZ-CIUDSAMLSA-N 0.000 description 1
- BVLIJXXSXBUGEC-SRVKXCTJSA-N Asn-Asn-Tyr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O BVLIJXXSXBUGEC-SRVKXCTJSA-N 0.000 description 1
- SRUUBQBAVNQZGJ-LAEOZQHASA-N Asn-Gln-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC(=O)N)N SRUUBQBAVNQZGJ-LAEOZQHASA-N 0.000 description 1
- WONGRTVAMHFGBE-WDSKDSINSA-N Asn-Gly-Gln Chemical compound C(CC(=O)N)[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CC(=O)N)N WONGRTVAMHFGBE-WDSKDSINSA-N 0.000 description 1
- OLVIPTLKNSAYRJ-YUMQZZPRSA-N Asn-Gly-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)CNC(=O)[C@H](CC(=O)N)N OLVIPTLKNSAYRJ-YUMQZZPRSA-N 0.000 description 1
- RCFGLXMZDYNRSC-CIUDSAMLSA-N Asn-Lys-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O RCFGLXMZDYNRSC-CIUDSAMLSA-N 0.000 description 1
- GZXOUBTUAUAVHD-ACZMJKKPSA-N Asn-Ser-Glu Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O GZXOUBTUAUAVHD-ACZMJKKPSA-N 0.000 description 1
- HNXWVVHIGTZTBO-LKXGYXEUSA-N Asn-Ser-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O HNXWVVHIGTZTBO-LKXGYXEUSA-N 0.000 description 1
- ZUFPUBYQYWCMDB-NUMRIWBASA-N Asn-Thr-Glu Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O ZUFPUBYQYWCMDB-NUMRIWBASA-N 0.000 description 1
- PIABYSIYPGLLDQ-XVSYOHENSA-N Asn-Thr-Phe Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O PIABYSIYPGLLDQ-XVSYOHENSA-N 0.000 description 1
- UXHYOWXTJLBEPG-GSSVUCPTSA-N Asn-Thr-Thr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O UXHYOWXTJLBEPG-GSSVUCPTSA-N 0.000 description 1
- FHCRKXCTKSHNOE-QEJZJMRPSA-N Asn-Trp-Glu Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CC(=O)N)N FHCRKXCTKSHNOE-QEJZJMRPSA-N 0.000 description 1
- QNNBHTFDFFFHGC-KKUMJFAQSA-N Asn-Tyr-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N)O QNNBHTFDFFFHGC-KKUMJFAQSA-N 0.000 description 1
- KBQOUDLMWYWXNP-YDHLFZDLSA-N Asn-Val-Phe Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](CC(=O)N)N KBQOUDLMWYWXNP-YDHLFZDLSA-N 0.000 description 1
- HPNDBHLITCHRSO-WHFBIAKZSA-N Asp-Ala-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)NCC(O)=O HPNDBHLITCHRSO-WHFBIAKZSA-N 0.000 description 1
- LKIYSIYBKYLKPU-BIIVOSGPSA-N Asp-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)N)C(=O)O LKIYSIYBKYLKPU-BIIVOSGPSA-N 0.000 description 1
- QQXOYLWJQUPXJU-WHFBIAKZSA-N Asp-Cys-Gly Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CS)C(=O)NCC(O)=O QQXOYLWJQUPXJU-WHFBIAKZSA-N 0.000 description 1
- OVPHVTCDVYYTHN-AVGNSLFASA-N Asp-Glu-Phe Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 OVPHVTCDVYYTHN-AVGNSLFASA-N 0.000 description 1
- SNDBKTFJWVEVPO-WHFBIAKZSA-N Asp-Gly-Ser Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(O)=O SNDBKTFJWVEVPO-WHFBIAKZSA-N 0.000 description 1
- WSGVTKZFVJSJOG-RCOVLWMOSA-N Asp-Gly-Val Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O WSGVTKZFVJSJOG-RCOVLWMOSA-N 0.000 description 1
- CMCIMCAQIULNDJ-CIUDSAMLSA-N Asp-His-Cys Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC(=O)O)N CMCIMCAQIULNDJ-CIUDSAMLSA-N 0.000 description 1
- KTTCQQNRRLCIBC-GHCJXIJMSA-N Asp-Ile-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O KTTCQQNRRLCIBC-GHCJXIJMSA-N 0.000 description 1
- HOBNTSHITVVNBN-ZPFDUUQYSA-N Asp-Ile-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H](CC(=O)O)N HOBNTSHITVVNBN-ZPFDUUQYSA-N 0.000 description 1
- DWOGMPWRQQWPPF-GUBZILKMSA-N Asp-Leu-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O DWOGMPWRQQWPPF-GUBZILKMSA-N 0.000 description 1
- UCHSVZYJKJLPHF-BZSNNMDCSA-N Asp-Phe-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O UCHSVZYJKJLPHF-BZSNNMDCSA-N 0.000 description 1
- CUQDCPXNZPDYFQ-ZLUOBGJFSA-N Asp-Ser-Asp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O CUQDCPXNZPDYFQ-ZLUOBGJFSA-N 0.000 description 1
- JSNWZMFSLIWAHS-HJGDQZAQSA-N Asp-Thr-Leu Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H](CC(=O)O)N)O JSNWZMFSLIWAHS-HJGDQZAQSA-N 0.000 description 1
- YUELDQUPTAYEGM-XIRDDKMYSA-N Asp-Trp-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)[C@H](CC(=O)O)N YUELDQUPTAYEGM-XIRDDKMYSA-N 0.000 description 1
- RKXVTTIQNKPCHU-KKHAAJSZSA-N Asp-Val-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CC(O)=O RKXVTTIQNKPCHU-KKHAAJSZSA-N 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 102100021277 Beta-secretase 2 Human genes 0.000 description 1
- 208000019838 Blood disease Diseases 0.000 description 1
- 241000713686 Bovine lentivirus group Species 0.000 description 1
- 241000440351 Caprine lentivirus Species 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- UXIYYUMGFNSGBK-XPUUQOCRSA-N Cys-Gly-Val Chemical compound [H]N[C@@H](CS)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O UXIYYUMGFNSGBK-XPUUQOCRSA-N 0.000 description 1
- OHLLDUNVMPPUMD-DCAQKATOSA-N Cys-Leu-Val Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H](CS)N OHLLDUNVMPPUMD-DCAQKATOSA-N 0.000 description 1
- XMVZMBGFIOQONW-GARJFASQSA-N Cys-Lys-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CS)N)C(=O)O XMVZMBGFIOQONW-GARJFASQSA-N 0.000 description 1
- ZXCAQANTQWBICD-DCAQKATOSA-N Cys-Lys-Val Chemical compound CC(C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CS)N ZXCAQANTQWBICD-DCAQKATOSA-N 0.000 description 1
- SMEYEQDCCBHTEF-FXQIFTODSA-N Cys-Pro-Ala Chemical compound [H]N[C@@H](CS)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O SMEYEQDCCBHTEF-FXQIFTODSA-N 0.000 description 1
- NDNZRWUDUMTITL-FXQIFTODSA-N Cys-Ser-Val Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O NDNZRWUDUMTITL-FXQIFTODSA-N 0.000 description 1
- VRJZMZGGAKVSIQ-SRVKXCTJSA-N Cys-Tyr-Ser Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O VRJZMZGGAKVSIQ-SRVKXCTJSA-N 0.000 description 1
- ALTQTAKGRFLRLR-GUBZILKMSA-N Cys-Val-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H](CS)N ALTQTAKGRFLRLR-GUBZILKMSA-N 0.000 description 1
- 101710112752 Cytotoxin Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 208000034951 Genetic Translocation Diseases 0.000 description 1
- DHNWZLGBTPUTQQ-QEJZJMRPSA-N Gln-Asp-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)N)N DHNWZLGBTPUTQQ-QEJZJMRPSA-N 0.000 description 1
- XKBASPWPBXNVLQ-WDSKDSINSA-N Gln-Gly-Asn Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O XKBASPWPBXNVLQ-WDSKDSINSA-N 0.000 description 1
- GQZDDFRXSDGUNG-YVNDNENWSA-N Gln-Ile-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(O)=O GQZDDFRXSDGUNG-YVNDNENWSA-N 0.000 description 1
- AQPZYBSRDRZBAG-AVGNSLFASA-N Gln-Phe-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N AQPZYBSRDRZBAG-AVGNSLFASA-N 0.000 description 1
- YRHZWVKUFWCEPW-GLLZPBPUSA-N Gln-Thr-Gln Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N)O YRHZWVKUFWCEPW-GLLZPBPUSA-N 0.000 description 1
- ITYRYNUZHPNCIK-GUBZILKMSA-N Glu-Ala-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O ITYRYNUZHPNCIK-GUBZILKMSA-N 0.000 description 1
- NADWTMLCUDMDQI-ACZMJKKPSA-N Glu-Asp-Cys Chemical compound C(CC(=O)O)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N NADWTMLCUDMDQI-ACZMJKKPSA-N 0.000 description 1
- IESFZVCAVACGPH-PEFMBERDSA-N Glu-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CCC(O)=O IESFZVCAVACGPH-PEFMBERDSA-N 0.000 description 1
- CKOFNWCLWRYUHK-XHNCKOQMSA-N Glu-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)N)C(=O)O CKOFNWCLWRYUHK-XHNCKOQMSA-N 0.000 description 1
- UENPHLAAKDPZQY-XKBZYTNZSA-N Glu-Cys-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(=O)O)N)O UENPHLAAKDPZQY-XKBZYTNZSA-N 0.000 description 1
- HUFCEIHAFNVSNR-IHRRRGAJSA-N Glu-Gln-Tyr Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 HUFCEIHAFNVSNR-IHRRRGAJSA-N 0.000 description 1
- HNVFSTLPVJWIDV-CIUDSAMLSA-N Glu-Glu-Gln Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O HNVFSTLPVJWIDV-CIUDSAMLSA-N 0.000 description 1
- AIGROOHQXCACHL-WDSKDSINSA-N Glu-Gly-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](C)C(O)=O AIGROOHQXCACHL-WDSKDSINSA-N 0.000 description 1
- WRNAXCVRSBBKGS-BQBZGAKWSA-N Glu-Gly-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O WRNAXCVRSBBKGS-BQBZGAKWSA-N 0.000 description 1
- MWMJCGBSIORNCD-AVGNSLFASA-N Glu-Leu-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O MWMJCGBSIORNCD-AVGNSLFASA-N 0.000 description 1
- IVGJYOOGJLFKQE-AVGNSLFASA-N Glu-Leu-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N IVGJYOOGJLFKQE-AVGNSLFASA-N 0.000 description 1
- NJCALAAIGREHDR-WDCWCFNPSA-N Glu-Leu-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O NJCALAAIGREHDR-WDCWCFNPSA-N 0.000 description 1
- QDMVXRNLOPTPIE-WDCWCFNPSA-N Glu-Lys-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QDMVXRNLOPTPIE-WDCWCFNPSA-N 0.000 description 1
- AAJHGGDRKHYSDH-GUBZILKMSA-N Glu-Pro-Gln Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CCC(=O)O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O AAJHGGDRKHYSDH-GUBZILKMSA-N 0.000 description 1
- ALMBZBOCGSVSAI-ACZMJKKPSA-N Glu-Ser-Asn Chemical compound C(CC(=O)O)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)N)C(=O)O)N ALMBZBOCGSVSAI-ACZMJKKPSA-N 0.000 description 1
- YQAQQKPWFOBSMU-WDCWCFNPSA-N Glu-Thr-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O YQAQQKPWFOBSMU-WDCWCFNPSA-N 0.000 description 1
- BPCLDCNZBUYGOD-BPUTZDHNSA-N Glu-Trp-Glu Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)N)C(=O)N[C@@H](CCC(O)=O)C(O)=O)=CNC2=C1 BPCLDCNZBUYGOD-BPUTZDHNSA-N 0.000 description 1
- MFYLRRCYBBJYPI-JYJNAYRXSA-N Glu-Tyr-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N)O MFYLRRCYBBJYPI-JYJNAYRXSA-N 0.000 description 1
- ZALGPUWUVHOGAE-GVXVVHGQSA-N Glu-Val-His Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CCC(=O)O)N ZALGPUWUVHOGAE-GVXVVHGQSA-N 0.000 description 1
- ZYRXTRTUCAVNBQ-GVXVVHGQSA-N Glu-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N ZYRXTRTUCAVNBQ-GVXVVHGQSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- CLODWIOAKCSBAN-BQBZGAKWSA-N Gly-Arg-Asp Chemical compound NC(N)=NCCC[C@H](NC(=O)CN)C(=O)N[C@@H](CC(O)=O)C(O)=O CLODWIOAKCSBAN-BQBZGAKWSA-N 0.000 description 1
- RQZGFWKQLPJOEQ-YUMQZZPRSA-N Gly-Arg-Gln Chemical compound C(C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)CN)CN=C(N)N RQZGFWKQLPJOEQ-YUMQZZPRSA-N 0.000 description 1
- UXJHNZODTMHWRD-WHFBIAKZSA-N Gly-Asn-Ala Chemical compound [H]NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(O)=O UXJHNZODTMHWRD-WHFBIAKZSA-N 0.000 description 1
- GGEJHJIXRBTJPD-BYPYZUCNSA-N Gly-Asn-Gly Chemical compound NCC(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O GGEJHJIXRBTJPD-BYPYZUCNSA-N 0.000 description 1
- QPDUVFSVVAOUHE-XVKPBYJWSA-N Gly-Gln-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)CN)C(O)=O QPDUVFSVVAOUHE-XVKPBYJWSA-N 0.000 description 1
- BUEFQXUHTUZXHR-LURJTMIESA-N Gly-Gly-Pro zwitterion Chemical compound NCC(=O)NCC(=O)N1CCC[C@H]1C(O)=O BUEFQXUHTUZXHR-LURJTMIESA-N 0.000 description 1
- TWTPDFFBLQEBOE-IUCAKERBSA-N Gly-Leu-Gln Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O TWTPDFFBLQEBOE-IUCAKERBSA-N 0.000 description 1
- CLNSYANKYVMZNM-UWVGGRQHSA-N Gly-Lys-Arg Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)N[C@H](C(O)=O)CCCN=C(N)N CLNSYANKYVMZNM-UWVGGRQHSA-N 0.000 description 1
- GMTXWRIDLGTVFC-IUCAKERBSA-N Gly-Lys-Glu Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O GMTXWRIDLGTVFC-IUCAKERBSA-N 0.000 description 1
- QAMMIGULQSIRCD-IRXDYDNUSA-N Gly-Phe-Tyr Chemical compound C([C@H](NC(=O)C[NH3+])C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C([O-])=O)C1=CC=CC=C1 QAMMIGULQSIRCD-IRXDYDNUSA-N 0.000 description 1
- VDCRBJACQKOSMS-JSGCOSHPSA-N Gly-Phe-Val Chemical compound [H]NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(O)=O VDCRBJACQKOSMS-JSGCOSHPSA-N 0.000 description 1
- YOBGUCWZPXJHTN-BQBZGAKWSA-N Gly-Ser-Arg Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N YOBGUCWZPXJHTN-BQBZGAKWSA-N 0.000 description 1
- OHUKZZYSJBKFRR-WHFBIAKZSA-N Gly-Ser-Asp Chemical compound [H]NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O OHUKZZYSJBKFRR-WHFBIAKZSA-N 0.000 description 1
- FFALDIDGPLUDKV-ZDLURKLDSA-N Gly-Thr-Ser Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O FFALDIDGPLUDKV-ZDLURKLDSA-N 0.000 description 1
- WTUSRDZLLWGYAT-KCTSRDHCSA-N Gly-Trp-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)NC(=O)CN WTUSRDZLLWGYAT-KCTSRDHCSA-N 0.000 description 1
- GBYYQVBXFVDJPJ-WLTAIBSBSA-N Gly-Tyr-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)CN)O GBYYQVBXFVDJPJ-WLTAIBSBSA-N 0.000 description 1
- SYOJVRNQCXYEOV-XVKPBYJWSA-N Gly-Val-Glu Chemical compound [H]NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O SYOJVRNQCXYEOV-XVKPBYJWSA-N 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100022132 High affinity immunoglobulin epsilon receptor subunit gamma Human genes 0.000 description 1
- 108091010847 High affinity immunoglobulin epsilon receptor subunit gamma Proteins 0.000 description 1
- BIAKMWKJMQLZOJ-ZKWXMUAHSA-N His-Ala-Ala Chemical compound C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1cnc[nH]1)C(O)=O BIAKMWKJMQLZOJ-ZKWXMUAHSA-N 0.000 description 1
- WMKXFMUJRCEGRP-SRVKXCTJSA-N His-Asn-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)N WMKXFMUJRCEGRP-SRVKXCTJSA-N 0.000 description 1
- FYVHHKMHFPMBBG-GUBZILKMSA-N His-Gln-Asp Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N FYVHHKMHFPMBBG-GUBZILKMSA-N 0.000 description 1
- HVCRQRQPIIRNLY-IUCAKERBSA-N His-Gln-Gly Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)NCC(=O)O)N HVCRQRQPIIRNLY-IUCAKERBSA-N 0.000 description 1
- AKEDPWJFQULLPE-IUCAKERBSA-N His-Glu-Gly Chemical compound N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O AKEDPWJFQULLPE-IUCAKERBSA-N 0.000 description 1
- CNHSMSFYVARZLI-YJRXYDGGSA-N His-His-Thr Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CNHSMSFYVARZLI-YJRXYDGGSA-N 0.000 description 1
- BXOLYFJYQQRQDJ-MXAVVETBSA-N His-Leu-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CN=CN1)N BXOLYFJYQQRQDJ-MXAVVETBSA-N 0.000 description 1
- JGFWUKYIQAEYAH-DCAQKATOSA-N His-Ser-Val Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O JGFWUKYIQAEYAH-DCAQKATOSA-N 0.000 description 1
- BRQKGRLDDDQWQJ-MBLNEYKQSA-N His-Thr-Ala Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O BRQKGRLDDDQWQJ-MBLNEYKQSA-N 0.000 description 1
- FOCSWPCHUDVNLP-PMVMPFDFSA-N His-Trp-Tyr Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)NC(=O)[C@H](CC4=CN=CN4)N FOCSWPCHUDVNLP-PMVMPFDFSA-N 0.000 description 1
- CSTDQOOBZBAJKE-BWAGICSOSA-N His-Tyr-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CC2=CN=CN2)N)O CSTDQOOBZBAJKE-BWAGICSOSA-N 0.000 description 1
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000840258 Homo sapiens Immunoglobulin J chain Proteins 0.000 description 1
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 1
- 101000830600 Homo sapiens Tumor necrosis factor ligand superfamily member 13 Proteins 0.000 description 1
- 101000851434 Homo sapiens Tumor necrosis factor ligand superfamily member 13B Proteins 0.000 description 1
- 101000795167 Homo sapiens Tumor necrosis factor receptor superfamily member 13B Proteins 0.000 description 1
- MKWSZEHGHSLNPF-NAKRPEOUSA-N Ile-Ala-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)O)N MKWSZEHGHSLNPF-NAKRPEOUSA-N 0.000 description 1
- VQUCKIAECLVLAD-SVSWQMSJSA-N Ile-Cys-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N VQUCKIAECLVLAD-SVSWQMSJSA-N 0.000 description 1
- TWPSALMCEHCIOY-YTFOTSKYSA-N Ile-Ile-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)O)N TWPSALMCEHCIOY-YTFOTSKYSA-N 0.000 description 1
- PFPUFNLHBXKPHY-HTFCKZLJSA-N Ile-Ile-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)O)N PFPUFNLHBXKPHY-HTFCKZLJSA-N 0.000 description 1
- RQQCJTLBSJMVCR-DSYPUSFNSA-N Ile-Leu-Trp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)N RQQCJTLBSJMVCR-DSYPUSFNSA-N 0.000 description 1
- AKOYRLRUFBZOSP-BJDJZHNGSA-N Ile-Lys-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)O)N AKOYRLRUFBZOSP-BJDJZHNGSA-N 0.000 description 1
- IALVDKNUFSTICJ-GMOBBJLQSA-N Ile-Met-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)O)N IALVDKNUFSTICJ-GMOBBJLQSA-N 0.000 description 1
- FBGXMKUWQFPHFB-JBDRJPRFSA-N Ile-Ser-Cys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N FBGXMKUWQFPHFB-JBDRJPRFSA-N 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102100029571 Immunoglobulin J chain Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 238000012404 In vitro experiment Methods 0.000 description 1
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- PWWVAXIEGOYWEE-UHFFFAOYSA-N Isophenergan Chemical compound C1=CC=C2N(CC(C)N(C)C)C3=CC=CC=C3SC2=C1 PWWVAXIEGOYWEE-UHFFFAOYSA-N 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- HGCNKOLVKRAVHD-UHFFFAOYSA-N L-Met-L-Phe Natural products CSCCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 HGCNKOLVKRAVHD-UHFFFAOYSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- TYYLDKGBCJGJGW-UHFFFAOYSA-N L-tryptophan-L-tyrosine Natural products C=1NC2=CC=CC=C2C=1CC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 TYYLDKGBCJGJGW-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- BQSLGJHIAGOZCD-CIUDSAMLSA-N Leu-Ala-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O BQSLGJHIAGOZCD-CIUDSAMLSA-N 0.000 description 1
- OIARJGNVARWKFP-YUMQZZPRSA-N Leu-Asn-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O OIARJGNVARWKFP-YUMQZZPRSA-N 0.000 description 1
- TWQIYNGNYNJUFM-NHCYSSNCSA-N Leu-Asn-Val Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O TWQIYNGNYNJUFM-NHCYSSNCSA-N 0.000 description 1
- PVMPDMIKUVNOBD-CIUDSAMLSA-N Leu-Asp-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O PVMPDMIKUVNOBD-CIUDSAMLSA-N 0.000 description 1
- RSFGIMMPWAXNML-MNXVOIDGSA-N Leu-Gln-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O RSFGIMMPWAXNML-MNXVOIDGSA-N 0.000 description 1
- LLBQJYDYOLIQAI-JYJNAYRXSA-N Leu-Glu-Tyr Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O LLBQJYDYOLIQAI-JYJNAYRXSA-N 0.000 description 1
- VWHGTYCRDRBSFI-ZETCQYMHSA-N Leu-Gly-Gly Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)NCC(O)=O VWHGTYCRDRBSFI-ZETCQYMHSA-N 0.000 description 1
- QPXBPQUGXHURGP-UWVGGRQHSA-N Leu-Gly-Met Chemical compound CC(C)C[C@@H](C(=O)NCC(=O)N[C@@H](CCSC)C(=O)O)N QPXBPQUGXHURGP-UWVGGRQHSA-N 0.000 description 1
- VGPCJSXPPOQPBK-YUMQZZPRSA-N Leu-Gly-Ser Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O VGPCJSXPPOQPBK-YUMQZZPRSA-N 0.000 description 1
- BTNXKBVLWJBTNR-SRVKXCTJSA-N Leu-His-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(O)=O BTNXKBVLWJBTNR-SRVKXCTJSA-N 0.000 description 1
- BKTXKJMNTSMJDQ-AVGNSLFASA-N Leu-His-Gln Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N BKTXKJMNTSMJDQ-AVGNSLFASA-N 0.000 description 1
- CSFVADKICPDRRF-KKUMJFAQSA-N Leu-His-Leu Chemical compound CC(C)C[C@H]([NH3+])C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C([O-])=O)CC1=CN=CN1 CSFVADKICPDRRF-KKUMJFAQSA-N 0.000 description 1
- AUBMZAMQCOYSIC-MNXVOIDGSA-N Leu-Ile-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(O)=O AUBMZAMQCOYSIC-MNXVOIDGSA-N 0.000 description 1
- FIICHHJDINDXKG-IHPCNDPISA-N Leu-Lys-Trp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O FIICHHJDINDXKG-IHPCNDPISA-N 0.000 description 1
- AUNMOHYWTAPQLA-XUXIUFHCSA-N Leu-Met-Ile Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O AUNMOHYWTAPQLA-XUXIUFHCSA-N 0.000 description 1
- KQFZKDITNUEVFJ-JYJNAYRXSA-N Leu-Phe-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(C)C)CC1=CC=CC=C1 KQFZKDITNUEVFJ-JYJNAYRXSA-N 0.000 description 1
- WMIOEVKKYIMVKI-DCAQKATOSA-N Leu-Pro-Ala Chemical compound [H]N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(O)=O WMIOEVKKYIMVKI-DCAQKATOSA-N 0.000 description 1
- RGUXWMDNCPMQFB-YUMQZZPRSA-N Leu-Ser-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O RGUXWMDNCPMQFB-YUMQZZPRSA-N 0.000 description 1
- LINKCQUOMUDLKN-KATARQTJSA-N Leu-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC(C)C)N)O LINKCQUOMUDLKN-KATARQTJSA-N 0.000 description 1
- DAYQSYGBCUKVKT-VOAKCMCISA-N Leu-Thr-Lys Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(O)=O DAYQSYGBCUKVKT-VOAKCMCISA-N 0.000 description 1
- VUBIPAHVHMZHCM-KKUMJFAQSA-N Leu-Tyr-Ser Chemical compound CC(C)C[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CO)C(O)=O)CC1=CC=C(O)C=C1 VUBIPAHVHMZHCM-KKUMJFAQSA-N 0.000 description 1
- MVJRBCJCRYGCKV-GVXVVHGQSA-N Leu-Val-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O MVJRBCJCRYGCKV-GVXVVHGQSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- KCXUCYYZNZFGLL-SRVKXCTJSA-N Lys-Ala-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O KCXUCYYZNZFGLL-SRVKXCTJSA-N 0.000 description 1
- UWKNTTJNVSYXPC-CIUDSAMLSA-N Lys-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN UWKNTTJNVSYXPC-CIUDSAMLSA-N 0.000 description 1
- NPBGTPKLVJEOBE-IUCAKERBSA-N Lys-Arg Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=N NPBGTPKLVJEOBE-IUCAKERBSA-N 0.000 description 1
- CLBGMWIYPYAZPR-AVGNSLFASA-N Lys-Arg-Arg Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O CLBGMWIYPYAZPR-AVGNSLFASA-N 0.000 description 1
- YKIRNDPUWONXQN-GUBZILKMSA-N Lys-Asn-Gln Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N YKIRNDPUWONXQN-GUBZILKMSA-N 0.000 description 1
- QUCDKEKDPYISNX-HJGDQZAQSA-N Lys-Asn-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O QUCDKEKDPYISNX-HJGDQZAQSA-N 0.000 description 1
- SVJRVFPSHPGWFF-DCAQKATOSA-N Lys-Cys-Arg Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SVJRVFPSHPGWFF-DCAQKATOSA-N 0.000 description 1
- GRADYHMSAUIKPS-DCAQKATOSA-N Lys-Glu-Gln Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O GRADYHMSAUIKPS-DCAQKATOSA-N 0.000 description 1
- DUTMKEAPLLUGNO-JYJNAYRXSA-N Lys-Glu-Phe Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O DUTMKEAPLLUGNO-JYJNAYRXSA-N 0.000 description 1
- VMTYLUGCXIEDMV-QWRGUYRKSA-N Lys-Leu-Gly Chemical compound OC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCCCN VMTYLUGCXIEDMV-QWRGUYRKSA-N 0.000 description 1
- OIQSIMFSVLLWBX-VOAKCMCISA-N Lys-Leu-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OIQSIMFSVLLWBX-VOAKCMCISA-N 0.000 description 1
- AFLBTVGQCQLOFJ-AVGNSLFASA-N Lys-Pro-Arg Chemical compound NCCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(O)=O AFLBTVGQCQLOFJ-AVGNSLFASA-N 0.000 description 1
- IOQWIOPSKJOEKI-SRVKXCTJSA-N Lys-Ser-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O IOQWIOPSKJOEKI-SRVKXCTJSA-N 0.000 description 1
- IEVXCWPVBYCJRZ-IXOXFDKPSA-N Lys-Thr-His Chemical compound NCCCC[C@H](N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 IEVXCWPVBYCJRZ-IXOXFDKPSA-N 0.000 description 1
- DLCAXBGXGOVUCD-PPCPHDFISA-N Lys-Thr-Ile Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O DLCAXBGXGOVUCD-PPCPHDFISA-N 0.000 description 1
- CAVRAQIDHUPECU-UVOCVTCTSA-N Lys-Thr-Thr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CAVRAQIDHUPECU-UVOCVTCTSA-N 0.000 description 1
- XYLSGAWRCZECIQ-JYJNAYRXSA-N Lys-Tyr-Glu Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(O)=O)CC1=CC=C(O)C=C1 XYLSGAWRCZECIQ-JYJNAYRXSA-N 0.000 description 1
- GILLQRYAWOMHED-DCAQKATOSA-N Lys-Val-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN GILLQRYAWOMHED-DCAQKATOSA-N 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- QEVRUYFHWJJUHZ-DCAQKATOSA-N Met-Ala-Leu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC(C)C QEVRUYFHWJJUHZ-DCAQKATOSA-N 0.000 description 1
- RKIIYGUHIQJCBW-SRVKXCTJSA-N Met-His-Glu Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(O)=O)C(O)=O RKIIYGUHIQJCBW-SRVKXCTJSA-N 0.000 description 1
- FWAHLGXNBLWIKB-NAKRPEOUSA-N Met-Ile-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H](N)CCSC FWAHLGXNBLWIKB-NAKRPEOUSA-N 0.000 description 1
- HWROAFGWPQUPTE-OSUNSFLBSA-N Met-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](CCSC)N HWROAFGWPQUPTE-OSUNSFLBSA-N 0.000 description 1
- HLZORBMOISUNIV-DCAQKATOSA-N Met-Ser-Leu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CC(C)C HLZORBMOISUNIV-DCAQKATOSA-N 0.000 description 1
- RKRFGIBULDYDPF-XIRDDKMYSA-N Met-Trp-Gln Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N RKRFGIBULDYDPF-XIRDDKMYSA-N 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 101100425747 Mus musculus Tnfrsf17 gene Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- XZFYRXDAULDNFX-UHFFFAOYSA-N N-L-cysteinyl-L-phenylalanine Natural products SCC(N)C(=O)NC(C(O)=O)CC1=CC=CC=C1 XZFYRXDAULDNFX-UHFFFAOYSA-N 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 1
- BQVUABVGYYSDCJ-UHFFFAOYSA-N Nalpha-L-Leucyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)C(N)CC(C)C)C(O)=O)=CNC2=C1 BQVUABVGYYSDCJ-UHFFFAOYSA-N 0.000 description 1
- 206010031264 Osteonecrosis Diseases 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- BJEYSVHMGIJORT-NHCYSSNCSA-N Phe-Ala-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=CC=C1 BJEYSVHMGIJORT-NHCYSSNCSA-N 0.000 description 1
- LBSARGIQACMGDF-WBAXXEDZSA-N Phe-Ala-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 LBSARGIQACMGDF-WBAXXEDZSA-N 0.000 description 1
- JOXIIFVCSATTDH-IHPCNDPISA-N Phe-Asn-Trp Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)O)N JOXIIFVCSATTDH-IHPCNDPISA-N 0.000 description 1
- VADLTGVIOIOKGM-BZSNNMDCSA-N Phe-His-Leu Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC=CC=1)C1=CN=CN1 VADLTGVIOIOKGM-BZSNNMDCSA-N 0.000 description 1
- YTILBRIUASDGBL-BZSNNMDCSA-N Phe-Leu-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 YTILBRIUASDGBL-BZSNNMDCSA-N 0.000 description 1
- MSHZERMPZKCODG-ACRUOGEOSA-N Phe-Leu-Phe Chemical compound C([C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 MSHZERMPZKCODG-ACRUOGEOSA-N 0.000 description 1
- KNYPNEYICHHLQL-ACRUOGEOSA-N Phe-Leu-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 KNYPNEYICHHLQL-ACRUOGEOSA-N 0.000 description 1
- JDMKQHSHKJHAHR-UHFFFAOYSA-N Phe-Phe-Leu-Tyr Natural products C=1C=C(O)C=CC=1CC(C(O)=O)NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)CC1=CC=CC=C1 JDMKQHSHKJHAHR-UHFFFAOYSA-N 0.000 description 1
- ZJPGOXWRFNKIQL-JYJNAYRXSA-N Phe-Pro-Pro Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(O)=O)C1=CC=CC=C1 ZJPGOXWRFNKIQL-JYJNAYRXSA-N 0.000 description 1
- MRWOVVNKSXXLRP-IHPCNDPISA-N Phe-Ser-Trp Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O MRWOVVNKSXXLRP-IHPCNDPISA-N 0.000 description 1
- RAGOJJCBGXARPO-XVSYOHENSA-N Phe-Thr-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H]([C@H](O)C)NC(=O)[C@@H](N)CC1=CC=CC=C1 RAGOJJCBGXARPO-XVSYOHENSA-N 0.000 description 1
- YDUGVDGFKNXFPL-IXOXFDKPSA-N Phe-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N)O YDUGVDGFKNXFPL-IXOXFDKPSA-N 0.000 description 1
- OLZVAVSJEUAOHI-UNQGMJICSA-N Phe-Thr-Met Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N)O OLZVAVSJEUAOHI-UNQGMJICSA-N 0.000 description 1
- ZVJGAXNBBKPYOE-HKUYNNGSSA-N Phe-Trp-Gly Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)NCC(O)=O)C1=CC=CC=C1 ZVJGAXNBBKPYOE-HKUYNNGSSA-N 0.000 description 1
- QTDBZORPVYTRJU-KKXDTOCCSA-N Phe-Tyr-Ala Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(O)=O QTDBZORPVYTRJU-KKXDTOCCSA-N 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- IWNOFCGBMSFTBC-CIUDSAMLSA-N Pro-Ala-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(O)=O IWNOFCGBMSFTBC-CIUDSAMLSA-N 0.000 description 1
- IFMDQWDAJUMMJC-DCAQKATOSA-N Pro-Ala-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O IFMDQWDAJUMMJC-DCAQKATOSA-N 0.000 description 1
- HMNSRTLZAJHSIK-YUMQZZPRSA-N Pro-Arg Chemical compound NC(=N)NCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1 HMNSRTLZAJHSIK-YUMQZZPRSA-N 0.000 description 1
- NHDVNAKDACFHPX-GUBZILKMSA-N Pro-Arg-Ala Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O NHDVNAKDACFHPX-GUBZILKMSA-N 0.000 description 1
- BNBBNGZZKQUWCD-IUCAKERBSA-N Pro-Arg-Gly Chemical compound NC(N)=NCCC[C@@H](C(=O)NCC(O)=O)NC(=O)[C@@H]1CCCN1 BNBBNGZZKQUWCD-IUCAKERBSA-N 0.000 description 1
- KIPIKSXPPLABPN-CIUDSAMLSA-N Pro-Glu-Asn Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1 KIPIKSXPPLABPN-CIUDSAMLSA-N 0.000 description 1
- NXEYSLRNNPWCRN-SRVKXCTJSA-N Pro-Glu-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O NXEYSLRNNPWCRN-SRVKXCTJSA-N 0.000 description 1
- PTLOFJZJADCNCD-DCAQKATOSA-N Pro-Glu-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1 PTLOFJZJADCNCD-DCAQKATOSA-N 0.000 description 1
- VPEVBAUSTBWQHN-NHCYSSNCSA-N Pro-Glu-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O VPEVBAUSTBWQHN-NHCYSSNCSA-N 0.000 description 1
- UIMCLYYSUCIUJM-UWVGGRQHSA-N Pro-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 UIMCLYYSUCIUJM-UWVGGRQHSA-N 0.000 description 1
- KWMUAKQOVYCQJQ-ZPFDUUQYSA-N Pro-Ile-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@@H]1CCCN1 KWMUAKQOVYCQJQ-ZPFDUUQYSA-N 0.000 description 1
- CFVRJNZJQHDQPP-CYDGBPFRSA-N Pro-Ile-Met Chemical compound CSCC[C@@H](C(O)=O)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H]1CCCN1 CFVRJNZJQHDQPP-CYDGBPFRSA-N 0.000 description 1
- MRYUJHGPZQNOAD-IHRRRGAJSA-N Pro-Leu-Lys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@@H]1CCCN1 MRYUJHGPZQNOAD-IHRRRGAJSA-N 0.000 description 1
- MCWHYUWXVNRXFV-RWMBFGLXSA-N Pro-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@@H]2CCCN2 MCWHYUWXVNRXFV-RWMBFGLXSA-N 0.000 description 1
- OFGUOWQVEGTVNU-DCAQKATOSA-N Pro-Lys-Ala Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O OFGUOWQVEGTVNU-DCAQKATOSA-N 0.000 description 1
- ZLXKLMHAMDENIO-DCAQKATOSA-N Pro-Lys-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(O)=O ZLXKLMHAMDENIO-DCAQKATOSA-N 0.000 description 1
- ULWBBFKQBDNGOY-RWMBFGLXSA-N Pro-Lys-Pro Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CCCCN)C(=O)N2CCC[C@@H]2C(=O)O ULWBBFKQBDNGOY-RWMBFGLXSA-N 0.000 description 1
- HWLKHNDRXWTFTN-GUBZILKMSA-N Pro-Pro-Cys Chemical compound C1C[C@H](NC1)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CS)C(=O)O HWLKHNDRXWTFTN-GUBZILKMSA-N 0.000 description 1
- RFWXYTJSVDUBBZ-DCAQKATOSA-N Pro-Pro-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 RFWXYTJSVDUBBZ-DCAQKATOSA-N 0.000 description 1
- PCWLNNZTBJTZRN-AVGNSLFASA-N Pro-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 PCWLNNZTBJTZRN-AVGNSLFASA-N 0.000 description 1
- SBVPYBFMIGDIDX-SRVKXCTJSA-N Pro-Pro-Pro Chemical compound OC(=O)[C@@H]1CCCN1C(=O)[C@H]1N(C(=O)[C@H]2NCCC2)CCC1 SBVPYBFMIGDIDX-SRVKXCTJSA-N 0.000 description 1
- KBUAPZAZPWNYSW-SRVKXCTJSA-N Pro-Pro-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 KBUAPZAZPWNYSW-SRVKXCTJSA-N 0.000 description 1
- GMJDSFYVTAMIBF-FXQIFTODSA-N Pro-Ser-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O GMJDSFYVTAMIBF-FXQIFTODSA-N 0.000 description 1
- RNEFESSBTOQSAC-DCAQKATOSA-N Pro-Ser-His Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O RNEFESSBTOQSAC-DCAQKATOSA-N 0.000 description 1
- LNICFEXCAHIJOR-DCAQKATOSA-N Pro-Ser-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O LNICFEXCAHIJOR-DCAQKATOSA-N 0.000 description 1
- PRKWBYCXBBSLSK-GUBZILKMSA-N Pro-Ser-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O PRKWBYCXBBSLSK-GUBZILKMSA-N 0.000 description 1
- FDMCIBSQRKFSTJ-RHYQMDGZSA-N Pro-Thr-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O FDMCIBSQRKFSTJ-RHYQMDGZSA-N 0.000 description 1
- KHRLUIPIMIQFGT-AVGNSLFASA-N Pro-Val-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O KHRLUIPIMIQFGT-AVGNSLFASA-N 0.000 description 1
- YDTUEBLEAVANFH-RCWTZXSCSA-N Pro-Val-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1 YDTUEBLEAVANFH-RCWTZXSCSA-N 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102220472894 Receptor-type tyrosine-protein phosphatase beta_R94K_mutation Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 208000001647 Renal Insufficiency Diseases 0.000 description 1
- UEJYSALTSUZXFV-SRVKXCTJSA-N Rigin Chemical compound NCC(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(O)=O UEJYSALTSUZXFV-SRVKXCTJSA-N 0.000 description 1
- 238000011579 SCID mouse model Methods 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- OYEDZGNMSBZCIM-XGEHTFHBSA-N Ser-Arg-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OYEDZGNMSBZCIM-XGEHTFHBSA-N 0.000 description 1
- HZWAHWQZPSXNCB-BPUTZDHNSA-N Ser-Arg-Trp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O HZWAHWQZPSXNCB-BPUTZDHNSA-N 0.000 description 1
- VAUMZJHYZQXZBQ-WHFBIAKZSA-N Ser-Asn-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O VAUMZJHYZQXZBQ-WHFBIAKZSA-N 0.000 description 1
- QPFJSHSJFIYDJZ-GHCJXIJMSA-N Ser-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CO QPFJSHSJFIYDJZ-GHCJXIJMSA-N 0.000 description 1
- BYIROAKULFFTEK-CIUDSAMLSA-N Ser-Asp-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CO BYIROAKULFFTEK-CIUDSAMLSA-N 0.000 description 1
- SWSRFJZZMNLMLY-ZKWXMUAHSA-N Ser-Asp-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O SWSRFJZZMNLMLY-ZKWXMUAHSA-N 0.000 description 1
- MOVJSUIKUNCVMG-ZLUOBGJFSA-N Ser-Cys-Ser Chemical compound C([C@@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)O)N)O MOVJSUIKUNCVMG-ZLUOBGJFSA-N 0.000 description 1
- LALNXSXEYFUUDD-GUBZILKMSA-N Ser-Glu-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O LALNXSXEYFUUDD-GUBZILKMSA-N 0.000 description 1
- KDGARKCAKHBEDB-NKWVEPMBSA-N Ser-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CO)N)C(=O)O KDGARKCAKHBEDB-NKWVEPMBSA-N 0.000 description 1
- HMRAQFJFTOLDKW-GUBZILKMSA-N Ser-His-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(O)=O)C(O)=O HMRAQFJFTOLDKW-GUBZILKMSA-N 0.000 description 1
- CAOYHZOWXFFAIR-CIUDSAMLSA-N Ser-His-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O CAOYHZOWXFFAIR-CIUDSAMLSA-N 0.000 description 1
- LQESNKGTTNHZPZ-GHCJXIJMSA-N Ser-Ile-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O LQESNKGTTNHZPZ-GHCJXIJMSA-N 0.000 description 1
- UIPXCLNLUUAMJU-JBDRJPRFSA-N Ser-Ile-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O UIPXCLNLUUAMJU-JBDRJPRFSA-N 0.000 description 1
- ZIFYDQAFEMIZII-GUBZILKMSA-N Ser-Leu-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O ZIFYDQAFEMIZII-GUBZILKMSA-N 0.000 description 1
- KCGIREHVWRXNDH-GARJFASQSA-N Ser-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N KCGIREHVWRXNDH-GARJFASQSA-N 0.000 description 1
- GVIGVIOEYBOTCB-XIRDDKMYSA-N Ser-Leu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CO)CC(C)C)C(O)=O)=CNC2=C1 GVIGVIOEYBOTCB-XIRDDKMYSA-N 0.000 description 1
- GZSZPKSBVAOGIE-CIUDSAMLSA-N Ser-Lys-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O GZSZPKSBVAOGIE-CIUDSAMLSA-N 0.000 description 1
- PPNPDKGQRFSCAC-CIUDSAMLSA-N Ser-Lys-Asp Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(O)=O)C(O)=O PPNPDKGQRFSCAC-CIUDSAMLSA-N 0.000 description 1
- XUDRHBPSPAPDJP-SRVKXCTJSA-N Ser-Lys-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CO XUDRHBPSPAPDJP-SRVKXCTJSA-N 0.000 description 1
- RRVFEDGUXSYWOW-BZSNNMDCSA-N Ser-Phe-Phe Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O RRVFEDGUXSYWOW-BZSNNMDCSA-N 0.000 description 1
- QPPYAWVLAVXISR-DCAQKATOSA-N Ser-Pro-His Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CO)N)C(=O)N[C@@H](CC2=CN=CN2)C(=O)O QPPYAWVLAVXISR-DCAQKATOSA-N 0.000 description 1
- DYEGLQRVMBWQLD-IXOXFDKPSA-N Ser-Thr-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H](CO)N)O DYEGLQRVMBWQLD-IXOXFDKPSA-N 0.000 description 1
- ZVBCMFDJIMUELU-BZSNNMDCSA-N Ser-Tyr-Phe Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CO)N ZVBCMFDJIMUELU-BZSNNMDCSA-N 0.000 description 1
- OQSQCUWQOIHECT-YJRXYDGGSA-N Ser-Tyr-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O OQSQCUWQOIHECT-YJRXYDGGSA-N 0.000 description 1
- YEDSOSIKVUMIJE-DCAQKATOSA-N Ser-Val-Leu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O YEDSOSIKVUMIJE-DCAQKATOSA-N 0.000 description 1
- LGIMRDKGABDMBN-DCAQKATOSA-N Ser-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CO)N LGIMRDKGABDMBN-DCAQKATOSA-N 0.000 description 1
- HNDMFDBQXYZSRM-IHRRRGAJSA-N Ser-Val-Phe Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O HNDMFDBQXYZSRM-IHRRRGAJSA-N 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- UKBSDLHIKIXJKH-HJGDQZAQSA-N Thr-Arg-Glu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O UKBSDLHIKIXJKH-HJGDQZAQSA-N 0.000 description 1
- YLXAMFZYJTZXFH-OLHMAJIHSA-N Thr-Asn-Asp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)O)N)O YLXAMFZYJTZXFH-OLHMAJIHSA-N 0.000 description 1
- JEDIEMIJYSRUBB-FOHZUACHSA-N Thr-Asp-Gly Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(O)=O JEDIEMIJYSRUBB-FOHZUACHSA-N 0.000 description 1
- ASJDFGOPDCVXTG-KATARQTJSA-N Thr-Cys-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(O)=O ASJDFGOPDCVXTG-KATARQTJSA-N 0.000 description 1
- KWQBJOUOSNJDRR-XAVMHZPKSA-N Thr-Cys-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)N1CCC[C@@H]1C(=O)O)N)O KWQBJOUOSNJDRR-XAVMHZPKSA-N 0.000 description 1
- LAFLAXHTDVNVEL-WDCWCFNPSA-N Thr-Gln-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCCN)C(=O)O)N)O LAFLAXHTDVNVEL-WDCWCFNPSA-N 0.000 description 1
- DIPIPFHFLPTCLK-LOKLDPHHSA-N Thr-Gln-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N1CCC[C@@H]1C(=O)O)N)O DIPIPFHFLPTCLK-LOKLDPHHSA-N 0.000 description 1
- BNGDYRRHRGOPHX-IFFSRLJSSA-N Thr-Glu-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)[C@@H](C)O)C(O)=O BNGDYRRHRGOPHX-IFFSRLJSSA-N 0.000 description 1
- NIEWSKWFURSECR-FOHZUACHSA-N Thr-Gly-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O NIEWSKWFURSECR-FOHZUACHSA-N 0.000 description 1
- SXAGUVRFGJSFKC-ZEILLAHLSA-N Thr-His-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O SXAGUVRFGJSFKC-ZEILLAHLSA-N 0.000 description 1
- ADPHPKGWVDHWML-PPCPHDFISA-N Thr-Ile-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)O)NC(=O)[C@H]([C@@H](C)O)N ADPHPKGWVDHWML-PPCPHDFISA-N 0.000 description 1
- JLNMFGCJODTXDH-WEDXCCLWSA-N Thr-Lys-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)NCC(O)=O JLNMFGCJODTXDH-WEDXCCLWSA-N 0.000 description 1
- WYLAVUAWOUVUCA-XVSYOHENSA-N Thr-Phe-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(O)=O)C(O)=O WYLAVUAWOUVUCA-XVSYOHENSA-N 0.000 description 1
- WNQJTLATMXYSEL-OEAJRASXSA-N Thr-Phe-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(C)C)C(O)=O WNQJTLATMXYSEL-OEAJRASXSA-N 0.000 description 1
- GFRIEEKFXOVPIR-RHYQMDGZSA-N Thr-Pro-Lys Chemical compound C[C@@H](O)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(O)=O GFRIEEKFXOVPIR-RHYQMDGZSA-N 0.000 description 1
- FWTFAZKJORVTIR-VZFHVOOUSA-N Thr-Ser-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O FWTFAZKJORVTIR-VZFHVOOUSA-N 0.000 description 1
- ZESGVALRVJIVLZ-VFCFLDTKSA-N Thr-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N1CCC[C@@H]1C(=O)O)N)O ZESGVALRVJIVLZ-VFCFLDTKSA-N 0.000 description 1
- BEZTUFWTPVOROW-KJEVXHAQSA-N Thr-Tyr-Arg Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N)O BEZTUFWTPVOROW-KJEVXHAQSA-N 0.000 description 1
- XVHAUVJXBFGUPC-RPTUDFQQSA-N Thr-Tyr-Phe Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O XVHAUVJXBFGUPC-RPTUDFQQSA-N 0.000 description 1
- FYBFTPLPAXZBOY-KKHAAJSZSA-N Thr-Val-Asp Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O FYBFTPLPAXZBOY-KKHAAJSZSA-N 0.000 description 1
- BKVICMPZWRNWOC-RHYQMDGZSA-N Thr-Val-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)[C@@H](C)O BKVICMPZWRNWOC-RHYQMDGZSA-N 0.000 description 1
- PWONLXBUSVIZPH-RHYQMDGZSA-N Thr-Val-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)O)N)O PWONLXBUSVIZPH-RHYQMDGZSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- BSSJIVIFAJKLEK-XIRDDKMYSA-N Trp-Cys-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N BSSJIVIFAJKLEK-XIRDDKMYSA-N 0.000 description 1
- DQDXHYIEITXNJY-BPUTZDHNSA-N Trp-Gln-Gln Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O)N DQDXHYIEITXNJY-BPUTZDHNSA-N 0.000 description 1
- LJCLHMPCYYXVPR-VJBMBRPKSA-N Trp-Gln-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC3=CNC4=CC=CC=C43)C(=O)O)N LJCLHMPCYYXVPR-VJBMBRPKSA-N 0.000 description 1
- XGFGVFMXDXALEV-XIRDDKMYSA-N Trp-Leu-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC1=CNC2=CC=CC=C21)N XGFGVFMXDXALEV-XIRDDKMYSA-N 0.000 description 1
- SSSDKJMQMZTMJP-BVSLBCMMSA-N Trp-Tyr-Val Chemical compound C([C@@H](C(=O)N[C@@H](C(C)C)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CC=C(O)C=C1 SSSDKJMQMZTMJP-BVSLBCMMSA-N 0.000 description 1
- UOXPLPBMEPLZBW-WDSOQIARSA-N Trp-Val-Lys Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(O)=O)=CNC2=C1 UOXPLPBMEPLZBW-WDSOQIARSA-N 0.000 description 1
- BURPTJBFWIOHEY-UWJYBYFXSA-N Tyr-Ala-Asp Chemical compound OC(=O)C[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 BURPTJBFWIOHEY-UWJYBYFXSA-N 0.000 description 1
- QYSBJAUCUKHSLU-JYJNAYRXSA-N Tyr-Arg-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(O)=O QYSBJAUCUKHSLU-JYJNAYRXSA-N 0.000 description 1
- SCCKSNREWHMKOJ-SRVKXCTJSA-N Tyr-Asn-Ser Chemical compound N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O SCCKSNREWHMKOJ-SRVKXCTJSA-N 0.000 description 1
- CTDPLKMBVALCGN-JSGCOSHPSA-N Tyr-Gly-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O CTDPLKMBVALCGN-JSGCOSHPSA-N 0.000 description 1
- LQGDFDYGDQEMGA-PXDAIIFMSA-N Tyr-Ile-Trp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)O)NC(=O)[C@H](CC3=CC=C(C=C3)O)N LQGDFDYGDQEMGA-PXDAIIFMSA-N 0.000 description 1
- KHCSOLAHNLOXJR-BZSNNMDCSA-N Tyr-Leu-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O KHCSOLAHNLOXJR-BZSNNMDCSA-N 0.000 description 1
- GITNQBVCEQBDQC-KKUMJFAQSA-N Tyr-Lys-Asn Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O GITNQBVCEQBDQC-KKUMJFAQSA-N 0.000 description 1
- GZUIDWDVMWZSMI-KKUMJFAQSA-N Tyr-Lys-Cys Chemical compound NCCCC[C@@H](C(=O)N[C@@H](CS)C(O)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 GZUIDWDVMWZSMI-KKUMJFAQSA-N 0.000 description 1
- BYAKMYBZADCNMN-JYJNAYRXSA-N Tyr-Lys-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(O)=O BYAKMYBZADCNMN-JYJNAYRXSA-N 0.000 description 1
- BGFCXQXETBDEHP-BZSNNMDCSA-N Tyr-Phe-Asn Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O BGFCXQXETBDEHP-BZSNNMDCSA-N 0.000 description 1
- YYLHVUCSTXXKBS-IHRRRGAJSA-N Tyr-Pro-Ser Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O YYLHVUCSTXXKBS-IHRRRGAJSA-N 0.000 description 1
- VPEFOFYNHBWFNQ-UFYCRDLUSA-N Tyr-Pro-Tyr Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 VPEFOFYNHBWFNQ-UFYCRDLUSA-N 0.000 description 1
- IEWKKXZRJLTIOV-AVGNSLFASA-N Tyr-Ser-Gln Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(O)=O IEWKKXZRJLTIOV-AVGNSLFASA-N 0.000 description 1
- NHOVZGFNTGMYMI-KKUMJFAQSA-N Tyr-Ser-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 NHOVZGFNTGMYMI-KKUMJFAQSA-N 0.000 description 1
- MDXLPNRXCFOBTL-BZSNNMDCSA-N Tyr-Ser-Tyr Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O MDXLPNRXCFOBTL-BZSNNMDCSA-N 0.000 description 1
- NZBSVMQZQMEUHI-WZLNRYEVSA-N Tyr-Thr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)N NZBSVMQZQMEUHI-WZLNRYEVSA-N 0.000 description 1
- PWKMJDQXKCENMF-MEYUZBJRSA-N Tyr-Thr-Leu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O PWKMJDQXKCENMF-MEYUZBJRSA-N 0.000 description 1
- MWUYSCVVPVITMW-IGNZVWTISA-N Tyr-Tyr-Ala Chemical compound C([C@@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 MWUYSCVVPVITMW-IGNZVWTISA-N 0.000 description 1
- SQUMHUZLJDUROQ-YDHLFZDLSA-N Tyr-Val-Asp Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(O)=O SQUMHUZLJDUROQ-YDHLFZDLSA-N 0.000 description 1
- CVUDMNSZAIZFAE-TUAOUCFPSA-N Val-Arg-Pro Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1CCC[C@@H]1C(=O)O)N CVUDMNSZAIZFAE-TUAOUCFPSA-N 0.000 description 1
- CVUDMNSZAIZFAE-UHFFFAOYSA-N Val-Arg-Pro Natural products NC(N)=NCCCC(NC(=O)C(N)C(C)C)C(=O)N1CCCC1C(O)=O CVUDMNSZAIZFAE-UHFFFAOYSA-N 0.000 description 1
- JLFKWDAZBRYCGX-ZKWXMUAHSA-N Val-Asn-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)O)N JLFKWDAZBRYCGX-ZKWXMUAHSA-N 0.000 description 1
- HZYOWMGWKKRMBZ-BYULHYEWSA-N Val-Asp-Asp Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N HZYOWMGWKKRMBZ-BYULHYEWSA-N 0.000 description 1
- BMGOFDMKDVVGJG-NHCYSSNCSA-N Val-Asp-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)N BMGOFDMKDVVGJG-NHCYSSNCSA-N 0.000 description 1
- YODDULVCGFQRFZ-ZKWXMUAHSA-N Val-Asp-Ser Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O YODDULVCGFQRFZ-ZKWXMUAHSA-N 0.000 description 1
- SCBITHMBEJNRHC-LSJOCFKGSA-N Val-Asp-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C(C)C)C(=O)O)N SCBITHMBEJNRHC-LSJOCFKGSA-N 0.000 description 1
- RKIGNDAHUOOIMJ-BQFCYCMXSA-N Val-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)C(C)C)C(O)=O)=CNC2=C1 RKIGNDAHUOOIMJ-BQFCYCMXSA-N 0.000 description 1
- UEHRGZCNLSWGHK-DLOVCJGASA-N Val-Glu-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O UEHRGZCNLSWGHK-DLOVCJGASA-N 0.000 description 1
- OACSGBOREVRSME-NHCYSSNCSA-N Val-His-Asn Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CC(N)=O)C(O)=O OACSGBOREVRSME-NHCYSSNCSA-N 0.000 description 1
- VHRLUTIMTDOVCG-PEDHHIEDSA-N Val-Ile-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)NC(=O)[C@H](C(C)C)N VHRLUTIMTDOVCG-PEDHHIEDSA-N 0.000 description 1
- BZOSBRIDWSSTFN-AVGNSLFASA-N Val-Leu-Met Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](C(C)C)N BZOSBRIDWSSTFN-AVGNSLFASA-N 0.000 description 1
- SBJCTAZFSZXWSR-AVGNSLFASA-N Val-Met-His Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N SBJCTAZFSZXWSR-AVGNSLFASA-N 0.000 description 1
- FMQGYTMERWBMSI-HJWJTTGWSA-N Val-Phe-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](C(C)C)N FMQGYTMERWBMSI-HJWJTTGWSA-N 0.000 description 1
- KISFXYYRKKNLOP-IHRRRGAJSA-N Val-Phe-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)O)N KISFXYYRKKNLOP-IHRRRGAJSA-N 0.000 description 1
- RYQUMYBMOJYYDK-NHCYSSNCSA-N Val-Pro-Glu Chemical compound CC(C)[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)O)N RYQUMYBMOJYYDK-NHCYSSNCSA-N 0.000 description 1
- USLVEJAHTBLSIL-CYDGBPFRSA-N Val-Pro-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)C(C)C USLVEJAHTBLSIL-CYDGBPFRSA-N 0.000 description 1
- AJNUKMZFHXUBMK-GUBZILKMSA-N Val-Ser-Arg Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N AJNUKMZFHXUBMK-GUBZILKMSA-N 0.000 description 1
- KSFXWENSJABBFI-ZKWXMUAHSA-N Val-Ser-Asn Chemical compound [H]N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O KSFXWENSJABBFI-ZKWXMUAHSA-N 0.000 description 1
- KRAHMIJVUPUOTQ-DCAQKATOSA-N Val-Ser-His Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)N KRAHMIJVUPUOTQ-DCAQKATOSA-N 0.000 description 1
- VHIZXDZMTDVFGX-DCAQKATOSA-N Val-Ser-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)N VHIZXDZMTDVFGX-DCAQKATOSA-N 0.000 description 1
- NZYNRRGJJVSSTJ-GUBZILKMSA-N Val-Ser-Val Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O NZYNRRGJJVSSTJ-GUBZILKMSA-N 0.000 description 1
- WUFHZIRMAZZWRS-OSUNSFLBSA-N Val-Thr-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C(C)C)N WUFHZIRMAZZWRS-OSUNSFLBSA-N 0.000 description 1
- JAIZPWVHPQRYOU-ZJDVBMNYSA-N Val-Thr-Thr Chemical compound C[C@H]([C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C(C)C)N)O JAIZPWVHPQRYOU-ZJDVBMNYSA-N 0.000 description 1
- BGTDGENDNWGMDQ-KJEVXHAQSA-N Val-Tyr-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](C(C)C)N)O BGTDGENDNWGMDQ-KJEVXHAQSA-N 0.000 description 1
- LLJLBRRXKZTTRD-GUBZILKMSA-N Val-Val-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)O)N LLJLBRRXKZTTRD-GUBZILKMSA-N 0.000 description 1
- 108700020467 WT1 Proteins 0.000 description 1
- 102100022748 Wilms tumor protein Human genes 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000013564 activation of immune response Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 108010045350 alanyl-tyrosyl-alanine Proteins 0.000 description 1
- 108010044940 alanylglutamine Proteins 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 108010050025 alpha-glutamyltryptophan Proteins 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 230000003698 anagen phase Effects 0.000 description 1
- 230000002421 anti-septic effect Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 108010013835 arginine glutamate Proteins 0.000 description 1
- 108010052670 arginyl-glutamyl-glutamic acid Proteins 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 1
- 108010093581 aspartyl-proline Proteins 0.000 description 1
- 108010038633 aspartylglutamate Proteins 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 238000005842 biochemical reaction Methods 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- IYYIVELXUANFED-UHFFFAOYSA-N bromo(trimethyl)silane Chemical compound C[Si](C)(C)Br IYYIVELXUANFED-UHFFFAOYSA-N 0.000 description 1
- 244000309466 calf Species 0.000 description 1
- 229920003123 carboxymethyl cellulose sodium Polymers 0.000 description 1
- 229940063834 carboxymethylcellulose sodium Drugs 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 239000000460 chlorine Substances 0.000 description 1
- 229910052801 chlorine Inorganic materials 0.000 description 1
- 210000001728 clone cell Anatomy 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 235000013409 condiments Nutrition 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- CVSVTCORWBXHQV-UHFFFAOYSA-N creatine Chemical compound NC(=[NH2+])N(C)CC([O-])=O CVSVTCORWBXHQV-UHFFFAOYSA-N 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 108010060199 cysteinylproline Proteins 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000011033 desalting Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 238000012631 diagnostic technique Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- FSXRLASFHBWESK-UHFFFAOYSA-N dipeptide phenylalanyl-tyrosine Natural products C=1C=C(O)C=CC=1CC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FSXRLASFHBWESK-UHFFFAOYSA-N 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- 239000001761 ethyl methyl cellulose Substances 0.000 description 1
- 235000010944 ethyl methyl cellulose Nutrition 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012467 final product Substances 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 108010063718 gamma-glutamylaspartic acid Proteins 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 108010042598 glutamyl-aspartyl-glycine Proteins 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 108010027668 glycyl-alanyl-valine Proteins 0.000 description 1
- 108010079413 glycyl-prolyl-glutamic acid Proteins 0.000 description 1
- 108010045126 glycyl-tyrosyl-glycine Proteins 0.000 description 1
- 108010081551 glycylphenylalanine Proteins 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000014951 hematologic disease Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 208000018706 hematopoietic system disease Diseases 0.000 description 1
- 108010036413 histidylglycine Proteins 0.000 description 1
- 108010085325 histidylproline Proteins 0.000 description 1
- 102000056239 human TNFRSF13B Human genes 0.000 description 1
- 102000050326 human TNFSF13B Human genes 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 102000027596 immune receptors Human genes 0.000 description 1
- 108091008915 immune receptors Proteins 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 229960001388 interferon-beta Drugs 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 108010031424 isoleucyl-prolyl-proline Proteins 0.000 description 1
- 201000006370 kidney failure Diseases 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 108010051673 leucyl-glycyl-phenylalanine Proteins 0.000 description 1
- 108010047926 leucyl-lysyl-tyrosine Proteins 0.000 description 1
- 108010091871 leucylmethionine Proteins 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 239000012452 mother liquor Substances 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 230000011234 negative regulation of signal transduction Effects 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 230000005298 paramagnetic effect Effects 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 108010024654 phenylalanyl-prolyl-alanine Proteins 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 108010031719 prolyl-serine Proteins 0.000 description 1
- 108010015796 prolylisoleucine Proteins 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 235000013772 propylene glycol Nutrition 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 238000000197 pyrolysis Methods 0.000 description 1
- 239000012857 radioactive material Substances 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 108010091078 rigin Proteins 0.000 description 1
- 239000012266 salt solution Substances 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 108010048818 seryl-histidine Proteins 0.000 description 1
- 108010069117 seryl-lysyl-aspartic acid Proteins 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000012409 standard PCR amplification Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 108010033670 threonyl-aspartyl-tyrosine Proteins 0.000 description 1
- 108010072986 threonyl-seryl-lysine Proteins 0.000 description 1
- 231100000820 toxicity test Toxicity 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 108010080629 tryptophan-leucine Proteins 0.000 description 1
- 108010020532 tyrosyl-proline Proteins 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 108010027345 wheylin-1 peptide Proteins 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3061—Blood cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4636—Immune checkpoint inhibitors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464416—Receptors for cytokines
- A61K39/464417—Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6817—Toxins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/525—Tumour necrosis factor [TNF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5434—IL-12
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5443—IL-15
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/555—Interferons [IFN]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/10—Cells modified by introduction of foreign genetic material
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57426—Specifically defined cancers leukemia
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
- G01N33/57492—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites involving compounds localized on the membrane of tumor or cancer cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
- C12N2740/15043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30 CD40 or CD95
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Biotechnology (AREA)
- Epidemiology (AREA)
- Hematology (AREA)
- Toxicology (AREA)
- Wood Science & Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Urology & Nephrology (AREA)
- Mycology (AREA)
- General Engineering & Computer Science (AREA)
- Oncology (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
Abstract
본 발명은 BCMA의 특이 항체 및 BCMA를 표적으로 하는 면역 효과기 세포에 관한 것으로서, 본 발명은 또한 상기 항체를 이용하여 제조된 키메라 항원 수용체 변형된 T 세포 및 이의 용도에 관한 것이다.
Description
본 발명은 종양 면역 치료 또는 진단 분야에 속한 것으로, 보다 구체적으로, 본 발명은 B 세포 성숙 항원(BCMA) 표적 항체 및 이의 용도에 관한 것이다.
다발성 골수종(Multiple myeloma, MM)은 모든 암증 사망 예의 2 %를 차지하는 흔한 악성 혈액병이다. MM은 이종 질병이고 대부분이 t(11; 14), t(4; 14), t(8; 14), del(13), del(17)(다른를 제외한 이외)의 염색체 전위에 의한 것이다(Drach 등, (1998)Blood 92(3): 802-809; Gertz 등, (2005)Blood 106(8): 2837-2840; Facon 등., (2001)Blood 97(6): 1566-1571). 다발성 골수종의 주요 병세는 골수에서 형질세포가 무한적으로 증폭되고 농축되어 골괴사를 초래하는 것이다. MM에 걸린 환자는 골수 침윤, 골질 파괴, 신부전, 면역 결핍 및 암증 진단의 심리적 부담으로 인해 다양한 질병 관련 증상을 경험할 수 있다. 현재, 주요한 치료 방안은 화학 요법과 줄기 세포 이식이고, 화학 요법 약물은 주로 스테로이드(steroid), 탈리도마이드(Thalidomide), 레날리도마이드(lenalidomide), 레나도마이드(Lenadomide), 보르테조밉(bortezomib) 또는 다양한 세포 독소 시약의 조합이고, 젊은 환자의 경우 고용량 화학 요법을 자가 줄기 세포 이식과 함께 사용할 수 있습니다. 젊은 환자에 대해서는 의 조합으로, 고용량 화학 요법을받는 젊은 환자에게 사용할 수 있다.
BCMA(B-cell maturation antigen)는 B 세포 성숙 항원이고, 185개 아미노산 잔기로 구성된 III형 막관통 단백질이고, TNF 수용체 슈퍼패밀리에 속하고, 그 리간드는 아프릴(APRIL, proliferation inducing ligand), B 림프구 자극인자(BAFF)와 같은 TNF 슈퍼패밀리에 속하며, BCMA는 그 리간드와 결합한 후, B 세포의 증식 및 생존을 활성화시킬 수 있다. BCMA는 형질세포와 다발성 골수종 세포의 표면에 특이적으로 고발현되며, 조혈모세포와 다른 정상 조직 세포에서 발현되지 않음으로써 BCMA는 MM의 표적 치료의 이상적인 표적으로 사용될 수 있다.
이를 감안하여, 본 분야는 BCMA에 대한 특이 항체 및 BCMA를 표적으로 하는 면역 효과기 세포가 시급히 필요하다.
본 발명의 목적은 BCMA에 대한 특이 항체 및 BCMA를 표적으로 하는 면역 효과기 세포를 제공하는 것이다.
제1 양태에 있어서, 본 발명은 BCMA 표적 항체를 제공하며, 상기 항체는, (1) 중쇄 가변 영역을 포함하되, 상기 중쇄 가변 영역은 서열번호 1, 60 또는 62에 의해 표시되는 HCDR1, 및/또는 서열번호 2, 61 또는 63에 의해 표시되는 HCDR2, 및/또는 서열번호 3, 서열번호 4 또는 서열번호 5 중 어느 하나에 의해 표시되는 HCDR3을 포함하는 항체;
(2) 경쇄 가변 영역을 포함하되, 상기 경쇄 가변 영역은 서열번호 6에 의해 표시되는 LCDR1, 및/또는 서열번호 7에 의해 표시되는 LCDR2, 및/또는 서열번호 8, 서열번호 9 또는 서열번호 10 중 어느 하나에 의해 표시되는 LCDR3을 포함하는 항체;
(3) (1)에 따른 항체의 중쇄 가변 영역 및 (2)에 따른 항체의 경쇄 가변 영역을 포함하는 항체;
(4) (1) 내지 (3) 중 어느 하나에 따른 항체의 변이체이고 (1) 내지 (3) 중 어느 하나에 따른 항체와 동일하거나 유사한 활성을 갖는 항체로부터 선택된다.
구체적인 실시형태에 있어서, 상기 항체는, (1) 서열번호 1에 의해 표시되는 HCDR1, 서열번호 2에 의해 표시되는 HCDR2, 서열번호 3에 의해 표시되는 HCDR3 및 서열번호 6에 의해 표시되는 LCDR1, 서열번호 7에 의해 표시되는 LCDR2, 서열번호 8에 의해 표시되는 LCDR3을 포함하는 항체;
(2) 서열번호 1에 의해 표시되는 HCDR1, 서열번호 2에 의해 표시되는 HCDR2, 서열번호 4에 의해 표시되는 HCDR3 및 서열번호 6에 의해 표시되는 LCDR1, 서열번호 7에 의해 표시되는 LCDR2, 서열번호 9에 의해 표시되는 LCDR3을 포함하는 항체;
(3) 서열번호 1에 의해 표시되는 HCDR1, 서열번호 2에 의해 표시되는 HCDR2, 서열번호 5에 의해 표시되는 HCDR3 및 서열번호 6에 의해 표시되는 LCDR1, 서열번호 7에 의해 표시되는 LCDR2, 서열번호 10에 의해 표시되는 LCDR3을 포함하는 항체;
(4) 서열번호 60에 의해 표시되는 HCDR1, 서열번호 61에 의해 표시되는 HCDR2, 서열번호 5에 의해 표시되는 HCDR3 및 서열번호 6에 의해 표시되는 LCDR1, 서열번호 7에 의해 표시되는 LCDR2, 서열번호 10에 의해 표시되는 LCDR3을 포함하는 항체;
(5) 서열번호 62에 의해 표시되는 HCDR1, 서열번호 63에 의해 표시되는 HCDR2, 서열번호 5에 의해 표시되는 HCDR3 및 서열번호 6에 의해 표시되는 LCDR1, 서열번호 7에 의해 표시되는 LCDR2, 서열번호 10에 의해 표시되는 LCDR3을 포함하는 항체;
(6) (1) 내지 (5) 중 어느 하나에 따른 항체의 변이체이고 (1) 내지 (5) 중 어느 하나에 따른 항체와 동일하거나 유사한 활성을 갖는 항체로부터 선택된다.
구체적인 실시형태에 있어서, 상기 항체는, (1) 중쇄 가변 영역이 서열번호 13에 의해 표시되는 아미노산 서열, 서열번호 17에 의해 표시되는 아미노산 서열, 서열번호 21에 의해 표시되는 아미노산 서열, 서열번호 56에 의해 표시되는 아미노산 서열, 또는 서열번호 58에 의해 표시되는 아미노산 서열을 갖는 항체;
(2) 경쇄 가변 영역이 서열번호 11에 의해 표시되는 아미노산 서열, 서열번호 15에 의해 표시되는 아미노산 서열, 또는 서열번호 19에 의해 표시되는 아미노산 서열을 갖는 항체;
(3) (1)에 따른 항체의 중쇄 가변 영역 및 (2)에 따른 항체의 경쇄 가변 영역을 포함하는 항체;
(4) (1) 내지 (3) 중 어느 하나에 따른 항체의 변이체이고 (1) 내지 (3) 중 어느 하나에 따른 항체와 동일하거나 유사한 활성을 갖는 항체로부터 선택된다.
구체적인 실시형태에 있어서, 상기 항체는, (1) 중쇄 가변 영역이 서열번호 13에 의해 표시되는 아미노산 서열을 갖고 경쇄 가변 영역이 서열번호 11에 의해 표시되는 아미노산 서열을 갖는 항체;
(2) 중쇄 가변 영역이 서열번호 17에 의해 표시되는 아미노산 서열을 갖고 경쇄 가변 영역이 서열번호 15에 의해 표시되는 아미노산 서열을 갖는 항체;
(3) 중쇄 가변 영역이 서열번호 21에 의해 표시되는 아미노산 서열을 갖고 경쇄 가변 영역이 서열번호 19에 의해 표시되는 아미노산 서열을 갖는 항체;
(4) 중쇄 가변 영역이 서열번호 56에 의해 표시되는 아미노산 서열을 갖고 경쇄 가변 영역이 서열번호 19에 의해 표시되는 아미노산 서열을 갖는 항체;
(5) 중쇄 가변 영역이 서열번호 58에 의해 표시되는 아미노산 서열을 갖고 경쇄 가변 영역이 서열번호 19에 의해 표시되는 아미노산 서열을 갖는 항체;
(6) (1) 내지 (5) 중 어느 하나에 따른 항체의 변이체이고 (1) 내지 (5) 중 어느 하나에 따른 항체와 동일하거나 유사한 활성을 갖는 항체로부터 선택된다.
제2 양태에 있어서, 본 발명은 본 발명의 제1 양태에 따른 항체와 동일한 항원결정부위를 식별하는 항체는 제공한다.
제3 양태에 있어서, 본 발명은 본 발명의 제1 양태 또는 제2 양태에 따른 항체를 코딩하는 핵산을 제공한다.
제4 양태에 있어서, 본 발명은 본 발명의 제3 양태에 따른 핵산을 포함하는 발현 벡터를 제공한다.
제5 양태에 있어서, 본 발명은 본 발명의 제4 양태에 따른 발현 벡터를 포함하거나 게놈 중에 본 발명의 제3 양태에 따른 핵산이 통합되는 숙주 세포를 제공한다.
제6 양태에 있어서, 본 발명은 BCMA를 발현하는 종양 세포를 특이적 표적으로 하는 표적 약물, 항체 약물 접합체 또는 다기능 항체를 제조하거나;
BCMA를 발현하는 종양을 진단하는 시약을 제조하거나;
바람직하게는, T 림프구, NK 세포 또는 NKT 림프구를 포함하는, 키메라 항원 수용체 변형된 면역 세포를 제조하기 위한,
본 발명의 제1 양태 또는 제2 양태에 따른 항체의 용도를 제공한다.
제7 양태에 있어서, 본 발명은 본 발명의 제1 양태 또는 제2 양태에 따른 항체; 및 상기 항체와 연결되는 기능성 분자로서, 종양 표면 마커 표적 분자, 종양 억제 분자, 면역 세포의 표면 마커 표적 분자 및 검출가능 표지로부터 선택되는 기능성 분자를 포함하는 다기능 면역접합체를 제공한다.
구체적인 실시형태에 있어서, 상기 종양 억제 분자는 항종양 사이토카인 또는 항종양 독소이고, 바람직하게는, 상기 사이토카인은 IL-12, IL-15, I형 인터페론, TNF-α를 포함한다.
구체적인 실시형태에 있어서, 상기 면역 세포의 표면 마커 표적 분자는 면역 세포 표면 마커에 결합하는 항체 또는 리간드이고, 바람직하게는, 상기 면역 세포 표면 마커는 CD3, CD16, CD28을 포함하고, 보다 바람직하게는, 상기 면역 세포 표면 마커에 결합하는 항체는 항-CD3 항체이다.
구체적인 실시형태에 있어서, 상기 면역 세포의 표면 마커 표적 분자는 T 세포 표면 마커에 결합하는 항체이다.
제8 양태에 있어서, 본 발명은 본 발명의 제7 양태에 따른 다기능 면역접합체를 코딩하는 핵산을 제공한다.
제9 양태에 있어서, 본 발명은 항종양 약물을 제조하거나;
BCMA를 발현하는 종양을 진단하는 시약을 제조하거나;
바람직하게는, T 림프구, NK 세포 또는 NKT 림프구를 포함하는, 키메라 항원 수용체 변형된 면역 세포를 제조하기 위한,
본 발명의 제7 양태에 따른 다기능 면역접합체의 용도를 제공한다.
제10 양태에 있어서, 본 발명은 세포외 도메인, 막관통 도메인 및 세포내 신호 도메인을 포함하는 키메라 항원 수용체를 제공하며, 상기 세포외 도메인은 제1 양태 또는 제2 양태에 따른 항체를 포함하되, 바람직하게는, 상기 항체는 단일 쇄 항체 또는 도메인 항체이다.
구체적인 실시형태에 있어서, 상기 세포내 신호 도메인은 하나 이상의 공자극 신호 도메인 및/또는 1차 신호 도메인을 포함한다.
구체적인 실시형태에 있어서, 상기 키메라 항원 수용체는 힌지 도메인을 추가로 포함한다.
구체적인 실시형태에 있어서, 상기 막관통 도메인은 TCR의 α 쇄, β 쇄, ζ 쇄, CD3ε, CD3ζ, CD4, CD5, CD8α, CD9, CD16, CD22, CD27, CD28, CD33, CD37, CD45, CD64, CD80, CD86, CD134, CD137, CD152, CD154, 및 PD1의 막관통 영역으로부터 선택되고/거나;
상기 공자극 신호 도메인은 CARD11, CD2, CD7, CD27, CD28, CD30, CD40, CD54, CD83, OX40, CD137, CD134, CD150, CD152, CD223, CD270, PD-L2, PD-L1, CD278, DAP10, LAT, NKD2C SLP76, TRIM, FcεRIγ, MyD88, 및 41BBL의 세포내 신호 영역으로부터 선택되고/거나;
상기 1차 신호 도메인은 TCRξ, FcRγ, FcRβ, CD3γ, CD3δ, CD3ε, CD5, CD22, CD79a, CD79b, CD278("ICOS"로도 지칭됨) 및 CD66d, 및 CD3ζ로부터 선택되고,
바람직하게는, 상기 막관통 도메인은 CD8α, CD4, CD45, PD1, CD154 및 CD28의 막관통 도메인으로부터 선택되고/거나;
상기 공자극 신호 도메인은 CD137, CD134, CD28 및 OX40으로부터 선택되고/거나;
상기 1차 신호 도메인은 CD3ζ로부터 선택되고,
가장 바람직하게는, 상기 막관통 도메인은 CD8α 및 CD28로부터 선택되고, 상기 공자극 신호 도메인은 CD137 또는 CD28의 세포내 신호 도메인으로부터 선택되고, 상기 1차 신호 도메인은 CD3ζ로부터 선택된다.
구체적인 실시형태에 있어서, 상기 키메라 항원 수용체는 본 발명의 제1 양태 또는 제2 양태에 따른 항체, CD8의 막관통 영역 및 CD3ζ;
본 발명의 제1 양태 또는 제2 양태에 따른 항체, CD8의 막관통 영역, CD137의 세포내 신호 영역 및 CD3ζ;
본 발명의 제1 양태 또는 제2 양태에 따른 항체, CD28의 막관통 영역, CD28의 세포내 신호 영역 및 CD3ζ; 또는
본 발명의 제1 양태 또는 제2 양태에 따른 항체, CD28의 막관통 영역, CD28의 세포내 신호 영역, CD137 및 CD3ζ의 순서로 연결되는 항체, 막관통 영역 및 세포내 신호 영역을 포함한다.
제11 양태에 있어서, 본 발명은 본 발명의 제10 양태에 따른 키메라 항원 수용체를 코딩하는 핵산을 제공한다.
제12 양태에 있어서, 본 발명은 본 발명의 제11 양태에 따른 핵산을 포함하는 발현 벡터를 제공한다.
제13 양태에 있어서, 본 발명은 본 발명의 제12 양태에 따른 벡터를 포함하는 바이러스를 제공한다.
바람직한 실시형태에 있어서, 상기 바이러스는 렌티바이러스(Lentivirus)이다.
제14 양태에 있어서, 본 발명은 BCMA를 발현하는 종양 세포 표적 유전자 변형된 면역 세포를 제조하기 위한 것인 본 발명의 제10 양태에 따른 키메라 항원 수용체, 또는 본 발명의 제11양태에 따른 핵산, 또는 본 발명의 제12 양태에 따른 발현 벡터, 또는 본 발명의 제13 양태에 따른 바이러스의 용도를 제공하며,
바람직한 실시형태에 있어서, 상기 BCMA를 발현하는 종양은 다발성 골수종이다.
제15 양태에 있어서, 본 발명은 본 발명의 제11 양태에 따른 핵산, 또는 본 발명의 제12 양태에 따른 발현 벡터 또는 본 발명의 제13 양태에 따른 바이러스가 형질도입되거나; 본 발명의 제10 양태에 따른 키메라 항원 수용체가 발현되는 유전자 변형된 면역 세포를 제공하되, 바람직하게는, 상기 면역 세포는 T 림프구, NK 세포 및 NKT 세포로부터 선택된다.
구체적인 실시형태에 있어서, 상기 유전자 변형된 면역 세포에는 본 발명의 제10 양태에 따른 키메라 항원 수용체 이외의 다른 서열을 추가로 발현하되, 상기 다른 서열은 사이토카인, 또는 다른 키메라 항원 수용체, 또는 케모카인 수용체, 또는 PD-1 발현을 감소시키는 siRNA, 또는 PD-L1을 차단하는 단백질, 또는 TCR, 또는 안전 스위치를 포함하고;
바람직하게는, 상기 사이토카인은 IL-12, IL-15, IL-21, 또는 I형 인터페론을 포함하고;
바람직하게는, 상기 케모카인 수용체는 CCR2, CCR5, CXCR2, 또는 CXCR4를 포함하고;
바람직하게는, 상기 안전 스위치는 iCaspase-9, 절두된 EGFR 또는 RQR8을 포함한다.
제16 양태에 있어서, 본 발명은 BCMA를 발현하는 종양을 억제하는 약물을 제조하기 위한 것인 본 발명의 제15 양태에 따른 유전자 변형된 면역 세포의 용도를 제공하며, 바람직한 실시형태에 있어서, 상기 BCMA를 발현하는 종양은 다발성 골수종이다.
제17 양태에 있어서, 본 발명은 본 발명의 제1 양태 또는 제2 양태에 따른 항체 또는 상기 항체를 코딩하는 핵산; 또는
본 발명의 제7 양태에 따른 면역접합체 또는 상기 면역접합체를 코딩하는 핵산; 또는
본 발명의 제10 양태에 따른 키메라 항원 수용체 또는 상기 키메라 항원 수용체를 코딩하는 핵산; 또는
본 발명의 제15 양태에 따른 유전자 변형된 면역 세포를 포함하는 약학 조성물을 제공한다.
본 발명의 범위내에서, 본 발명의 상기 각 기술 특징과 아래(예를 들어, 실시예)에서 구체적으로 설명될 각 기술 특징 사이는 모두 상호 조합될 수 있으며, 이로써 새로운 또는 바람직한 기술적 해결수단을 구성함을 이해해야 한다. 편폭의 제한으로 인하여 여기서 더이상 일일이 설명하지 않기로 한다.
도 1은 BCMA_huFc, BCMA_muFc의 SDS 전기영동도(환원 조건)를 나타낸다.
도 2는 FACs에 의해 검출된 안정적 형질전환 세포주 K562-BCMA 중 BCMA의 발현 정황을 나타낸다.
도 3은 항체 7A12, 7G2, 23F10의 ELISA 측정 결과를 나타낸다.
도 4는 FACs에 의해 검출된 항체 7A12, 7G2, 23F10과 K562-BCMA 및 K562의 결합 정황을 나타낸다.
도 5는 SDS-PAGE 분석에 의해 정제된 항-BCMA scFv_Fc 항체(환원조건)를 나타낸다.
도 6은 FACs에 의해 단계희석된 정제 scFv_Fc와 K562-BCMA의 결합을 측정하는 정황을 나타낸다.
도 7은 Biacore에 의해 측정된 항체 7A12, 7G2, 23F10과 BCMA의 친화력을 나타낸다.
도 8은 FACs에 의해 측정된 항체 7A12, 7G2, 23F10과 RPMI8226 세포주의 결합 정황을 나타낸다.
도 9는 ELISA에 의해 검출된 항체 및 APRIL에 대한 BCMA의 경쟁적 결합 정황을 나타낸다.
도 10은 FACS에 의해 검출된 BCMA-CAR T바이러스에 의해 감염된 T 림프구의 양성률을 나타낸다.
도 11a는 BCMA에 대해 양성 및 음성 세포를 발현시키는 BCMA-CAR T의 체외 독성 실험 결과를 나타내며, 도 11b는 BCMA-CAR T의 쥐 체내 실험 결과를 나타낸다.
도 12는 25C2, 25D2 및 23F10 클론의 중쇄 아미노산 서열을 비교한다.
도 13a는 항체 25C2의 집합 정황을 나타내고, 도 13b는 항체 25D2의 집합 정황을 나타내며, 도 13c는 항체 23F10 및 7A12의 집합 정황을 나타낸다.
도 14a는 25C2, 25D2와 K562-BCMA 및 K562 세포의 결합 정황을 나타내고, 도 14b는 ELISA에 의해 측정된 항체 23F10, 25C2, 25D2의 특이성을 나타낸다.
도 15는 25C2-BBZ, 25D2-BBZ, 7A12-BBZ, C11D5.3-BBZ 및 sPD-1-7A12-BBZ의 세포 살상의 실험 결과를 나타낸다.
도 16은 25C2-BBZ, 25D2-BBZ, C11D5.3-BBZ, 7A12-BBZ의 피하 이식 종양 결과를 나타낸다.
도 2는 FACs에 의해 검출된 안정적 형질전환 세포주 K562-BCMA 중 BCMA의 발현 정황을 나타낸다.
도 3은 항체 7A12, 7G2, 23F10의 ELISA 측정 결과를 나타낸다.
도 4는 FACs에 의해 검출된 항체 7A12, 7G2, 23F10과 K562-BCMA 및 K562의 결합 정황을 나타낸다.
도 5는 SDS-PAGE 분석에 의해 정제된 항-BCMA scFv_Fc 항체(환원조건)를 나타낸다.
도 6은 FACs에 의해 단계희석된 정제 scFv_Fc와 K562-BCMA의 결합을 측정하는 정황을 나타낸다.
도 7은 Biacore에 의해 측정된 항체 7A12, 7G2, 23F10과 BCMA의 친화력을 나타낸다.
도 8은 FACs에 의해 측정된 항체 7A12, 7G2, 23F10과 RPMI8226 세포주의 결합 정황을 나타낸다.
도 9는 ELISA에 의해 검출된 항체 및 APRIL에 대한 BCMA의 경쟁적 결합 정황을 나타낸다.
도 10은 FACS에 의해 검출된 BCMA-CAR T바이러스에 의해 감염된 T 림프구의 양성률을 나타낸다.
도 11a는 BCMA에 대해 양성 및 음성 세포를 발현시키는 BCMA-CAR T의 체외 독성 실험 결과를 나타내며, 도 11b는 BCMA-CAR T의 쥐 체내 실험 결과를 나타낸다.
도 12는 25C2, 25D2 및 23F10 클론의 중쇄 아미노산 서열을 비교한다.
도 13a는 항체 25C2의 집합 정황을 나타내고, 도 13b는 항체 25D2의 집합 정황을 나타내며, 도 13c는 항체 23F10 및 7A12의 집합 정황을 나타낸다.
도 14a는 25C2, 25D2와 K562-BCMA 및 K562 세포의 결합 정황을 나타내고, 도 14b는 ELISA에 의해 측정된 항체 23F10, 25C2, 25D2의 특이성을 나타낸다.
도 15는 25C2-BBZ, 25D2-BBZ, 7A12-BBZ, C11D5.3-BBZ 및 sPD-1-7A12-BBZ의 세포 살상의 실험 결과를 나타낸다.
도 16은 25C2-BBZ, 25D2-BBZ, C11D5.3-BBZ, 7A12-BBZ의 피하 이식 종양 결과를 나타낸다.
발명자는 광범위하고 심층적 연구를 거쳐 예상 밖으로 BCMA에 특이적으로 결합되는 항체를 발견하였으며, 이러한 항체는 다양한 항종양 표적 약물 및 종양 진단 약물을 제조하는데 응용될 수 있었다. 이에 기반하여 본 발명을 완성하였다.
본문에서 사용된 과학기술 용어는 본 분야의 기술자가 통상적으로 이해하는 용어와 동일하거나 유사한 의미를 갖고 있다. 본 발명을 쉽게 이해하기 위해 일부 용어는 하기와 같이 정의된다.
본문에서의 용어 "BCMA"는 B 세포 성숙화 항원(anti-B-cell maturation antigen)을 가리키며, 184개 아미노산 잔기로 구성된 III형 막관통 단백질(NCBI Reference Sequence: NP_001183.2)이고, 아미노산 서열은 서열번호 37에 표시된 바와 같다. 일 구체적인 실시예에서, BCMA는 인간 BCMA를 가리킨다.
본문에서의 용어 "APRIL"은 A proliferation-inducing ligand를 가리키며, 이것은 증식 유도 리간드이고, 184개 아미노산 잔기로 구성(NCBI Reference Sequence: NP_003799.1)되며 TNF 슈퍼패밀리에 속한다.
본문에서의 용어 "항체"는 면역시스템의 항원결합단백질을 가리킨다. 본문에서 언급된 용어 "항체"는 항원결합영역을 갖는 완전한 전장 항체 및 그 중 "항원결합부분" 또는 "항원결합영역"에 보류된 임의의 단편, 또는 단일 쇄 가변 단편(scFv)과 같은 단일 쇄를 포함한다. 천연 항체는 이황화 결합에 의해 상호 연결되는 적어도 두개의 중(H)쇄와 두개의 경(L)쇄 또는 그 항원결합단편을 포함하는 당단백질을 가리킨다. 용어 "항체"는 항체(특히 본문에서 서술된 항체)의 모든 재조합 형태, 예를 들어, 원핵세포 중 발현되는 항체, 비글리코실화의 항체 및 항원과 결합되는 항체 단편 및 아래에서 서술되는 유도체를 추가로 포함한다. 각각의 중쇄는 중쇄 가변 영역(본문에서 VH로 약칭함)과 중쇄 일정부위로 조성된다. 각각의 경쇄는 경쇄 가변 영역(본문에서 VL로 약칭함)과 경쇄 일정부위로 조성된다. VH와 VL은 상보결정부위(complementaritydetermining region, CDR)로 불리우는 초가변영역(hypervariable region)으로 더 세분화할 수 있으며, 이것들은 프레임워크 영역(FR)으로 불리우는 보다 보수적인 영역 중에 분산된다. 각각의 VH와 VL은 3개의 CDR 및 4개의 FR로 조성되며, 아미노말단으로부터 카르복실말단까지 FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4의 순서로 배열된다. 중쇄 및 경쇄의 가변 영역은 항원과 상호 작용하는 결합 도메인을 포함한다. 항체의 일정부위는 상기 면역글로불린과 숙주 조직 또는 인자와의 결합을 매개할 수 있으며, 상기 숙주 조직 또는 인자는 면역시스템의 다양한 세포(예를 들어, 효과기 세포)와 고전보체시스템의 제1 성분(C1q)을 포함한다.
항체 단편은 (i) VL, VH, CL 및 CH1 도메인으로 조성되고, Fab' 및 Fab'-SH를 포함하는 Fab 단편, (ii) VH 및 CH1 도메인으로 조성된 Fd 단편, (iii) 단일 항체의 VL 및 VH 도메인으로 조성된 Fv 단편; (iv) 단일 가변 영역으로 조성된 dAb 단편(Ward 등, 1989, Nature341: 544-546); (v) 2개의 연결된 Fab 단편을 포함한 2가 단편인 F(ab')2 단편; (vi) 단일 쇄 Fv 분자 항원결합사이트(Bird 등, 1988, Science 242: 423-426; Huston 등, 1988, Proc.Natl.Acad.Sci.U.S.A 85: 5879-5883); (vii) 이중 특이적 단일 쇄 Fv 이합체(PCT/US92/09965); (viii) 유전자 융합에 의해 구축된 다가 또는 다중 특이성 단편(Tomlinson 등, 2000, Methods Enzymol.326: 461-479; WO94/13804; Holliger 등, 1993, Proc.Natl.Acad.Sci.U.S.A 90: 6444-6448)의 "2체" 또는 "3체"; 및 (ix) 동일하거나 상이한 항체와 유전적으로 융합되는 scFv(Coloma & Morrison, 1997, Nature Biotechnology 15, 159-163)를 포함하지만 이에 한정되지 않는다.
본문에서의 용어 "Fc" 또는 "Fc 영역"은 제1 일정부위 면역글로불린 도메인 이외의 항체 일정부위를 포함하는 폴리펩타이드를 포함한다. 따라서, Fc는 IgA, IgD 및 IgG의 마지막 2개의 일정부위 면역글로불린 도메인, 및 IgE 및 IgM의 마지막 3개의 일정부위 면역글로불린 도메인, 및 이러한 도메인 N단의 플랙셔 힌지(Flexure Hinge)를 가리킨다. IgA 및 IgM에 대해 Fc는 J 쇄를 포함할 수 있다. IgG에 대해 Fc는 면역글로불린 도메인 Cγ2와 Cγ3 및 Cγ1과 Cγ2 사이에 있는 힌지를 포함한다. Fc 영역의 경계는 변화될 수 있지만 인간 IgG 중쇄 Fc 영역은 통상적으로 그 카르복실말단에 잔기 C226 또는 P230을 포함하는 것으로 정의되며, 그중 번호는 Kabat의 EU 색인에 의한 것이다. 인간 IgG1에 대해 Fc는 본문에서 잔기 P232로부터 그 카르복실말단까지 포함하는 것으로 정의되며, 그중 번호는 Kabat의 EU 색인에 의한 것이다. Fc는 분리된 상기 영역을 가리킬 수 있거나 예를 들어, 항체, 환경 중의 상기 영역과 같은 Fc 폴리펩타이드에 위치할 수 있다. 상기 "힌지"는 항체의 제1 일정 도메인과 제2 일정 도메인 사이에 포함된 아미노산의 플렉셔블 폴리펩타이드를 포함한다. 구조적으로, IgG CH1 도메인은 EU220 부위에서 중단되며, IgG CH2 도메인은 잔기 EU237 부위로부터 시작한다. 따라서, IgG에 대해 본문에서의 항체 힌지는 221(IgG1의 D221)로부터 231(IgG1의 A231) 부위까지 포함하는 것으로 정의되며, 그중 번호는 Kabat의 EU 색인에 의한 것이다.
본문에서 사용된 용어 "친본 항체" 또는 "친본 면역글로불린"은 변형되지 않은 항체를 포함하고, 상기 항체 이후 변형되어 변이체를 생성한다. 상기 친본 항체는 천연적으로 존재하는 항체이거나 천연적으로 존재하는 항체의 변이체 또는 개선된 버전일 수 있다. 친본 항체는 항체 자체를 가리킬 수 있으며, 상기 친본 항체의 조성물을 포함하거나 그 아미노산 서열을 코딩한다. 본문에서 사용된 용어 "친본 항체" 또는 "친본 면역글로불린"은 그후 변형을 거쳐 인간화 항체를 생성하는 쥐 항체 또는 키메라 항체를 포함한다.
본문에서 사용된 용어 "변이체 항체" 또는 "항체 변이체"는 친본의 적어도 하나의 변형으로 인하여 친본 항체 서열과 상이한 항체 서열을 포함한다. 본문에서의 변이체 항체 서열은 바람직하게는, 친본 항체 서열과 적어도 약 80 %, 가장 바람직하게는, 적어도 약 90 %, 보다 바람직하게는, 적어도 약 95 %의 아미노산 서열 동일성을 갖는다. 항체 변이체는 항체 자체를 가리킬 수 있으며, 상기 친본 항체의 조성물을 포함하거나 그 아미노산 서열을 코딩한다.
본문에서 사용된 용어 "변이체"는 친본의 적어도 하나의 아미노산 변형으로 인하여 친본 항체 서열과 상이한 항체 서열을 포함한다. 구체적인 실시형태에 있어서, 본문에서의 변이체 항체 서열은 친본 항체 서열과 적어도 약 80 %, 바람직하게는, 적어도 약 90 %, 보다 바람직하게는, 적어도 약 95 %, 보다 바람직하게는, 적어도 약 97 %, 보다 바람직하게는, 적어도 약 98 %, 가장 바람직하게는, 적어도 약 99 %의 아미노산 서열 동일성을 갖는다. 항체 변이체는 항체 자체를 가리킬 수 있으며, 상기 친본 항체의 조성물을 포함하거나 그 아미노산 서열을 코딩한다. 용어 "아미노산 변형"은 아미노산 치환, 첨가 및/또는 결실을 포함하고, "아미노산 치환"은 다른 한가지 아미노산으로 친본 폴리펩타이드 서열 중 특정 위치에서의 아미노산을 대체하는 것을 의미한다. 예를 들어, R94K 치환은 94 부위의 아르기닌이 리신으로 대체되는 것을 기리키며, 본문에서 사용된 "아미노산 삽입"은 친본 폴리펩타이드 서열 중의 특정 위치에 아미노산을 첨가하는 것을 의미한다. 본문에서 사용된 "아미노산 결실" 또는 "결실"은 친본 폴리펩타이드 서열 중 특정 위치에 있는 아미노산을 제거하는 것을 의미한다.
본문에서 사용된 용어 "보수적 변형" 또는 "보수적 서열 변형"은 상기 아미노산 서열을 포함하는 항체의 결합 특징에 큰 영향을 미치지 않거나 변화시키지 않는 아미노산 변형을 의미한다. 해당 유형의 보수적 변형은 아미노산 치환, 삽입 및 결실을 포함하낟. 본 분야에서 공지된 표준 기술에 의해 변형을 본 발명의 항체에 도입시킬 수 있으며, 예를 들어, 부위 특이적 돌연변이 유도 및 PCR 매개에 의한 돌연변이 유도이다. 보수적인 아미노산 치환은 유사한 측쇄를 갖는 아미노산 잔기로 아미노산 잔기를 대체하는 치환이다. 본 분야에서는 유사한 측쇄를 갖는 아미노산 잔기 패밀리를 정의하였다. 이러한 패밀리는 알칼리 측쇄를 포함하는 아미노산(예를 들어, 리신, 아르기닌, 히스티딘), 산성 측쇄(예를 들어, 아스파르트산, 글루탐산), 전하를 띠지 않는 급성 측쇄(예를 들어, 글리신, 아스파라긴, 세린, 트레오닌, 티로신, 시스테인, 트립토판), 비극성 측쇄 (예를 들어, 알라닌, 발린, 류신, 이소류신, 프롤린, 페닐알라닌, 메티오닌), β분지 측쇄(예를 들어, 트레오닌, 발린, 이소류신) 및 방향족 측쇄(예를 들어, 티로신, 페닐알라닌, 트립토판, 히스티딘)를 포함한다. 따라서, 다른 동일한 측쇄 패밀리의 아미노산 잔기로 본 발명의 항체의 CDR 영역 또는 프레임워크 영역 중의 하나 이상의 아미노산 잔기로 대체할 수 있으며, 또한 변화된 항체(변이체 항체)가 보류한 기능을 테스트할 수 있다.
본 발명에서 토론하는 모든 면역글로불린 중쇄 일정부위 위치는 모두 Kabat의 EU 색인에 의한 번호이다(Kabat 등, 1991, sequences of proteins of immunological interest, 제5판, United States Public Health Service, National Institutes of Health, Bethesda, 전체 문장이 참조로서 통합됨). "Kabat의 EU 색인"은 인간 IgG1 EU 항체의 잔기 번호이고, 예를 들어, Edelman 등 사람, 1969, Biochemistry 63: 78-85에 서술된 바와 같다.
본문에서 사용된 용어 "항원결정부위"는 또 항원결정기로 불리우며, BCMA 단백질 서열의 연속적 서열에 의해 조성될 수 있고 BCMA 단백질 서열의 불연속적인 3차원 구조에 의해 조성될 수도 있다.
본문에서 사용된 용어 "키메라 항원 수용체" 또는 "CAR"은 항원을 결합할 수 있는 세포외 도메인, 막관통 도메인 및 세포질 신호를 도메인에 전달시키는 폴리펩타이드(즉 세포내 신호 도메인)를 포함하고, 세포내 신호 도메인은 결정된 신호 전달 경로를 경유하여 제2 메신저를 생성하여 정보를 세포내에 전달시킴으로써 세포 활성을 조절하는 단백질, 또는 상기 유형의 메신저에 해당되는 효과기로써 작용하는 단백질을 가리키고, 1차 신호 도메인을 포함하고, 아래에서 정의된 자극 분자의 기능 신호 전달 도메인(즉 공자극 신호 도메인)을 추가로 포함할 수 있다. 세포내 신호 도메인은 CAR의 세포(예를 들어, CAR T 세포)를 촉진시킬 수 있는 면역 효과기 기능의 신호, 면역 효과기 기능의 예를 산생할 수 있으며, 예를 들어, CAR T 세포에서 세포 열분해 활성과 보조 활성, 사이토카인 분비를 포함한다.
용어 "1차 신호 도메인"은 자극적인 방식으로 TCR 복합체의 초기 활성화를 조절한다. 한편, 1차 신호 도메인은 예를 들어 TCR/CD3 복합체와 펩타이가 로딩된 MHC 분자의 결합에 의해 야기되고, 이로부터 T 세포 반응(증식, 활성화, 분화 등을 포함하지한 이에 한정되지 않음)을 매개한다. 자극적인 방식으로 작용하는 1차 신호 도메인은 면역 수용체 티로신 활성화 모티브 또는 ITAM의 신호 전달 모티브를 포함할 수 있다. 본 발명에서, 특히 유용적인 ITAM을 포함하는 1차 신호 도메인의 예는 TCRξ, FcRγ, FcRβ, CD3γ, CD3δ, CD3ε, CD5, CD22, CD79a, CD79b, CD278("ICOS"로도 불리움) 및 CD66d로부터 선택된 서열을 포함하지만 이에 한정되지 았고, 본 발명의 CAR의 특정 예에서, 세포내 신호 전달 도메인은 어느 하나 이상의 본 발명의 CAR에서 CD3ζ의 1 차 신호 도메인과 같은 세포내 신호 전달 서열을 포함한다.
용어 "공자극 신호 도메인"은 "공자극 분자"를 가리키며, 공자극 리간드에 특이 적으로 결합하는 T 세포의 관련 결합성 배우체이고, 이에 의해 T 세포의 공자극 반응(예를 들어, 증식을 포함하지만 이에 한정되지 않음)을 매개한다. 공자극 분자는 유효 면역 반응에 필요되는, 비항원 수용체의 세포 표면 분자 또는 그 리간드이다. 공자극 분자는 MHC I류 분자, BTLA 및 Toll 리간드 수용체, 및 OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1(CD11a/CD18) 및 4-1BB(CD137)를 포함하지만 이에 한정되지 않는다.
본 발명에서, 한편, CAR은 세포외 항원 식별 도메인, 막관통 도메인, 및 세포내 신호 전달 도메인을 포함하는 키메라 융합 단백질을 포함하고, 상기 세포내 신호 전달 도메인은 자극 분자로부터 유래된 기능 신호 전달 도메인을 포함한다. 다른 한편, CAR은 세포외 항원 식별 도메인, 막관통 도메인, 및 세포내 신호 전달 도메인을 포함하는 키메라 융합 단백질을 포함하고, 상기 세포내 신호 전달 도메인은 공자극 분자로부터 유래된 기능 신호 전달 도메인 및 자극 분자로부터 유래된 기능성 신호 전달 도메인을 포함한다. 또 다른 한편, CAR은 세포외 항원 식별 도메인, 막관통 도메인, 및 세포내 신호 전달 도메인을 포함하는 키메라 융합 단백질을 포함하고, 상기 세포내 신호 전달 도메인은 하나 이상의 공자극 분자로부터 유래된 적어도 2개의 기능성 신호 전달 도메인 및 자극 분자로부터 유래된 기능성 신호 전달 도메인을 포함한다. 한편, CAR은 CAR 융합 단백질의 아미노산(ND단)에서 선택 가능한 선도 서열을 포함한다. 다른 한편, CAR은 세포외 항원 식별 도메인의 N단에서 선도 서열을 추가로 포함하고, 그중 선도 서열은 CAR의 세포 가공 및 위치결정으로부터 세포막까지 과정에서 항원 식별 도메인(예를 들어, scFv)으로부터 임의적으로 절단된다.
본문에서 용어 "CD3ξ"는 GenBank 등록번호 BAG36664.1에 의해 제공된 단백질, 또는 쥐, 설치류 동물, 원숭이, 유인원 등과 같은 비인간 종으로부터 유래된 등가 잔기로 정의된다. "CD3ξ 도메인"은 ξ 쇄로부터 생성된 세포질 도메인의 아미노산 잔기로 정의되며, 이는 T 세포 활성화에 필요한 초기 신호를 기능적으로 전달하기에 충분한다. 한편, ξ의 세포질 도메인은 GenBank 등록번호 BAG36664.1의 잔기 52부터 164, 그 기능성 이종 상동체-쥐, 설치류 동물, 원숭이, 유인원 등과 같은 비인간 종으로부터 유래된 등가 잔기를 포함한다.
본문에서 용어 "4-1BB"는 TNFR 슈퍼패밀리의 성원을 가리키며, GenBank Acc.No.AAA62478.2의 아미노산 서열, 또는 쥐, 설치류 동물, 원숭이, 유인원 등과 같은 비인간 종으로부터 유래된 등가 잔기를 갖고 있다. "4-1BB 공자극 도메인"은 GenBank ACC.No.AAA62478.2의 아미노산 서열 214-255, 또는 쥐, 설치류 동물, 원숭이, 유인원 등과 같은 비분류 종으로부터 유래된 등가 잔기로 정의된다. 한편, "4-1BB 공자극 도메인"은 서열번호 35에서 제공된 서열, 또는 쥐, 설치류 동물, 원숭이, 유인원 등과 같은 비인간 종으로부터 유래된 등가 잔기이다.
본문에서 사용된 용어 "인터페론"은 전장 인터페론, 또는 기본적으로 전장 야생형 인터페론을 유지하는 생물활성(예를 들어, 적어도 80 %, 바람직하게는, 적어도 90 %, 보다 바람직하게는, 적어도 95 %, 98 % 또는 99 %의 전장을 유지함)의 인터페론 단편(절단된 인터페론) 또는 인터페론 돌연변이체를 가리킨다. 인터페론은 I형 인터페론(예를 들어, 인터페론α 및 인터페론β) 및 II형 인터페론(예를 들어, 인터페론γ)을 포함한다.
본 발명의 항체 또는 그 변이체는 다양한 항종양 표적 약물 및 종양을 진단하는 약물의 제조에 응용될 수 있으며, 특히, BCMA를 표적으로 하는 면역 효과기 세포의 제조에 응용된다.
항-BCMA의 항체
본 공개에 있어서, 항체를 포함한 scFv에 기반한 항원 결합 영역을 갖는 항원 결합 단백질이 기재되어있다. 여기서, 재조합 BCMA를 사용하여 인간 scFv 박테리오파지 전시 라이브러리로부터 scFv를 선택한다. 이러한 분자는 정밀한 특이성을 전시한다. 예를 들어, 상기 항체는 단지 BCMA를 안정적으로 발현하는 K562 세포를 식별하고 K562 세포를 식별하지 않는다.
일부 실시방안에 있어서, 본 발명은 scFv 서열을 갖는 항체를 포함하고, 상기 scFv 서열은 하나 이상의 중쇄 일정부위와 융합되어 인간 면역글로불린 Fc 영역을 갖는 항체를 형성하여 이가 단백질을 생성함으로써 항체의 전반 친화력 및 안정성을 증가시킨다. 이밖에, Fc 부분은 다른 분자(형광 염료, 세포 독소, 방사성 동위원소 등을 포함하지만 이에 한정되지 않음)를 예를 들어 항원 정량 연구에 사용되는 항체와 직접 접합하여 친화력 측정을 위한 항체, 치료제의 정향적 배달을 위한 항체, 면역 효과기 세포를 이용한 Fc 매개의 세포 독성 및 많은 다른 응용을 테스트하기 위한 항체를 고정하기 위해서이다.
본문에서 제공한 결과는 BCMA를 표적으로 할 때 본 발명의 항체의 특이성, 민감성 및 유용성을 강조한다.
본 발명의 분자는 박테리오파지를 사용한 전시에 기반하여 단일 쇄 가변 단편(scFv)을 감정하고 선택하며, 상기 단일 쇄 가변 단편의 아미노산 서열은 분자에 BCMA에 대한 특이성을 부여하고 본원에서 공개된 전체 항원 결합 단백질의 기초를 형성한다. 따라서, 상기 scFv로 일련의 상이한 "항체" 분자를 설계할 수 있으며, 예를 들어 전장 항체, Fab 및 F(ab')2와 같은 그 단편, 융합 단백질(scFv_Fc 포함), 다가 항체를 포함하고, 여기서 다가 항체는 동일한 항원 또는 상이한 항원에 대해 한 가지 특이성이 더 많은 항체, 예를 들어, 이중 특이성 T 세포 결합 항체(BiTE), 3항체(Cuesta 등, Multivalent antibodies: when design surpasses evolution, Trends in Biotechnology 28: 355-362, 2010) 등이다.
항원 결합 단백질이 전장 항체인 하나의 실시방안에 있어서, 본 발명의 항체의 중쇄 및 경쇄는 전장(예를 들어, 항체는 적어도 하나와 바람직한 2개의 완전한 중쇄 및 적어도 하나와 바람직한 2개의 완전한 경쇄를 포함할 수 있음)일 수 있거나 항원 결합 부분(Fab, F(ab')2, Fv 또는 scFv)을 포함할 수 있다. 다른 실시방안에 있어서, 항체 중쇄 일정부위는 예를 들어 IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD 및 IgE로부터 선택된다. 항체 유형의 선택은 설계된 항체가 유도하려는 면역 효과기 기능에 의해 결정된다. 재조합 면역글로불린을 구축할 경우, 다양한 면역글로불린의 동종형의 일정부위의 적절한 아미노산 서열 및 광범위한 종류의 항체를 생성하는 방법은 본 분야의 기술자에게 있어서 공지된 바이다.
한편, 본 발명은 서열번호 1, 60, 62 중 어느 하나의 아미노산 서열을 포함하는 중쇄 CDR1, 및/또는 서열번호 2, 61, 63 중 어느 하나의 아미노산 서열을 포함하는 중쇄 CDR2, 및/또는 서열번호 3, 4, 5 중 어느 하나의 아미노산 서열을 포함하는 중쇄 CDR3을 포함하는 BCMA 결합 항체 또는 그 단편을 제공한다. 다른 한편, 본 발명은 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR1, 및/또는 서열번호 7의 아미노산 서열을 포함하는 경쇄 CDR2, 및/또는 서열번호 8, 9, 10 중 어느 하나의 아미노산 서열을 포함하는 경쇄 CDR3을 포함하는 BCMA 결합 항체 또는 그 단편을 제공한다. 다른 한편, 본 발명은 서열번호 1, 60, 62 중 어느 하나의 아미노산 서열을 포함하는 중쇄 CDR1, 및/또는 서열번호 2, 61, 63 중 어느 하나의 아미노산 서열을 포함하는 중쇄 CDR2, 및/또는 서열번호 3, 4, 5 중 어느 하나의 아미노산 서열을 포함하는 중쇄 CDR3, 및/또는 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR1, 및/또는 서열번호 7의 아미노산 서열을 포함하는 경쇄 CDR2, 및/또는 서열번호 8, 9, 10 중 어느 하나의 아미노산 서열을 포함하는 경쇄 CDR3을 포함하는 BCMA 결합 항체 또는 그 단편을 제공한다. 바람직하게는, 상기 BCMA 결합 항체 또는 그 단편은 서열번호 1, 60, 62 중 어느 하나의 아미노산 서열을 포함하는 중쇄 CDR1, 및 서열번호 2, 61, 63 중 어느 하나의 아미노산 서열을 포함하는 중쇄 CDR2, 및 서열번호 3, 4, 5 중 어느 하나의 아미노산 서열을 포함하는 중쇄 CDR3, 및/또는 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR1, 및 서열번호 7의 아미노산 서열을 포함하는 경쇄 CDR2, 및 서열번호 8, 9, 10 중 어느 하나의 아미노산 서열을 포함하는 경쇄 CDR3을 포함한다. 보다 바람직하게는, 상기 BCMA 결합 항체 또는 그 단편은 서열번호 1, 60, 62의 아미노산 서열을 포함하는 중쇄 CDR1, 및 서열번호 2, 61, 63의 아미노산 서열을 포함하는 중쇄 CDR2, 및 서열번호 3, 4, 5 중 어느 하나의 아미노산 서열을 포함하는 중쇄 CDR3, 및 서열번호 6의 아미노산 서열을 포함하는 경쇄 CDR1, 및 서열번호 7의 아미노산 서열을 포함하는 경쇄 CDR2, 및 서열번호 8, 9, 10 중 어느 하나의 아미노산 서열을 포함하는 경쇄 CDR3을 포함한다.
다른 한편, 본 발명은 서열번호 13, 17, 21, 56, 58로부터 선택되는 중쇄 가변 영역 서열을 포함하는 BCMA 결합 항체 또는 그 단편을 제공한다.
다른 한편, 본 발명은 서열번호 11, 15, 19로부터 선택되는 경쇄 가변 영역 서열을 포함하는 BCMA 결합 항체 또는 그 단편을 제공한다.
이러한 중쇄 및 경쇄 가변 영역 서열이 각각 BCMA를 결합할 수 있는 점을 고려하여, 중쇄 및 가변 영역 서열을 "혼합 및 통합"하여 본 발명의 항-BCMA의 결합 분자를 생성할 수 있다.
다른 한편, 본 발명은 BCMA 결합 항체 또는 그 단편의 변이체를 제공한다. 따라서 본 발명은 중쇄 또는 경쇄의 가변 영역 서열과 적어도 80 % 동일한 중쇄 및/또는 경쇄 가변 영역을 갖는 항체 또는 그 단편을 제공한다. 바람직하게는, 중쇄 및/또는 경쇄 가변 영역의 아미노산 서열의 동일성은 적어도 85 %, 보다 바람직하게는, 적어도 90 %, 가장 바람직하게는, 적어도 95 %, 특히 96 %, 보다 특별하게 97 %, 심지어 보다 특별하게 98 %, 가장 특별하게 99 %이고, 예를 들어 80 %, 81 %, 82 %, 83 %, 84 %, 85 %, 86 %, 87 %, 88 %, 89 %, 90 %, 91 %, 92 %, 93 %, 94 %, 95 %, 96 %, 97 %, 98 %, 99 % 및 100 %를 포함한다. 변이체는 본원 발명에서 서술한 항체를 모본 항체로 하고, 효모 라이브러리 선별, 박테리오파지 라이브러리 선별, 돌연변이 등 방법에 의해 얻을 수 있다. 본원 발명의 실시예 10에서 사용된 방법과 같이, 항체 23F10을 모본 항체로 하고, 박테리오파지 라이브러리 선별 방법으로 이용하여 돌연변이 개조를 진행한다.
다른 한편, 본 발명은 상술한 항-BCMA의 항체와 동일한 항원결정부위를 식별하는 항체를 제공한다.
항-BCMA의 항체 특성
항-BCMA의 항체와 같은 항체의 결합능력을 평가하기 위한 표준 측정은 본 분야에서 이미 공지된 바이고, 예를 들어, ELISA, biacore, 웨스턴 블롯(Western blot) 및 유세포분석기에 의한 분석을 포함한다. 적합한 측정은 실시예에 상세하게 기재되어있다.
핵산, 벡터 및 숙주 세포
본 발명은 BCMA 결합 항체 및 그 단편을 코딩하여 분리된 핵산, 벡터 및 상기 핵산 또는 벡터를 포함하는 숙주 세포를 제공한다. 핵산은 완전한 세포 중, 세포 열분해액 중 또는 부분적으로 정제되거나 기본적으로 정제된 형태로 위치할 수 있다.
표준적인 분자생물학 기술을 이용하여 본 발명의 핵산을 얻을 수 있으며, 예를 들어 표준적인 PCR 증폭 또는 cDNA 클론 기술에 의해 항체를 코딩하는 경쇄 및 중쇄 또는 VH 및 VL 구간을 코딩하는 cDNA를 얻을 수 있다. 면역글로불린 유전자 라이브러리로부터 얻은 항체(예를 들어, 박테리오파지 전시 기술을 이용함)에 대해, 라이브러리로부터 항체를 코딩하는 한 가지 또는 다수의 핵산을 회수할 수 있다. 숙주 세포 중에 외래 핵산을 도입시키는 방법은 본 분야에서 통상적으로 공지된 바이고 사용되는 숙주 세포에 따라 변화될 수 있다.
바람직하게는, 본 발명의 핵산 분자는 경쇄 가변 영역을 코딩하는 서열번호 12, 16, 20으로부터 선택되는 것이고, 및/또는 중쇄 가변 영역을 코딩하는 서열번호 14, 18, 22, 57, 59로부터 선택되는 것이다. 보다 바람직하게는, 중쇄를 코딩하는 서열번호 14 서열을 포함하고, 및 경쇄를 코딩하는 서열번호 12 서열을 포함하거나, 중쇄를 코딩하는 서열번호 18 서열을 포함하고, 및 경쇄를 코딩하는 서열번호 16 서열을 포함하거나, 중쇄를 코딩하는 서열번호 22 서열을 포함하고, 및 경쇄를 코딩하는 서열번호 20 서열을 포함하거나, 중쇄를 코딩하는 서열번호 57 서열을 포함하고, 및 경쇄를 코딩하는 서열번호 20 서열을 포함하거나, 중쇄를 코딩하는 서열번호 59 서열을 포함하고, 및 경쇄를 코딩하는 서열번호 20 서열을 포함하는 핵산 분자이다.
단백질을 발현시키기 위하여, 본 발명의 항체를 코딩하는 핵산을 발현 벡터 중에 통합시킬 수 있다. 다양한 발현 벡터는 단백질 발현에 사용될 수 있다. 발현 벡터는 자아 복제의 염색체 외 벡터 또는 숙주 게놈에 통합되는 벡터를 포함할 수 있다. 본 발명에 사용되는 발현 벡터는 포유 동물 세포, 세균, 곤충 세포, 효모 및 체외 시스템에서 단백질을 발현시킬 수 있는 발현 벡터를 포함 하나, 이에 한정되는 것은 아니다. 본 분야에 공지된 바와 같이, 다양한 발현 벡터는 상업적 또는 다른 방식에 의해 얻을 수 있다. 본 발명에 사용되어 항체를 발현시킬 수 있다.
면역접합체
본 발명은 본문에서 서술된 항체를 포함하고 적어도 한가지 다른 유형의 기능성 분자를 추가로 포함하는 다기능 면역접합체를 제공한다. 상기 기능성 분자는 종양 표면 마커 표적 분자, 종양 억제 분자, 면역 세포의 표면 마커 표적 분자 및 검출가능 표지로부터 선택되지만 이에 한정되지 않는다. 상기 항체와 상기 기능성 분자는 공유결합 연결, 결합, 부착, 가교 등 방식에 의해 화합물을 구성할 수 있다.
하나의 바람직한 방식으로서, 상기 면역접합체는 본 발명의 항체 및 적어도 하나의 종양 표면 마커 표적 분자 또는 종양 억제 분자를 포함할 수 있다. 상기 종양 억제 분자는 항종양 사이토카인이거나 항종양 독소일 수 있다. 바람직하게는, 상기 사이토카인은 IL-2, IL-7, IL-12, IL-15, I형 IFN, TNF-α를 포함하지만 이에 한정되지 않는다. 구체적인 실시형태에 있어서, 상기 종양 표면 마커 표적 분자는 본 발명의 항체가 표적으로 하는 동일한 종양의 표면 마커를 표적으로 하는 분자이다. 예를 들어, 상기 종양 표면 마커 표적 분자는 종양 표면 마커를 결합한 항체 또는 리간드일 수 있으며, 예를 들어, 본 발명의 항체와 협동 작용하여 보다 정밀하게 종양 세포를 표적화할 수 있다.
하나의 바람직한 방식으로서, 상기 면역접합체는 본 발명의 항체 및 검출가능 표지를 포함할 수 있다. 상기 검출가능 표지는 효소, 보조기, 형광 재료, 발광 재료, 생물발광 재료, 방사성 재료, 양전자 방출 금속 및 비방사성 상자성 금속 이온과 같은 형광 마커, 발색 마커를 포함하지만 이에 한정되지 않는다. 또한 하나 이상의 마커를 포함할 수도 있다. 검출 및/또는 분석 및/또는 진단 목적으로 항체를 표지하기 위해 사용되는 표지는 면역조직화학염색(조직) 샘플, 유동 세포 계측법 등과 같은 특정 검출/분석/진단 기술 및/또는 방법에 의존한다. 본 분야의 공지된 검출/분석/진단 기술 및/또는 방법에 적합한 표지는 본 분야의 기술자에게 있어서 숙지된 것이다.
하나의 바람직한 방식으로서, 상기 면역접합체는 본 발명의 항체 및 면역 세포의 표면 마커 표적 분자를 포함할 수 있다. 상기 면역 세포의 표면 마커 표적 분자는 면역 세포 표면 마커를 결합한 항체 또는 리간드일 수 있으며, 면역 세포에 본 발명의 항체를 보유하는 면역 세포를 식별할 수 있고, 동시에 본 발명의 항체는 면역 세포를 종양 세포에 표적화하여 면역 세포가 종양을 특이적으로 살상하도록 유도할 수 있다. 상기 면역 세포 표면 마커는 CD3, CD16, CD28로부터 선택될 수 있으며, 보다 바람직하게는, 면역 세포 표면 마커를 결합한 항체는 항-CD3 항체이다. 면역 세포는 T 세포, NK 세포, NKT 세포로부터 선택될 수 있다.
직접적 또는 간접적(예를 들어, 어댑터에 의함) 접합에 의해 면역접합체를 화학적으로 생산하는 수단으로서, 상기 면역접합체는 본 발명의 항체 및 적합한 다른 단백질을 포함하는 융합 단백질로서 생성될 수 있다. 융합 단백질은 본 분야의 공지된 방법에 의해 생성될 수 있으며, 예를 들어 핵산 분자를 구축하고 잇따라 상기 핵산 분자를 발현시켜 재조합적으로 생성되며, 상기 핵산 분자는 해독틀에 부합되는 항체를 코딩하는 뉴클레오티드 서열 및 적절한 표지를 코딩하는 뉴클레오티드 서열을 포함한다.
본 발명의 다른 한편에서는 본 발명의 적어도 한가지 항체, 그 기능 변이체 도는 면역접합체를 코딩하는 핵산 분자를 제공한다. 일단 관련 서열을 얻으면 재조합법으로 관련 서열을 대량적으로 얻을 수 있다. 이는 통상적으로 벡터에 클로닝하고, 다시 세포로 옮긴 다음, 통상적인 방법에 의해 증식된 후의 숙주 세포로부터 관련 서열을 분리하여 얻는 것으로써 수행된다.
본 발명은 또한 상기 적당한 DNA 서열 및 적당한 프로모터를 포함하거나 서열을 제어하는 벡터에 관한 것이다. 이러한 벡터는 적당한 숙주 세포를 형질전환하여 이것이 단백질을 발현시키는데 사용될 수 있다. 숙주 세포는 세균 세포와 같은 원핵세포일 수 있다. 또는 효모 세포와 같은 저등 진핵세포일 수 있다. 또는 포유동물 세포와 같은 고등 진핵세포일 수 있다.
항-BCMA 항체를 포함한 키메라 항원 수용체
본 발명은 본 발명의 항체 또는 항체 단편을 포함하는 다양한 키메라 항원 수용체(CAR)를 제공하며, 상기 CAR-T 세포는 항종양 성질을 나타낸다. 일부 실시사례에서, CAR을 코딩하는 바이러스 벡터 형질도입 세포(예를 들어, T 세포)를 사용한다. 일부 실시사례에서, 바이러스 벡터는 렌티바이러스 벡터이다. 일부 실시방안에서 세포는 CAR을 안정적으로 발현시킬 수 있다.
일 바람직한 예에서, CAR의 BCMA 결합 부분은 IgG 항체에 비해 등가의 결합친화력을 유지하는 scFv 항체 단편이고, 예를 들어 동등한 효능으로 동일한 항원을 결합한다. 상기 항체 단편은 기능적이므로 면역 반응의 활성화, 표적 항원으로부터의 신호 전달 개시의 억제, 키나아제 활성의 억제 등의 생물화학적 반응을 제공한다. 따라서 본 발명은 공정화에 의해 T 세포에 도입된, WT1 결합 도메인을 포함하는 BCMA-CAR을 제공하며, 이를 입양면역요법(Adoptive immunotherapy)에 사용한다.
한편, CAR의 항-BCMA 항원 결합 도메인은 그로부터 유래된 쥐 서열 scFv가 인간화된 scFv 항체 단편이다.
한편, 본 발명의 CAR은 특정 항체의 항원 결합 도메인과 세포내 신호 전달 분자를 조합시킨다. 예를 들어, 일부 양태에 있어서, 세포내 신호 전달 분자는 CD3ξ쇄, 4-1BB 및CD28 신호 전달 모듈 및 그 조합을 포함하지만 이에 한정되지 않는다.
한편, BCMA-CAR은 CD137(4-1BB) 신호 전달 도메인, CD28 신호 전달 도메인, CD3ξ 신호 도메인 및 이들의 임의의 조합을 선택하는 적어도 하나의 세포내 신호 전달 도메인을 포함한다. 한편, BCMA-CAR은 하나 이상의 비CD137(4-1BB) 또는 CD28의 공자극 분자로부터 유래된 적어도 하나의 세포내 신호 전달 도메인을 포함한다.
예시적으로서, BCMA-CAR의 서열은 7A12-BBZ(서열번호 75), 25C2-BBZ(서열번호 76), 25D2-BBZ(서열번호 77), 7G2-BBZ(서열번호 78), 7A12-28Z(서열번호 79), 7A12-28BBZ(서열번호 80), 7G2-28Z(서열번호 81), 7G2-28BBZ(서열번호 82), 25C2-28Z(서열번호 83), 25C2-28BBZ(서열번호 84), 25D2-28Z(서열번호 85), 25D2-28BBZ(서열번호 86)일 수 있으며, 상기 서열번호 75-86의 막관통 도메인과 세포내 도메인은 본 분야의 기술자가 통상적인 막관통 도메인과 세포내 도메인을 선택하여 대체할 수 있고, 본원 발명의 보호 범위에 속한다.
키메라
항원 수용체 변형된 T 세포
본 발명은 본 발명에 서술된 키메라 항원 수용체를 포함하는 면역 세포를 더 제공한다.
다른 한편, 본 발명에 의해 제공된 키메라 항원 수용체 변형된 T 세포는 외인성 사이토카인의 코딩 서열을 더 보유한다. 바람직하게는, 상기 사이토카인은 IL-12, IL-15 또는 IL-21을 포함한다. 상기 면역 세포는 바람직하게는, T 림프구, NK 세포 및 NKT 세포로부터 선택된다.
다른 한편, 본 발명에 의해 제공된 키메라 항원 수용체 변형된 T 세포는 천연 PD-1, 또는 PD-L1에 결합할 수 있는 돌연변이 PD-1, 또는 PD-L1에 결합할 수 있는 천연 또는 돌연변이 PD-1의 단편, 또는 항-PD-L1의 항체와 같은 PD-L1 차단제 또는 PD-L1을 차단하는 단백질을 더 보유한다. 예시적으로서, PD-L1 차단제는 서열번호 70이 코딩하는 아미노산 서열을 포함할 수 있다
약학 조성물
본 발명의 항체, 상기 항체를 포함하는 면역접합체 및 유전자 변형된 면역 세포는 약학 조성물 또는 진단 시약을 제조하는데 응용될 수 있다. 상기 조성물은 유효량의 상기 항체, 면역접합체 또는 면역 세포를 포함한 이외, 약학적으로 허용 가능한 벡터를 추가로 포함할 수 있다. 용어 "약학적으로 허용 가능한"은 분자 본체 및 조성물을 동물 또는 인간에 적절하게 투여할 경우, 이들에 불리하고 민감하거나 다른 불량 반응이 일어나지 않는 것을 가리킨다.
약학적으로 허용 가능한 벡터 또는 그 성분으로서의 일부 물질의 구체적인 예로, 유당, 포도당 및 자당과 같은 당류; 옥수수 전분 및 감자 전분과 같은 전분; 카르복시메칠셀룰로오스나트륨, 에틸셀룰로오스 및 메틸셀룰로오스와 같은 셀룰로오스 및 그 유도체; Gummi Tragacanthae 분말; 맥아; 젤라틴(gelatin); 활석; 스테아린산 및 스테아린산마그네슘(Magnesium Stearate)과 같은 고체 윤활제; 황산칼슘; 땅콩 기름, 면실유, 참기름, 올리브유, 옥수수 기름, 코코아 기름과 같은 식물유; 프로필렌글리콜, 글리세린, 솔비톨, 만니톨 및 폴리에틸렌글리콜과 같은 다가 알코올; 알긴산; Tween과 같은 유화제; 소듐라우릴황산염(Sodium Lauryl Sulfate) 과 같은 습윤제; 착색제; 조미료; 압편제, 안정제; 항산화제; 방부제; 무열원수; 등삼투염 용액; 인산염 완충액 등이 있을 수 있다.
본 발명의 조성물은 수요에 따라 다양한 제형으로 형성될 수 있으며, 환자의 종류, 나이, 체중 및 대체적인 질병 상황, 약 투여 방식 등 요소에 따라 환자에게 유익한 투여량은 의사에 의해 결정될 수 있다. 약 투여 방식은 예를 들어 주사 또는 다른 치료 방식을 사용할 수 있다.
본 발명의 이점:
1. 본 발명은 BCMA에 대한 특이 항체를 제공한다;
2. 본 발명은 BCMA을 표적으로 하는 면역 효과기 세포를 제공한다; 및
3. 본 발명의 항체는 BCMA를 발현하는 종양 세포에 효과적으로 결합할 수 있으며, 본 발명의 면역 효과기 세포는 BCMA를 발현하는 종양 세포에 대하여 현저한 살상 능력을 나타내므로, 본 발명의 항체 및 면역 효과기 세포는 다발성 골수종의 치료에 유효적 및 안전적으로 응용될 수 있음으로써 다발성 골수종의 치료에 물질적 기초를 마련한다.
아래에서 구체적인 실시예를 결부하여 본 발명을 더 상세하게 설명한다. 이러한 실시예는 단지 본 발명을 설명하기 위한 것일 뿐, 본 발명의 범위를 한정하려는 것이 아님을 이해해야 한다. 아래 실시예에서 비고하지 않은 조건의 실험 방법은 일반적으로 J. Sambrook 등이 편집한 분자 클론 실험 지침, 제3버전, 과학출판사, 2002에서 서술된 조건 또는 제조업체에서 권장하는 조건을 따른다
실시예 1. BCMA 재조합 단백질의 제조
a. BCMA_huFc, BCMA_muFc 발현 플라스미드의 구축
인간 BCMA의 세포외 부분 Met1-Ala54(서열번호 38) 유전자(서열번호 39)를 체외 합성하고, 상기 유전자를 인간 IgG1 중쇄 일정부위를 포함한 Fc 부분 Asp104-Lys330의 진핵 발현 플라스미드 중에 삽입하며 중간은 "GS"로 연결시켜, 융합 발현 단백질 BCMA_huFc(서열번호 40)를 형성하며, 대응되는 유전자 서열은 서열번호 41에 표시된 바와 같다.
BCMA 세포외 부분 유전자(서열번호 39)를 쥐 IgG1 중쇄 일정부위를 포함한 Fc 부분 Arg100-Lys324의 진핵 발현 플라스미드 중에 삽입하고 중간은 "GS"로 연결시켜, 융합 발현 단백질 BCMA_muFc(서열번호 42)를 형성하며, 대응되는 유전자 서열은 서열번호 43에 표시된 바와 같다.
b. BCMA_huFc, BCMA_muFc의 순시적 형질전환 발현
1) 형질전환 하루 전에 125 ml 배양 플라스크에서 6 내지 7 x 105/ml 293F 세포를 접종시킨다.
2) 형질전환 당일에 28 ml FreeStyleTM 293 expression medium에서 3 x 107 세포를 조정한다.
3) 하기와 같은 조작 단계에 따라 lipid-DNA 복합체를 제조한다.
Opti-MEM I로 30 ug DNA를 희석하고 최종 부피 1 ml로 충분히 섞는다.
Opti-MEM I로 60 ul 293fectinTM을 희석하고 최종 부피 1 ml로 충분히 섞는다.
실온에서 5분 동안 부화시킨다.
4) 희석한 DNA와 293fectinTM을 혼합하고 실온에서 20분 동안 부화시킨다.
5) 2 ml DNA-293fectin 복합체를 28 ml 세포 중에 넣고, 37도, 8 % CO2, 125 rpm 조건에서 3 내지 4일 배양하여 상청액을 수집한다.
c. BCMA_huFc, BCMA_muFc의 정제
1) 13000 rpm 조건에서 상청액을 15분 동안 원심분리한다.
2) 단백질 A 필러를 사용하여 친화 정제를 진행하며 구체적인 조작 단계는 하기와 같다.
균형: 10개 컬럼 부피의 균형 완충액으로 단백질 A 필러를 균형시킨다.
샘플 로딩: 0.45 μm 필터로 처리된 모든 샘플을 로딩한다.
세척: 물질 유출없이 통과할 때까지 20개 컬럼 부피 균형 완충액으로 세척한다.
용리: 10개 컬럼 부피의 용리 완충액을 첨가하여 표적 단백질을 용리시킨다(6 % 중화 완충액을 수집 튜브에 사전에 첨가함).
용액 배합
균형 완충액: PBS pH 7.4
용리 완충액: 0.1M 글리신 pH 2.6
중화 완충액: 1M Tris
3) 용리는 0.22 um의 막으로 여과하고, 10 KD의 단면 유동을 갖는 밀리 포어 한외 여과 튜브를 사용하여 1 ml 이내의 부피로 농축시키고, PD-Midi 탈염 칼럼을 사용하여 탈염시키고, 1.5 ml의 샘플을 수집한다. OD280/1.47에 의해 단백질 농도를 측정한다.
SDS-PAGE에 의해 2 ug 수집하였으며, 결과는 도 1에 도시된 바와 같다.
실시예 2. K562-BCMA 안정적 형질전환 세포주의 구축
1. pWPT-BCMA 패키징 플라스미드의 구축
인간 BCMA의 전장(서열번호 37) 유전자를 체외 합성하고 효소제한부위 MluI, SalI(서열번호 44)애 도입한다. 이중 제한효소에 의해 렌티바이러스 패키징 플라스미드 pWPT 중에 삽입한다.
2. 렌티바이러스의 패키징
a) Lenti-x 293T 소화 후 8 × 106 세포로 10 cm 접시에 늘여놓고 37 ℃에서 배양한다.
b) 이튿날 오전: 플라스미드/PEI 혼합액을 배합하여 만든다.
pWPT-BCMA 5ug
psPAX.2 7.5ug
pMD2.G 2.5ug
800 uL DMEM 중에 첨가하여 부화시킨다. PEI에 대응되는 양은 45 uL이고 800 uL OMEM 중에 첨가하여 5분 동안 부화시킨다.
c) 플라스미드 혼합액을 PEI 부화액 중에 적하하고 가볍게 혼합하여 실온에서 20분 동안 부화시킨다.
d) 배합하여 만든 플라스미드/PEI 혼합액을 세포 중에 적하하고 혼합시킨다. 5시간 후 액체를 교환한다.
e) 72시간 후 바이러스 상청액을 수집하여 0.45 um 필터로 여과한 후 4 ℃에서 잠시 보존한다.
3. BCMA 바이러스에 의한 K562 세포 감염
a) 제1일 오후: 양호하게 성장한 K562 세포를 1 x 105 세포로 6 cm 접시에 늘여놓는다.
b) 제2일 오후: K562 세포 상청액을 제거하고, 3 mL의 신선한 완전 배지를 첨가하며, 또 1 mL의 바이러스 원액을 첨가하고, 최종 농도가 6 ug/mL인 폴리브렌을 첨가한다.
c) 제3일 오전: 상청액을 제거하고 5 mL의 신선한 완전 배지를 첨가한다.
d) 제6일 오전: 부분적 세포를 취한 후 유동식 검출을 진행한다.
4. K562-BCMA 혼합 클론 감정
a) K562-BCMA 혼합 클론 및 K562 음성 세포를 1 % NCS(1 % 송아지 혈청을 함유하는 PBS)로 2 회 세척한 후 1차 항체로 부화한다. huBCMA 항체(abcam, #17323)를 1 % NCS 1:1000으로 희석하고, 각각 50 uL 첨가하며 4 ℃에서 45분 동안 부화시킨다.
b) 세포를 1 % NCS로 2회 세척한 후 2 차 항체로 부화한다. DyLight488로 표기된 염소 저항 쥐 IgG(abcam, #ab98420)를 1 % NCS 1:200으로 희석하고, 각각 50 uL 첨가하며 4 ℃에서 45분 동안 부화시킨다.
c) 세포를 1 % NCS로 3 회 세척한 후 1 % NCS 중에 재현탁하고 Guava easyCyteTM HT System 기기를 사용하여 검출하며, 결과는 도 2a에 도시된 바와 같다.
5. K562-BCMA 단일 클론 플레이팅
a) K562-BCMA 혼합 클론 세포를 통계하여 유한희석법으로 단일 클론 플레이팅을 진행한다.
b) 한주일 후 클론 성장 정황을 관찰하고 배지를 보충 첨가한다.
c) 2주 후 단일 클론 성장한 셀 중 세포를 선택하여 확대배양을 진행한다.
6. K562-BCMA 단일 클론 감정
검출 방법은 혼합 클론 감정과 동일하며, 실험 결과는 도 2B에 도시된 바와 같다. 여기서 4개의 단일 클론은 BCMA 양성 클론이다.
실시예 3. 전인 박테리오파지 디스플레이 라이브러리를 이용한 BCMA에 대해 특이적인 scFv 선별
본 발명에서 사용된 박테리오파지 디스플레이 라이브러리는 본 회사에서 구축한 전인의 천연 scFv 박테리오파지 라이브러리이고, 용량은 1E+11이다. 본 분야의 기술자에게 공지된 선별 방법을 이용하여 BCMA에 대해 고도로 특이적인 scFv 단편을 얻었다. 간단히 말해서, 10 ug/ml 항원 BCMA_huFc 및 인간 Fc 단편을 각각 면역 튜브에 코팅한다. Fc 단편의 영향을 감소시키기 위하여 박테리오파지 라이브러리를 인간 Fc 단편이 코팅된 면역 튜브 중에 넣고 1시간 결합시킨다. 상청액을 취하여 BCMA_huFc가 코팅된 면역 튜브 중에 넣고 1.5시간 결합시키며 잇따라 비특이적인 박테리오파지를 세척하고 결합된 박테리오파지를 용리시킨 후 로그성장기의 대장균 TG1에 대해 감염시킨다. 용리된 박테리오파지를 확대 배양하고 다음 라운드의 선별을 위해 PEG/NaCl 침전으로 확대된 박테리오파지 라이브러리를 정제하였다. 패닝에 의해 3 내지 4회 순환을 진행하여 BCMA와 특이적으로 결합되는 scFv 박테리오파지 단일 클론을 축적한다. BCMA_huFc에 대한 표준 ELISA 방법에 의해 양성 클론을 결정한다. ELISA는 인간 Fc 단편을 무관 항원으로 사용하여 항체의 특이성을 검증하는 것이다. 총 2470개의 클론을 선별하였고, 그중 160개 클론된 ELISA 실험은 BCMA_huFc를 특이적으로 결합하고 인간의 Fc 단편을 결합하지 않는다. 여기서 76개 신호값이 높은 클론을 선택하여 시퀀스를 진행하여 23개 단일 서열을 얻었다. 이 23개 클론을 발현 정제하여 3개 특이적으로 결합된 K562-BCMA 세포(도 4)를 얻었으며 클론 명칭은 7G2, 7A12, 23F10이다. 시퀀스 분석 결과, 7A12의 중쇄 가변 영역은 서열번호 13에 의해 표시되는 아미노산 서열이고, 경쇄 가변 영역은 서열번호 11에 의해 표시되는 아미노산 서열이다. 7G2의 중쇄 가변 영역은 서열번호 17에 의해 표시되는 아미노산 서열이고, 경쇄 가변 영역은 서열번호 15에 의해 표시되는 아미노산 서열이다. 23F10의 중쇄 가변 영역은 서열번호 21에 의해 표시되는 아미노산 서열이고, 경쇄 가변 영역은 서열번호 19에 의해 표시되는 아미노산 서열이다.
7A12의 중쇄 가변 영역의 아미노산 서열(서열번호 13):
EVQLLESGGGLVQPGGSLRLSCAASGFTFS SYAMS WVRQAPGKGLEWVS AISGSGGSTYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR YPYLAFDY WGQGTLVTVSS(고딕활자체에 밑줄을 그은 부분은 CDR 서열을 나타냄)
7A12의 중쇄 가변 영역의 뉴클레오티드 서열(서열번호 14):
GAGGTGCAATTGCTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTTAGCAGTTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAGATGAACAGCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGCGTTACCCATACCTGGCATTCGACTACTGGGGCCAAGGAACCCTGGTCACCGTCTCGAGT
7A12의 경쇄 가변 영역의 아미노산 서열(서열번호 11)
EIVLTQSPGTLSLSPGERATLSC RASQSVSSSYLA WYQQKPGQAPRLLIY GASSRAT GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYC QQYGYPPSY TFGQGTKVEIK(고딕활자체에 밑줄을 그은 부분은 CDR 서열을 나타냄)
7A12의 경쇄 가변 영역의 뉴클레오티드 서열(서열번호 12):
GAAATCGTGTTAACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCTTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGAGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGATCCGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTACGGTTACCCACCATCTTACACGTTCGGCCAGGGGACCAAAGTGGAAATCAAA
7G2의 중쇄 가변 영역의 아미노산 서열(서열번호 17):
EVQLLESGGGLVQPGGSLRLSCAASGFTFS SYAMS WVRQAPGKGLEWVS AISGSGGSTYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK LSGDAAMDY WGQGTLVTVSS(고딕활자체에 밑줄을 그은 부분은 CDR 서열을 나타냄)
7G2의 중쇄 가변 영역의 뉴클레오티드 서열(서열번호 17):
GAGGTGCAATTGCTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTTAGCAGTTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAGATGAACAGCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGAAACTGTCTGGTGATGCAGCAATGGACTACTGGGGCCAAGGAACCCTGGTCACCGTCTCGAGT
7G2의 경쇄 가변 영역의 아미노산 서열(서열번호 15):
EIVLTQSPGTLSLSPGERATLSC RASQSVSSSYLA WYQQKPGQAPRLLIY GASSRAT GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYC QQYGYPPRY TFGQGTKVEIK(고딕활자체에 밑줄을 그은 부분은 CDR 서열을 나타냄)
7G2의 경쇄 가변 영역의 뉴클레오티드 서(서열번호 16):
GAAATCGTGTTAACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCTTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGAGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGATCCGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTACGGTTACCCACCAAGATACACGTTCGGCCAGGGGACCAAAGTGGAAATCAAA
23F10의 중쇄 가변 영역의 아미노산 서열(서열번호 21):
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVS AISGSGGSTYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK VRPFWGTFDY WGQGTLVTVSS(고딕활자체에 밑줄을 그은 부분은 CDR 서열을 나타냄)
23F10의 중쇄 가변 영역의 아미노산 서열(서열번호 22):
GAGGTGCAATTGCTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCCGGATTCACCTTTAGCAGTTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGGTTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAGATGAACAGCCTGAGAGCCGAGGACACGGCCGTATATTACTGTGCGAAAGTTCGTCCATTCTGGGGTACTTTCGACTACTGGGGCCAAGGAACCCTGGTCACCGTCTCGAGT
23F10의 중쇄 가변 영역의 아미노산 서열(서열번호 19):
EIVLTQSPGTLSLSPGERATLSC RASQSVSSSYLA WYQQKPGQAPRLLIY GASSRAT GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYC QQYFNPPEY TFGQGTKVEIK(고딕활자체에 밑줄을 그은 부분은 CDR 서열을 나타냄)
23F10의 중쇄 가변 영역의 아미노산 서열(서열번호 20):
GAAATCGTGTTAACGCAGTCTCCAGGCACCCTGTCTTTGTCTCCAGGGGAAAGAGCCACCCTCTCTTGCAGGGCCAGTCAGAGTGTTAGCAGCAGCTACTTAGCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATGGAGCATCCAGCAGGGCCACTGGCATCCCAGACAGGTTCAGTGGCAGTGGATCCGGGACAGACTTCACTCTCACCATCAGCAGACTGGAGCCTGAAGATTTTGCAGTGTATTACTGTCAGCAGTACTTCAACCCACCAGAATACACGTTCGGCCAGGGGACCAAAGTGGAAATCAAA
실시예 4. 항-BCMA scFv_Fc 융합 항체의 구축 및 그 진핵세포에서의 순시적 형질전환 발현 정제, 활성 감정
7G2, 7A12, 23F10의 VH 및 VL 단편에 대해 각각 프라이머를 설계하고, 15개 플렉셔블 아미노산(GGGGSGGGGSGGGGS)으로 조성된 linker 연결을 도입하여 scFv를 조성한다. VH 상류에 NheI의 효소제한부위와 보호 염기를 도입하고, VL 하류에 BamHI의 효소제한부위와 보호 염기를 도입한다. 1 % 아가로오스 겔 전기영동에 의해 PCR 산물을 분석하고 정제 및 회수한다. 효소 절단 후 V152(상하이 루이진생물기술유한회사) 진핵 발현 벡터를 연결시킨다. 293fectinTM Transfection reagent(Invitrogen, 12347-019) 또는 폴리에틸렌이민(PEI)(Sigma-Aldrich, 408727)을 이용하여 로그 성장기의 293F 세포를 순시적 형질전환시킨다. 형질전환 5-7일 후, 배양 상청액을 수집하여 단백질 A에 의해 친화 정제를 진행한다. SDS PAGE를 통하여 얻은 항체에 대해 정량 및 정성 분석(도 5)을 진행한다.
유세포분석법에 의해 항체와 BCMA를 안정적으로 발현하는 K562의 결합을 테스트한다. FACs 검출의 구체적인 방법은 다음과 같다. 세포를 수확하고, 성장 배지로 세포를 1회 세척하며, PBS 중에 재현탁시키고, 세포 농도를 4E+5 세포/ml로 조정한다. 얼음에서 구배 희석된 scFv_Fc 융합 항체를 세포와 30분 동안 부화시키고, 항체의 시작 농도는 500 nM이고, 5배 희석하여 총 7개 기울기가 있다. 그후 FITC 표지의 항-쥐 IgG 제2항체와 부화시킨다. 두번의 세척 단계 이후, Guava easyCyteTM HT System 기기로 검출한다. 도 6은 항체7A12, 7G2, 23F10 scFv_Fc 융합 형태와 K562-BCMA 결합 정황을 나타낸다. 이 3개 항체는 모두 농도에 의존하며 결합하고, EC50은 각각 3.13 nM, 3.42 nM, 5.61 nM이다.
실시예 5. 표면 플라즈몬 공명 기술(SPR)을 이용한 항체의 친화력 측정
biacoreT200을 사용하여 BCMA에 대한 상이한 항체의 친화력을 측정한다. 구체적으로 하기와 같이 수행한다.
BCMA_huFc를 아미노기와 결합된 방식으로 CM5 칩에 약 500 RU까지 코팅시키고, 구배 희석된 항체를 30 ul/min의 유속으로 유동상으로서 항원 코팅 채널을 통과시켰다. 작동 완충액은 HBS-N, 온도는 25도이다. 실험 데이터는 BIAevaluation3.2에 의해 분석하고, 역학 곡선은 1:1의 langmuir 모델로 피팅한다. 여기서 7A12(scFv_Fc)의 KD는 663 pM이고, 7G2(scFv_Fc)의 KD는 499 pM이고, 23F10(scFv_Fc)의 KD는 667 pM(도 7 참조)이다. 구체적인 파라미터는 하기 표에 표시된 바와 같다.
실시예 6. FACs를 이용한 항체와 종양 세포주의 결합 측정
RPMI8226은 인간 다발성 골수종 말초혈액 B 림프구이다. FACs 검출의 구체적인 방법은 다음과 같다. 세포를 수확하고, 성장 배지로 세포를 1회 세척하며, PBS 중에 재현탁시키고, 세포 농도를 4E+5 세포/ml로 조정한다. 얼음에서 구배 희석된 scFv_Fc 융합 항체를 세포와 30분 동안 부화시키고, 항체의 시작 농도는 500 nM이고, 5배 희석하여 총 7개 기울기가 있다. 그후 FITC 표지의 항-쥐 IgG 제2항체와 부화시킨다. 두번의 세척 단계 이후, Guava easyCyteTM HT System 기기로 검출한다. 도 8에 도시된 바와 같이, 항체 7A12, 7G2, 23F10 scFv_Fc 융합 형태는 세포주 RPMI8226에서 농도 기울기에 의존하며 결합한다.
실시예 7. 항-BCMA 항체와 BCMA 리간드 APRIL의 경쟁성 결합 실험
1. APRIL 융합 단백질의 발현 정제 재조합
인간 APRIL His115-Leu250 및 인간의 IgG1 중쇄 일정부위를 발현하는 Fc 단편 Asp104-Lys330의 융합 단백질을 재조합시고, 중간은 "GS"로 연결시키며, 융합 단백질 APRIL_huFc(서열번호 45)에 대응되는 유전자 서열은 서열번호 46에 표시된 바와 같다. 실시예 1에 서술된 방법으로 순시적 형질전환 발현 정제를 진행한다.
2. 경쟁성 ELISA
50 ng/ml 100 ul/빈 BCMA_muFc와 ELISA 플레이트에서 코팅되고, 하룻밤 동안 4도의 온도에서 코팅하였다. 다음 날, 코팅된 플레이트를 PBS로 3회 세척하고, 2 % 탈지 분유를 함유하는 PBS를 첨가하고, 실온에서 1 시간 동안 밀봉시킨다. 동시에 40 ng/ml APRIL_huFc 및 구배 희석된 항체 7A12, 7G2 또는 23F10(시작 농도 200 nM이고, 3배 희석하며, 7개 기울기가 있음)을 첨가한다. 실온에서 1시간 부화하고 PBST로 세번 세척하고, PBS로 세번 세척하며 1:1000으로 희석된 HRP 표지의 쥐 저항 인간 Fc 항체를 넣고 실온에서 1시간 동안 부화시키고, PBST로 세번 세척하며, PBS로 세번 세척한다. TMB 발색을 넣고 효소라벨기기로 숫자를 판독한다.
실험 결과는 도 9에 도시된 바와 같으며, 7A12, 7G2, 23F10은 모두 APRIL과 BCMA의 결합을 현저하게 억제할 수 있다. 이는 본 발명의 항체가 BCMA와 그 천연 리간드의 결합을 억제할 수 있다는 것을 설명한다.
실시예 8. 항-BCMA 키메라 항원 수용체 플라스미드(CAR)의 구축
a. 항-BCMA 항체 7A12 키메라 항원 수용체 플라스미드의 구축
PRRLSIN-cPPT.EF-1α를 벡터로 하여, 항체 7A12를 발현하는, PRRLSIN-cPPT.EF-1α-7A12-28Z, PRRLSIN-cPPT.EF-1α-7A12-BBZ 및 PRRLSIN-cPPT.EF-1α-7A12-28BBZ를 포함하는 2대, 3대 키메라 항원 수용체의 렌티바이러스 플라스미드를 구축한다. 7A12-28Z 서열은 CD8α 신호 펩타이드(서열번호 23), 7A12scFv(서열번호 47), CD8 힌지(서열번호 25), CD28 막관통 영역(서열번호 27) 및 세포내 신호 전달 도메인(서열번호 29) 및 CD3의 세포내 단편 CD3ξ(서열번호 31)로 조성된다. 7A12-BBZ 서열은 CD8α 신호 펩타이드(서열번호 23), 7A12scFv(서열번호 47), CD8 힌지(서열번호 25) 및 막관통 영역(서열번호 33), CD137 세포내 신호 전달 도메인(서열번호 35) 및 CD3ξ(서열번호 31)로 조성된다. 7A12-28BBZ서열은 CD8α 신호 펩타이드(서열번호 23), 7A12-scFv(서열번호 47), CD8 힌지(서열번호 25), CD28 막관통 영역(서열번호 27) 및 세포내 단편(서열번호 29), CD137 세포내 신호 전달 도메인(서열번호 35) 및 CD3ξ(서열번호 31)로 조성된다.
b. 항-BCMA 항체 7G2 키메라 항원 수용체 플라스미드의 구축
PRRLSIN-cPPT.EF-1α를 벡터로 하여, 항체 7G2를 발현하는, PRRLSIN-cPPT.EF-1α-7G2-28Z, PRRLSIN-cPPT.EF-1α-7G2-BBZ 및 PRRLSIN-cPPT.EF-1α-7G2-28BBZ를 포함하는 2대, 3대 키메라 항원 수용체의 렌티바이러스 플라스미드를 구축한다. 7G2-28Z 서열은 CD8α 신호 펩타이드(서열번호 23), 7G2scFv(서열번호 48), CD8 힌지(서열번호 25), CD28 막관통 영역(서열번호 27) 및 세포내 신호 전달 도메인(서열번호 29) 및 CD3의 세포내 단편CD3ξ(서열번호 31)로 조성된다. 7G2-BBZ 서열은 CD8α 신호 펩타이드(서열번호 23), 7G2scFV(서열번호 48), CD8 힌지(서열번호 25) 및 막관통 영역(서열번호 33), CD137 세포내 신호 전달 도메인(서열번호 35) 및 CD3ξ(서열번호 31)로 조성된다. 7G2-28BBZ 서열은 CD8α 신호 펩타이드(서열번호 23), 7G2-scFv(서열번호 48), CD8 힌지(서열번호 25), CD28 막관통 영역(서열번호 27) 및 세포내 단편(서열번호 29), CD137 세포내 신호 전달 도메인(서열번호 35) 및 CD3ξ(서열번호 31)로 조성된다.
실시예 9. CAR-T 세포의 제조
1. BCMA CAR 렌티바이러스 벡터를 표적으로 하는 렌티바이러스 패키징, 바이러스 농축 및 적도 측정
a. 렌티바이러스 패키징
1) 293T 세포를 10 cm 세포 배양접시에 접종시키고, 형질전환하기 위해 37 ℃, 5 % CO2 조건에서 하룻밤 동안 배양하며, 배양기는 10 % 소태아혈청(Gibico)을 함유한 DMEM이다.
2) 표적 유전자 플라스미드 PRRLSIN-cPPT.EF-1α-EGFP(Mock) 또는 관련 CAR 플라스미드 5.4 μg을 각각 패키징 플라스미드 pRsv-REV 6.2 μg, RRE-PMDLg 6.2 μg, Vsvg 2.4 μg과 800 μL 대조군 DMEM 배양액에 용해시키고 균일하게 혼합시킨다.
3) 60 μg PEI를 800 μl의 무혈청 DMEM 배양액 중에 용해시키고, 가볍게 균일하게 혼합시키며(또는 1000 rpm에서 5초 동안 소용돌이시킴), 실온에서 5분 동안 부화시킨다.
4) 형질전환 복합체의 형성: 플라스미드 혼합액을 PEI 혼합액에 넣고 첨가 후, 즉시 소용돌이 혼합 또는 가볍게 균일하게 혼합하며, 실온에서 20분 동안 부화시킨다.
5) 형질전환 복합체 1.6 ml를 11 ml DMEM 배지를 함유한 10 cm 배양접시(액체를 교환 할 필요가 없음)에 적가한다. 4-5시간 후, 10 % FBS의 DMEM 배지로 형질전환된 293T 세포에게 액체를 바꾸어준다. 37 ℃에서 72시간 동안 부화시키고, 바이러스 상청액을 수집한다.
b. 렌티바이러스 농축
1) 5X PEG8000NaCl 배합: NaCl 8.766 g, PEG8000 50 g을 200 ml Milli-Q 순수물에 용해시킨다. 121 ℃에서 30 분 동안 습열멸종시킨다. 4 ℃에 저장한다.
2) 0.45 μm 필터를 사용하여 렌티바이러스 상청액을 여과한다. 각각 30 ml 여과한 후의 바이러스 초기액을 7.5 ml의 5X PEG-8000 NaCl 모액에 넣는다. 20 내지 30분에 한번씩 혼합시키고, 총 3 내지 5회 진행한다. 4 ℃에서 하룻밤 동안 놓아둔다. 4 ℃, 4000 g 조건에서 20분 동안 원심분리한다.
3) 상층액을 흡인하고 1 내지 2 분 동안 튜브를 정치한 후 잔여 액체를 흡수한다. 적당한 양의 렌티바이러스 용해액을 넣고 렌티바이러스 침전을 용해시킨다. 분류한 후 -80 ℃에 저장한다.
c. 렌티바이러스 적도 측정
1) 293T 세포를 2×05의 세포개수로 1 ml/well의 부피로 6well 배양판에 접종시킨다. 0.6 μl/ml에 따라 초기 농도 10 ug/μl의 폴리브렌 용액을 최종 농도 6 ug/ml가 되도록 첨가한다. 37 ℃, 5 % CO2 조건에서 1시간 동안 배양하고 배양액은 10 % 소태아혈청을 함유한 DMEM이다.
2) 10 μL/well의 바이러스 농축액을 3개 기울기에서 5배 희석하고, 37 ℃, 5 % CO2 조건에서 배양한다.
3) 감염 72시간 후, 췌장 효소로 293T 세포를 소화시키고, 1 ml DMEM(10 % FBS)을 넣어 소화를 종료시키며, 세포 현탁액을 2 ml 원심분리 튜브 중(2등분)에 전이시켜 5000 rpm에서 5분 동안 원심분리하고 상청액을 제거한다. PBS(2 % NBS)로 두번 세척한다.
4) 대조군의 세포에 50μl PE-SA(1:200으로 희석) 항체를 넣어 얼음에서 45분 동안 부화시키고 PBS(2 % NBS)로 두번 세척하며 재현탁한 후 대조군으로 사용한다.
5) 검출군의 세포 +50μl 1: 50에 의해 희석된 biotin-Goat anti 인간 IgG, F(ab')2 항체를 얼음에서 45분 동안 부화시킨다. PBS(2 % NBS)로 두번 세척한다. 50μl PE-SA(1:200으로 희석) 항체를 넣어 얼음에서 45분 동안 부화시킨다.
6) 2 ml PBS(2 % NBS) 재현탁 세포를 넣고, 4 ℃, 5000 rpm/min 조건에서 5분 동안 원심분리하여 상청액을 제거한다. 두번 반복한다.
7) 500 μl PBS(2 % NBS)를 넣고, 유동식 튜브 중에 전이시킨다. 유세포분석기로 PE 경로를 검출하며 양성률이 5 내지 20 %인 세포수가 적합하고, 적도(PFUs/mL)=세포개수×성률/바이러스 부피를 계산한다.
2. 렌티바이러스에 의한 T 림프구의 형질도입------CAR 양성의 T 림프구의 제조
1) T 림프구 활성화: 약 1×06 /mL 밀도로 림프구를 넣고 배지에서 배양하며, 세포 비율이 2:1인 자성구슬에 따라 동시에 항-CD3 및 CD28 항체로 코팅된 자성구슬(Invitrogen)과 최종 농도 500 U/mL의 재조합 인간 IL-2(상하이 화신바이오테크유한회사)를 넣어 48시간 동안 자극하여 배양한다.
2) 감염 하루 전에 Retronectin은 24-웰 플레이트에 코팅되고, retronectin의 최종 농도는 5 μg/ml이고, 4도에서 하룻밤 동안 배양되었다.
3) 24-웰 플레이트 중의 retronectin 용액(PBS)을 제거하고, 1 ml PBS로 두번 세척한다.
4) MOI = 10에 따라 PBMCs 세포에 농축후의 렌티바이러스를 넣고, 1000 g 조건에서 40분 동안 원심 분리한 후 세포 배양박스에 전이시킨다.
5) 증폭 배양: 감염 후의 세포를 5×05/mL의 밀도로 격일로 계대배양하고, 동시에 림프구 배양액에서 최종 농도 500 U/mL의 재조합 인간 IL-2를 보충 첨가한다.
3. T 림프구 키메라 항원 수용체의 발현
1) 렌티바이러스에 의해 감염된 T 림프구의 배양 7일 째에 원심분리 튜브내에서 1×06의 T 세포를 취한다.
2) 4 ℃, 5000 rpm 조건에서 5분 동안 원심분리하여 상청액을 제거하며, PBS로 두번 세척한다.
3) 피검출 세포를 50 μl의 biotin-Goat anti 인간 IgG, F(ab')2항체(1: 50으로 희석)에 넣고 얼음에서 45분 동안 부화시킨다. PBS(2 % NBS)로 두번 세척한다. 50 μl PE-SA(1: 200으로 희석)항체를 넣고 얼음에서 45분 동안 부화시킨다.
4) 2 ml PBS(2 % NBS) 재현탁 세포를 넣고, 4 ℃, 5000 rpm/min에서 5분 동안 원심분리하여 상청액을 제거한다. 두번 반복한다.
5) 500 μl PBS(2 % NBS)를 넣고 유동 튜브에 전이시킨다. 유세포분석기로 PE 채널을 검출하여 CAR 양성의 T 세포 비율을 결정한다.
체외 독성 살상 실험을 진행할 경우, 도 10에 도시된 바와 같이, Mock, 7A12-28Z, 7A12-BBZ, 7A12-28BBZ, 7G2-28Z, 7G2-BBZ 및 7G2-28BBZ T 세포의 감염 양성률은 각각 72.8 %, 60.8 %, 48.7 %, 57.4 %, 67.5 %, 68.8 %, 63.6 %이다.
4. BCMA CAR T 세포를 표적으로 하는 세포 독성 측정
CytoTox 96 비방사성 세포 독성 검출 시약 키트(Promega 회사)를 사용하며 구체적으로 CytoTox 96 비방사성 세포 독성 검출 시약 키트 설명서를 참조한다.
표적 세포: 각각 75μl 2×05/mL의 K562, K562-BCMA 및 RPMI-8226 세포를 96웰 플레이트에 접종시킨다. 효과기 세포: 효과기 표적 비 3:1, 1:1 또는 1:3에 따라 T-Mock 및 상이한 키메라 항원 수용체를 발현하는 CAR T 세포를 첨가한다. 각 군에 4개의 이중구멍을 설치하고 4개의 이중구멍의 평균값을 구한다. 검출 시간은 세포 부화 18시간이다. 여기서 각 실험군과 각 대조군은 하기와 같다.
각 실험군: 각 표적 세포 + 상이한 키메라 항원 수용체를 발현하는 CAR T;
대조군 1: 표적 세포는 LDH를 최대로 방출한다.
대조군 2: 표적 세포는 자발적으로 LDH를 방출한다.
대조군 3: 효과기 세포는 자발적으로 LDH를 방출한다.
세포 독성 계산 공식은, 세포 독성 % = [(실험군 - 효과기 세포 대조 - 표적 세포 대조)/(표적 세포 최대 열분해량 - 표적 세포 대조)]×00 %이다.
실험 결과, 상이한 키메라 항원 수용체를 각각 발현하는 CAR T 세포는 BCMA 양성의 K562-BCMA 및 RPMI-8226 세포에 대해 현저한 체외 살상 활성을 나타내며, 특히 BCMA를 내인성 발현하는 RPMI-8226 세포에 대한 그 살상 독성은 보다 강하고, BCMA 양성의 K562 세포에 대해 거의 살상 작용이 없다(도 11a).
5. 다발성 골수종 말초혈액 B 림프구 RPMI-8226의 NOD/SCID 쥐 피하이식종양 모델에 대한 치료
RPMI-8226 세포를 각각 40마리 NOD/SCID 쥐에 접종하며, 접종한 세포수는 8×06/마리 쥐이다. 종양 세포를 피하 접종한 12일 째, 종양 부피는 평균 75 mm3이고, 임의로 4개 군으로 나뉘어 각각 꼬리에 1×07CAR T를 정맥주사하고 주사하기 전에 100 mg/kg 용량의 시클로포스파미드(cyclophosphamide)를 복강주사하여 쥐 체내 잔류한 T 세포를 사전에 제거하고, CAR T를 주사한 17일 째에 쥐의 목을 길게 빼어 죽였다.
쥐의 종양 크기에 대한 분석 결과는 도 11b에 도시된 바와 같으며, UTD 군에 비해, 7A12-28Z, 7A12-BBZ 및 7A12-28BBZ 치료군의 종양 억제 효과는 매우 현저하게 나타났으며, CAR T를 주사한 17일 째에 7A12-28Z 치료군의 7마리 쥐 중 1마리의 종양이 사라졌고, 7A12-BBZ 치료군의 7마리 쥐 중 2마리의 종양이 사라졌으며, 7A12-28BBZ 치료군의 7마리 쥐의 종양은 모두 사라졌고 종양 억제율은 각각 7A12-28Z(84.6 %), 7A12-BBZ(65.4 %) 및 7A12-28BBZ(100 %)이었다.
실시예 10. 항체 23F10의 개조
본 실시예는 상술한 23F10을 모본 항체로 하고, 박테리오파지 디스플레이 방법을 이용하여 23F10에 대해 개조하였다. 23F10에 기반한 박테리오파지 라이브러리의 구축에 있어서 경쇄 및 중쇄의 CDR3 영역을 보류하였으며, 프라이머 변성에 의해, 경쇄의 CDR1 및 CDR2 또는 중쇄의 CDR1 및 CDR2를 각각 랜덤화하여 2개의 박테리오파지 라이브러리를 구축하였다. 프라이머 정보는 하기와 같다.
2.1 23F10 돌연변이체의 구축
우선 항체23F10(scFv)(서열번호 55)에 기반하여 템플릿 플라스미드를 구축한다. 경쇄 CDR1 및 CDR2를 랜덤화한 박테리오파지 라이브러리에 대해, 프라이머 LMF 및 BL1R을 사용하여 PCR에 의해 단편1을 증폭한다. 프라이머 BL2F 및 FdR을 사용하여 PCR에 의해 단편2를 증폭한다. 다음 단편1과 단편2를 바이패스 PCR에 의해 연결시켜 더 랜덤화된 서열의 scFv 전장을 얻은 다음, 전장 단편을 NcoI 및 NotI 효소로 절단하고 T4 연결효소에 의해 동일한 제한효소의 템플릿 플라스미드에 연결시킨다. 또한 TG1 수용성 세포에 전기전환하며 저장량은 1.50E+9이다. 중쇄 CDR1 및 CDR2를 랜덤화한 박테리오파지 라이브러리에 대해, LMF 및 BH1R을 사용하여 PCR에 의해 단편3을 증폭한다. BH2F 및 FdR을 사용하여 PCR에 의해 단편4를 증폭한다. 다음 단편3과 단편4를 바이패스 PCR에 의해 연결시켜 더 랜덤화된 서열의 scFv 전장을 얻은 다음, 전장 단편을 NcoI 및 NotI 효소로 절단하고 T4 연결효소에 의해 동일한 제한효소의 템플릿 플라스미드에 연결시킨다. 또한 TG1 수용성 세포에 전기전환하며 저장량은 2.2E+9이다.
박테리오파지 라이브러리의 선별은 본 특허의 실시예 3의 방법을 참조한다. 항원 BCMA_huFc의 시작 농도는 20 nM이고, 5배 구배 희석하여 다음 라운드 선별을 진행한다. 패닝에 의해 2 내지 3회 순환을 진행하여 BCMA_huFc와 특이적으로 결합되는 scFv 박테리오파지 클론을 축적한다. BCMA_huFc에 대한 표준 ELISA 방법에 의해 양성 클론을 결정한다. ELISA는 인간 Fc 단편을 무관 항원으로 사용하여 항체의 특이성을 검증하는 것이다. 총 80개의 ELISA 양성의 클론을 선별하였고, 다시 유도한 이후 biacore에 의해 상청액을 유도한 해리 상수 Kd를 측정한다. 그중 두개의 클론 25C2, 25D2는 모본 클론 23F10에 비해 10배 낮으며, 하기 표에 표시된 바와 같다.
시퀀싱 결과, 클론 25C2 및 25D2의 경쇄는 23F10과 같다. 도 12는 클론 25C2, 25D2 및 23F10의 중쇄 아미노산 서열을 비교하였으며, 여기서 클론 25C2는 모본 항체 23F10에 비해 중쇄에 5개 점이 돌연변이되고(서열번호 56, 57은 각각 25C2의 중쇄 가변 영역의 아미노산 서열 및 뉴클레오티드 서열임), 여기서 CDR1에는 2개, 즉 제31 부위 세린은 글리신으로 변하고, 제32 부위 티로신은 아스파라긴으로 변한다. CDR2에는 2개, 즉 제54 부위 세린은 아스파라긴으로 변하고, 제59 부위 티로신은 페닐알라닌으로 변하며, 프레임워크 영역에 1개, 즉 제30 부위 세린은 글리신으로 변한다. 클론 25D2는 모본 항체 23F10에 비해 중쇄에 4개 점이 돌연변이되며(서열번호 58, 59는 각각 25D2의 중쇄 가변 영역의 아미노산 서열 및 뉴클레오티드 서열임), 여기서 3개는 CDR2 영역에 위치하고, 즉 제54 부위 세린은 글리신으로 변하며, 제57 부위 세린은 아스파라긴으로 변하고, 제59 부위 티로신은 페닐알라닌으로 변하며, 프레임워크 영역에 1개, 즉 제30 부위 세린은 글리신으로 변한다.
25C2의 HCDR1의 서열은 서열번호 60에 표시된 바와 같고, 25C2의 HCDR2의 서열은 서열번호 61에 표시된 바와 같다. 25D2의 HCDR1의 서열은 서열번호 62에 표시된 바와 같고, 25D2의 HCDR2의 서열은 서열번호 63에 표시된 바와 같다. 25C2scFv의 뉴클레오티드 서열 및 아미노산 서열은 각각 서열번호 64, 65에 표시된 바와 같고, 25D2scFv의 뉴클레오티드 서열 및 아미노산 서열은 각각 서열번호 66, 67에 표시된 바와 같다.
2.2 클론25C2, 25D2(scFv_Fc)의 발현 정제
실시예 4를 참조하면, VH 상류에 적합한 효소제한부위와 보호 염기를 도입하고, VL의 하류에 적합한 효소제한부위와 보호 염기를 도입한다. 1 % 아가로오스 겔 전기영동에 의해 PCR 산물을 분석하고 정제 및 회수한다. 효소 절단 후 인간 Fc 단편을 함유한 진핵 발현 벡터 V152(상하이 루이진생물기술유한회사에서 구매됨)에 연결시킨다. 293Fectin에 의해 293F 세포에 형질주입시키고 발현시킨다.
SEC에 의해 25C2, 25D2의 축적 정황을 분석한 결과 도 13a 및 도 13b에 도시된 바와 같으며, 단량체 형식의 항체는 각각 91 %, 97 % 차지한다. 모본 항체 23F10(30 % 단량체율)에 비해 각각 61 % 및 67 % 향상되었으며, 축적도는 현저하게 감소하였다. 한외여과 농축을 거친 후, SDS PAGE에 의해 얻은 항체에 대해 정량 및 정성 분석을 진행한다. 수율은 각각 80 ug/ml 및 60 ug/ml(수율 = 최종산물 질량/형질주입 부피)이다.
2.3 클론25C2, 25D2의 결합 특성
인간 BCMA를 안정적으로 발현하는 K562 세포(K562-BCMA) 및 K562를 사용하여 세포를 수집하고, 완전한 성장 배지로 세포를 세척하며 또 약 1 내지 5×05개 세포/well로 세포를 U형 저부 미량정량판에 펼쳐놓는다. 얼음에서 구배 희석된 scFv_Fc 융합 항체를 K562-BCMA/K562와 30분 동안 부화시키고, 그후 FITC 표지의 항-인간 Fc를 제2 항체로 하여 부화시킨다. 두번의 세척 단계 이후, Guava easyCyteTM HT System 기기로 분석하고, GraphPad Prism으로 실험 데이터를 처리하여 EC50을 얻었다. 도 14는 25C2, 25D2와 K562-BCMA 및 K562 세포의 결합 정황을 나타낸다. 결과, 안정성이 향상되고 축적 정도가 감소한 2개의 클론 25C2, 25D2와 K562-BCMA의 결합 능력 EC50은 각각 2.594 nM 및 1.891 nM이다. 23F10에 비해 3 내지 4배 향상되었다.
2.4 클론
25C2
,
25D2의
특이성 측정
ELISA에 의해 항체23F10, 25C2, 25D2의 특이성을 측정한다.
전날에 2 ug/ml 재조합 인간 BCMA_Fc, 마우스 BCMA_Fc, TACI_huFc(R&D, #174TC), BAFF R(R&D, #1162-BR)을 면역판에 코팅하고 4도에서 하룻밤 지낸다. 두 번째 날에 300 ul/well 2 % MPBS를 넣고 2시간 밀봉시킨 다음 200 nM 정제된 항체(scFv 형태)를 넣고 37도에서 1시간 동안 부화시키고, PBST(0.05 % Tween-20을 함유한 PBS)로 세번 세척하며 PBS로 세번 세척한 다음, 1: 4000으로 희석한 HRP 표지의 항-Flag 태그의 항체(sigma, #A8592-1MG)를 넣고 37도에서 1시간 동안 부화시키고, PBST(0.05 % Tween-20을 함유한 PBS)로 세번 세척하며 PBS로 세번 세척한다. 100 ul/well TMBS 기저물을 넣고 10분 내지 15분 발색시키며 50 ul 2M 황산을 넣어 반응을 정지한다.
결과는 도 14b에 도시된 바와 같으며, 항체7A12, 23F10, 25C2, 25D2는 인간 BCMA와 특이적으로 결합하고 인간 TACI 및 인간 BAFF R과 결합하지 않는다. 여기서 항체 25C2, 25D2와 마우스 BCMA는 비교적 약하게 결합된다.
실시예
11.
25C2
,
25D2의
CAR-T 세포의 제조
실시예 8의 동작을 참조하면 각각 구축하여 25C2, 25D2의 키메라 항원 수용체 플라스미드를 얻었다.
a. 25C2의 키메라 항원 수용체 플라스미드의 구축
PRRLSIN-cPPT.EF-1α를 벡터로 하여 항체 25C2를 발현하는 2대 키메라 항원 수용체의 렌티바이러스 플라스미드 PRRLSIN-cPPT.EF-1α-25C2-BBZ를 구축하였다. PRRLSIN-cPPT.EF-1α를 벡터로 하여 항체 25D2를 발현하는 2대 키메라 항원 수용체의 렌티바이러스 플라스미드 PRRLSIN-cPPT.EF-1α-25D2-BBZ를 구축하였다.
25C2-BBZ 서열은 CD8α 신호 펩타이드(서열번호 23), 25C2scFv(서열번호 64), CD8 힌지(서열번호 25) 및 막관통 영역(서열번호 33), CD137 세포내 신호 전달 도메인(서열번호 35) 및 CD3ξ(서열번호 31)로 조성된다.
25D2-BBZ 서열은 CD8α 신호 펩타이드(서열번호 23), 25D2scFV(서열번호 66), CD8 힌지(서열번호 25) 및 막관통 영역(서열번호 33), CD137 세포내 신호 전달 도메인(서열번호 35) 및 CD3ξ(서열번호 31)로 조성된다.
실시예 9를 참조하면, 플라스미드 PRRLSIN-cPPT.EF-1α-25C2-BBZ, PRRLSIN-cPPT.EF-1α-25D2-BBZ를 각각 렌티바이러스 패키징, T 세포 감염, 증폭을 진행하여 키메라 항원 수용체 수식의 T 세포 25C2-BBZ 및 25D2-BBZ를 얻는다.
실시예
12. 가용성 PD1 발현의 CAR-T 세포의 제조
본 실시예는 항체 7A12의 scFv를 이용하여 가용성 PD1 발현의 CAR-T 세포를 제조한다. 제조방법은 하기와 같다.
1. PD-1의 신호 펩타이드 서열(서열번호 68), PD-1 세포외 단편 서열(서열번호 69), CH3의 서열(서열번호 70)을 모두 합성하고 T벡터를 클론하여 플라스미드 T-sPD1-Fc를 얻는다.
T-sPD1-Fc 플라스미드를 템플릿으로 하여, 상류 프라이머 5'-acgcgtcctagcgctaccggtcgccaccatgcagatcccacaggcgccc-3'(서열번호 71), 하류 프라이머 5'-ctctcggggctgcccaccatacaccagggtttggaactggc-3'(서열번호 72)의 PCR 증폭에 의해 Spd1 서열을 얻는다. 상류 프라이머 5'-tatggtgggcagccccgagagccacag-3'(서열번호 73), 하류 프라이머 5'-aaaattcaaagtctgtttcactttacccggagacagggag-3'(서열번호 74) 증폭에 의해 sPD1-CH3 단편을 얻는다.
sPD1-CH3 단편 및 7A12-BBZ(서열번호 75)의 단편을 PCR 결합 및 증폭하여 sPD1-CH3-7A12-BBZ를 얻으며, 7A12-BBZ의 서열은 CD8α 신호 펩타이드(서열번호 23), 7A12scFv(서열번호 47), CD8 힌지(서열번호 25) 및 막관통 영역(서열번호 33), CD137 세포내 신호 전달 도메인(서열번호 35) 및 CD3ξ(서열번호 31)로 조성된다.
상기 단편 sPD1-CH3-7A12-BBZ를 구축하는 5'단은 MluI 효소제한부위를 보유하고, 3'단은 SalI 효소제한부위를 보유한다. MluI 및 SalI 이중효소제한에 의해 마찬가지로 이중효소제한된 PRRLSIN-cPPT.EF-1α벡터에 연결시켜 sPD-1-CH3 단백질을 발현하는 BCMA 표적 키메라 항원 수용체의 플라스미드를 얻는다.
실시예 9를 참조하면, sPD1 및 7A12-BBZ를 발현하는 T 세포 sPD-1-7A12-BBZ를 얻는다.
실시예
13. 체외세포 살상 실험
25C2-BBZ T 세포, 25D2-BBZ T 세포, 7A12-BBZ T 세포, C11D5.3-BBZ T 세포 및 sPD-1-7A12-BBZ T 세포를 효과기 세포로 하여, 체외 살상 실험을 진행하며, 여기서 C11D5.3-BBZ(서열번호 87)은 항-BCMA의 쥐 항-C11D5.3(CN201580073309.6을 참조바람)으로 제조된 2대 CAR이다. 표적 세포는 인간 골수종 세포 NCI-H929 및 다발성 골수종 말초혈액 B림프구 RPMI-8226이다.
CytoTox 96 비방사성 세포 독성 검출 시약 키드(Promega 회사)를 사용하여 진행한다. 구체적인 방법은 CytoTox 96 비방사성 세포 독성 검출 시약 키드 설명서를 참조한다.
효과기 표적 비 3:1, 1:1 또는 1:3에 따라 각각 효과기 세포를 96웰 플레이트에 접종시키고, 50μL 2×05/mL의 NCI-H929 및 RPMI-8226 세포를 각각 대응되는 96웰 플레이트에 접종시킨다.
각 군에 5개 이중 구멍을 설치하고 배지를 세포 배양 탱크에 놓고 18시간 동안 부화시킨다.
여기서 각 실험군 및 각 대조군을 하기와 같이 설정한다. 실험군: 각 표적 세포 + 상이한 키메라 항원 수용체를 발현하는 T림프구; 대조군1: 표적 세포는 LDH를 최대로 방출한다. 대조군 2: 표적 세포는 자발적으로 LDH를 방출한다. 대조군 3: 효과기 세포는 자발적으로 LDH를 방출한다. 계산 공식은 세포 독성 % = [(실험군 - 효과기 세포 자발 군 - 표적 세포 자발 군)/(표적 세포 최대 - 표적 세포 자발)]×00 %이다.
세포 살상의 실험 결과는 도 15에 도시된 바와 같다.
실시예
14. 쥐 체내 세포 살상 실험
8×06의 RPMI-8226 세포를 각각 B-NDG 쥐 오른쪽 겨드랑이 부분의 피하에 접종시키고, 종양 세포를 피하에 접종시킨 18일 후, 종양 평균 부피는 약 243 mm3이고, 다발성 골수종 말초혈액 B림프구 RPMI-8226의 B-NDG 쥐 피하이식 종양 모델을 얻는다.
쥐 피하이식 종양 모델을 한 군에 4마리씩 각각 3개 군으로 나누고, 각각 5×06의 주사제 량의 25C2-BBZ, 25D2-BBZ, 및 형질주입되지 않은 T 세포(UTD)를 주사하였으며, 결과는 하기표에 표시된 바와 같고, 종양 세포를 각각 접종시킨 32일 및 36일 후, 25C2-BBZ 및 25D2-BBZ 치료군의 4마리 쥐의 종양은 모두 사라졌다.
쥐 피하 이식 종양 모델을 한 군에 4마리씩 각각 3개 군으로 나누고, 각각 1×06의 CAR T 주사제 량의25C2-BBZ, 25D2-BBZ, C11D5.3-BBZ, 7A12-BBZ 및 형질주입되지 않은 T 세포(UTD)를 주사하며, 종양이 사라진 결과는 하기표와 도 16에 도시된 바와 같다.
본 발명에서 언급된 모든 문헌은 각각의 문헌이 단독으로 인용되는 것과 마찬가지로 모두 본원 발명에서 참조로서 인용된다. 이밖에, 본 발명의 상기 설명된 내용을 열독한 후 본 기술분야의 기술자들은 본 발명에 대해 여러가지 변경 또는 수정을 진행할수 있으며 이러한 등가형식은 본원 발명의 청구범위에 의해 제한된 범위에 속함을 이해해야 한다.
SEQUENCE LISTING
<110> CARSGEN THERAPEUTICS CO., LTD.
<120> BCMA-TARGETING ANTIBODY AND USE THEREOF
<130> P2018-0137
<140> PCT/CN2018/073863
<141> 2018-01-23
<150> CN 201710058581.8
<151> 2017-01-23
<150> CN 201710920346.7
<151> 2017-09-30
<160> 87
<170> PatentIn version 3.5
<210> 1
<211> 5
<212> PRT
<213> Artificial sequence
<220>
<223> 7A12, 7G2, 23F10 HCDR1
<400> 1
Ser Tyr Ala Met Ser
1 5
<210> 2
<211> 17
<212> PRT
<213> Artificial sequence
<220>
<223> 7A12, 7G2, 23F10 HCDR1
<400> 2
Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys
1 5 10 15
Gly
<210> 3
<211> 8
<212> PRT
<213> Artificial sequence
<220>
<223> 7A12 HCDR3
<400> 3
Tyr Pro Tyr Leu Ala Phe Asp Tyr
1 5
<210> 4
<211> 9
<212> PRT
<213> Artificial sequence
<220>
<223> 7G2 HCDR3
<400> 4
Leu Ser Gly Asp Ala Ala Met Asp Tyr
1 5
<210> 5
<211> 10
<212> PRT
<213> Artificial sequence
<220>
<223> 23F10 HCDR3
<400> 5
Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr
1 5 10
<210> 6
<211> 12
<212> PRT
<213> Artificial sequence
<220>
<223> 7A12, 7G2, 23F10 LCDR1
<400> 6
Arg Ala Ser Gln Ser Val Ser Ser Ser Tyr Leu Ala
1 5 10
<210> 7
<211> 7
<212> PRT
<213> Artificial sequence
<220>
<223> 7A12, 7G2, 23F10 LCDR2
<400> 7
Gly Ala Ser Ser Arg Ala Thr
1 5
<210> 8
<211> 9
<212> PRT
<213> Artificial sequence
<220>
<223> 7A12 LCDR3
<400> 8
Gln Gln Tyr Gly Tyr Pro Pro Ser Tyr
1 5
<210> 9
<211> 9
<212> PRT
<213> Artificial sequence
<220>
<223> 7G2 LCDR3
<400> 9
Gln Gln Tyr Gly Tyr Pro Pro Arg Tyr
1 5
<210> 10
<211> 9
<212> PRT
<213> Artificial sequence
<220>
<223> 23F10 LCDR3
<400> 10
Gln Gln Tyr Phe Asn Pro Pro Glu Tyr
1 5
<210> 11
<211> 109
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of 7A12 light chain variable regoin
<400> 11
Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly
1 5 10 15
Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Ser
20 25 30
Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu
35 40 45
Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser
50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu
65 70 75 80
Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr Gly Tyr Pro Pro
85 90 95
Ser Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
100 105
<210> 12
<211> 327
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of 7A12 light chain variable region
<400> 12
gaaatcgtgt taacgcagtc tccaggcacc ctgtctttgt ctccagggga aagagccacc 60
ctctcttgca gggccagtca gagtgttagc agcagctact tagcctggta ccagcagaaa 120
cctggccagg ctcccaggct cctcatctat ggagcatcca gcagggccac tggcatccca 180
gacaggttca gtggcagtgg atccgggaca gacttcactc tcaccatcag cagactggag 240
cctgaagatt ttgcagtgta ttactgtcag cagtacggtt acccaccatc ttacacgttc 300
ggccagggga ccaaagtgga aatcaaa 327
<210> 13
<211> 117
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of 7A12 heavy chain variable region
<400> 13
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Arg Tyr Pro Tyr Leu Ala Phe Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110
Val Thr Val Ser Ser
115
<210> 14
<211> 351
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of 7A12 heavy chain variable region
<400> 14
gaggtgcaat tgctggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60
tcctgtgcag cctccggatt cacctttagc agttatgcca tgagctgggt ccgccaggct 120
ccagggaagg ggctggagtg ggtctcagct attagtggta gtggtggtag cacatactac 180
gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat 240
ctgcagatga acagcctgag agccgaggac acggccgtat attactgtgc gcgttaccca 300
tacctggcat tcgactactg gggccaagga accctggtca ccgtctcgag t 351
<210> 15
<211> 109
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of 7G2 light chain variable region
<400> 15
Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly
1 5 10 15
Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Ser
20 25 30
Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu
35 40 45
Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser
50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu
65 70 75 80
Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr Gly Tyr Pro Pro
85 90 95
Arg Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
100 105
<210> 16
<211> 327
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of 7G2 light variable region
<400> 16
gaaatcgtgt taacgcagtc tccaggcacc ctgtctttgt ctccagggga aagagccacc 60
ctctcttgca gggccagtca gagtgttagc agcagctact tagcctggta ccagcagaaa 120
cctggccagg ctcccaggct cctcatctat ggagcatcca gcagggccac tggcatccca 180
gacaggttca gtggcagtgg atccgggaca gacttcactc tcaccatcag cagactggag 240
cctgaagatt ttgcagtgta ttactgtcag cagtacggtt acccaccaag atacacgttc 300
ggccagggga ccaaagtgga aatcaaa 327
<210> 17
<211> 118
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of 7G2 heavy chain variable region
<400> 17
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Leu Ser Gly Asp Ala Ala Met Asp Tyr Trp Gly Gln Gly Thr
100 105 110
Leu Val Thr Val Ser Ser
115
<210> 18
<211> 354
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of 7G2 heavy chain variable region
<400> 18
gaggtgcaat tgctggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60
tcctgtgcag cctccggatt cacctttagc agttatgcca tgagctgggt ccgccaggct 120
ccagggaagg ggctggagtg ggtctcagct attagtggta gtggtggtag cacatactac 180
gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat 240
ctgcagatga acagcctgag agccgaggac acggccgtat attactgtgc gaaactgtct 300
ggtgatgcag caatggacta ctggggccaa ggaaccctgg tcaccgtctc gagt 354
<210> 19
<211> 109
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of 23F10 light chain variable region
<400> 19
Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly
1 5 10 15
Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Ser
20 25 30
Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu
35 40 45
Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser
50 55 60
Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu
65 70 75 80
Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr Phe Asn Pro Pro
85 90 95
Glu Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
100 105
<210> 20
<211> 327
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of 23F10 light chain variable region
<400> 20
gaaatcgtgt taacgcagtc tccaggcacc ctgtctttgt ctccagggga aagagccacc 60
ctctcttgca gggccagtca gagtgttagc agcagctact tagcctggta ccagcagaaa 120
cctggccagg ctcccaggct cctcatctat ggagcatcca gcagggccac tggcatccca 180
gacaggttca gtggcagtgg atccgggaca gacttcactc tcaccatcag cagactggag 240
cctgaagatt ttgcagtgta ttactgtcag cagtacttca acccaccaga atacacgttc 300
ggccagggga ccaaagtgga aatcaaa 327
<210> 21
<211> 119
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of 23F10 heavy chain variable region
<400> 21
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser
115
<210> 22
<211> 357
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of 23F10 heavy chain variable region
<400> 22
gaggtgcaat tgctggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60
tcctgtgcag cctccggatt cacctttagc agttatgcca tgagctgggt ccgccaggct 120
ccagggaagg ggctggagtg ggtctcagct attagtggta gtggtggtag cacatactac 180
gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat 240
ctgcagatga acagcctgag agccgaggac acggccgtat attactgtgc gaaagttcgt 300
ccattctggg gtactttcga ctactggggc caaggaaccc tggtcaccgt ctcgagt 357
<210> 23
<211> 21
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of CD8alpha signal peptide
<400> 23
Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu Leu Leu
1 5 10 15
His Ala Ala Arg Pro
20
<210> 24
<211> 63
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of CD8alpha signal peptide
<400> 24
atggccttac cagtgaccgc cttgctcctg ccgctggcct tgctgctcca cgccgccagg 60
ccg 63
<210> 25
<211> 45
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of CD8 hinge
<400> 25
Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala
1 5 10 15
Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly
20 25 30
Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp
35 40 45
<210> 26
<211> 135
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of CD8 hinge
<400> 26
accacgacgc cagcgccgcg accaccaaca ccggcgccca ccatcgcgtc gcagcccctg 60
tccctgcgcc cagaggcgtg ccggccagcg gcggggggcg cagtgcacac gagggggctg 120
gacttcgcct gtgat 135
<210> 27
<211> 27
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of CD28 transmembrane region
<400> 27
Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu
1 5 10 15
Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val
20 25
<210> 28
<211> 81
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of CD28 transmembrane region
<400> 28
ttttgggtgc tggtggtggt tggtggagtc ctggcttgct atagcttgct agtaacagtg 60
gcctttatta ttttctgggt g 81
<210> 29
<211> 41
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of CD28 intracellular region
<400> 29
Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr
1 5 10 15
Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro
20 25 30
Pro Arg Asp Phe Ala Ala Tyr Arg Ser
35 40
<210> 30
<211> 123
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of CD28 intracellular region
<400> 30
aggagtaaga ggagcaggct cctgcacagt gactacatga acatgactcc ccgccgcccc 60
gggccaaccc gcaagcatta ccagccctat gccccaccac gcgacttcgc agcctatcgc 120
tcc 123
<210> 31
<211> 113
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of CD3Z domain
<400> 31
Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly
1 5 10 15
Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr
20 25 30
Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys
35 40 45
Pro Gln Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln
50 55 60
Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu
65 70 75 80
Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr
85 90 95
Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro
100 105 110
Arg
<210> 32
<211> 339
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of CD3Z domain
<400> 32
agagtgaagt tcagcaggag cgcagacgcc cccgcgtacc agcagggcca gaaccagctc 60
tataacgagc tcaatctagg acgaagagag gagtacgatg ttttggacaa gagacgtggc 120
cgggaccctg agatgggggg aaagccgcag agaaggaaga accctcagga aggcctgtac 180
aatgaactgc agaaagataa gatggcggag gcctacagtg agattgggat gaaaggcgag 240
cgccggaggg gcaaggggca cgatggcctt taccagggtc tcagtacagc caccaaggac 300
acctacgacg cccttcacat gcaggccctg ccccctcgc 339
<210> 33
<211> 21
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of CD8 transmembrane region
<400> 33
Ile Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu Leu
1 5 10 15
Ser Leu Val Ile Thr
20
<210> 34
<211> 63
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of CD8 transmembrane region
<400> 34
atctacatct gggcgccctt ggccgggact tgtggggtcc ttctcctgtc actggttatc 60
acc 63
<210> 35
<211> 42
<212> PRT
<213> Artificial sequence
<220>
<223> Amino acid sequence of CD137 intracellular region
<400> 35
Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met
1 5 10 15
Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe
20 25 30
Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu
35 40
<210> 36
<211> 126
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of CD137 intracellular region
<400> 36
aaacggggca gaaagaaact cctgtatata ttcaaacaac catttatgag accagtacaa 60
actactcaag aggaagatgg ctgtagctgc cgatttccag aagaagaaga aggaggatgt 120
gaactg 126
<210> 37
<211> 184
<212> PRT
<213> Artificial sequence
<220>
<223> BCMA amino acid sequence
<400> 37
Met Leu Gln Met Ala Gly Gln Cys Ser Gln Asn Glu Tyr Phe Asp Ser
1 5 10 15
Leu Leu His Ala Cys Ile Pro Cys Gln Leu Arg Cys Ser Ser Asn Thr
20 25 30
Pro Pro Leu Thr Cys Gln Arg Tyr Cys Asn Ala Ser Val Thr Asn Ser
35 40 45
Val Lys Gly Thr Asn Ala Ile Leu Trp Thr Cys Leu Gly Leu Ser Leu
50 55 60
Ile Ile Ser Leu Ala Val Phe Val Leu Met Phe Leu Leu Arg Lys Ile
65 70 75 80
Asn Ser Glu Pro Leu Lys Asp Glu Phe Lys Asn Thr Gly Ser Gly Leu
85 90 95
Leu Gly Met Ala Asn Ile Asp Leu Glu Lys Ser Arg Thr Gly Asp Glu
100 105 110
Ile Ile Leu Pro Arg Gly Leu Glu Tyr Thr Val Glu Glu Cys Thr Cys
115 120 125
Glu Asp Cys Ile Lys Ser Lys Pro Lys Val Asp Ser Asp His Cys Phe
130 135 140
Pro Leu Pro Ala Met Glu Glu Gly Ala Thr Ile Leu Val Thr Thr Lys
145 150 155 160
Thr Asn Asp Tyr Cys Lys Ser Leu Pro Ala Ala Leu Ser Ala Thr Glu
165 170 175
Ile Glu Lys Ser Ile Ser Ala Arg
180
<210> 38
<211> 54
<212> PRT
<213> Artificial sequence
<220>
<223> Human BCMA extracellular segment Met1-Ala54
<400> 38
Met Leu Gln Met Ala Gly Gln Cys Ser Gln Asn Glu Tyr Phe Asp Ser
1 5 10 15
Leu Leu His Ala Cys Ile Pro Cys Gln Leu Arg Cys Ser Ser Asn Thr
20 25 30
Pro Pro Leu Thr Cys Gln Arg Tyr Cys Asn Ala Ser Val Thr Asn Ser
35 40 45
Val Lys Gly Thr Asn Ala
50
<210> 39
<211> 162
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of human BCMA extracellular segment Met1-Ala54
<400> 39
atgctgcaga tggccggcca gtgcagccag aacgagtact tcgacagcct gctgcacgcc 60
tgcatcccct gccagctgcg gtgcagcagc aacacccccc ccctgacctg ccagcggtac 120
tgcaacgcca gcgtgaccaa cagcgtgaag ggcaccaacg cc 162
<210> 40
<211> 283
<212> PRT
<213> Artificial sequence
<220>
<223> BCMA_huFc
<400> 40
Met Leu Gln Met Ala Gly Gln Cys Ser Gln Asn Glu Tyr Phe Asp Ser
1 5 10 15
Leu Leu His Ala Cys Ile Pro Cys Gln Leu Arg Cys Ser Ser Asn Thr
20 25 30
Pro Pro Leu Thr Cys Gln Arg Tyr Cys Asn Ala Ser Val Thr Asn Ser
35 40 45
Val Lys Gly Thr Asn Ala Gly Ser Asp Lys Thr His Thr Cys Pro Pro
50 55 60
Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro
65 70 75 80
Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
85 90 95
Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
100 105 110
Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
115 120 125
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val
130 135 140
Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser
145 150 155 160
Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys
165 170 175
Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Asp
180 185 190
Glu Leu Thr Lys Asn Gln Val Ser Leu Trp Cys Leu Val Lys Gly Phe
195 200 205
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu
210 215 220
Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe
225 230 235 240
Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
245 250 255
Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
260 265 270
Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
275 280
<210> 41
<211> 849
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of BCMA_huFc
<400> 41
atgctgcaga tggccggcca gtgcagccag aacgagtact tcgacagcct gctgcacgcc 60
tgcatcccct gccagctgcg gtgcagcagc aacacccccc ccctgacctg ccagcggtac 120
tgcaacgcca gcgtgaccaa cagcgtgaag ggcaccaacg ccggatccga caaaactcac 180
acatgcccac cgtgcccagc acctgaactc ctggggggac cgtcagtctt cctcttcccc 240
ccaaaaccca aggacaccct catgatctcc cggacccctg aggtcacatg cgtggtggtg 300
gacgtgagcc acgaagaccc tgaggtcaag ttcaactggt acgtggacgg cgtggaggtg 360
cataatgcca agacaaagcc gcgggaggag cagtacaaca gcacgtaccg tgtggtcagc 420
gtcctcaccg tcctgcacca ggactggctg aatggcaagg agtacaagtg caaggtctcc 480
aacaaagccc tcccagcccc catcgagaaa accatctcca aagccaaagg gcagccccga 540
gaaccacagg tgtacaccct gcccccatcc cgggatgagc tgaccaagaa ccaggtcagc 600
ctgtggtgcc tggtcaaagg cttctatccc agcgacatcg ccgtggagtg ggagagcaat 660
gggcagccgg agaacaacta caagaccacg cctcccgtgc tggactccga cggctccttc 720
ttcctctata gcaagctcac cgtggacaag agcaggtggc agcaggggaa cgtcttctca 780
tgctccgtga tgcatgaggc tctgcacaac cactacacgc agaagagcct ctccctgtct 840
ccgggtaaa 849
<210> 42
<211> 281
<212> PRT
<213> Artificial sequence
<220>
<223> BCMA_muFc
<400> 42
Met Leu Gln Met Ala Gly Gln Cys Ser Gln Asn Glu Tyr Phe Asp Ser
1 5 10 15
Leu Leu His Ala Cys Ile Pro Cys Gln Leu Arg Cys Ser Ser Asn Thr
20 25 30
Pro Pro Leu Thr Cys Gln Arg Tyr Cys Asn Ala Ser Val Thr Asn Ser
35 40 45
Val Lys Gly Thr Asn Ala Gly Ser Arg Asp Cys Gly Cys Lys Pro Cys
50 55 60
Ile Cys Thr Val Pro Glu Val Ser Ser Val Phe Ile Phe Pro Pro Lys
65 70 75 80
Pro Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys Val Thr Cys Val
85 90 95
Val Val Asp Ile Ser Lys Asp Asp Pro Glu Val Gln Phe Ser Trp Phe
100 105 110
Val Asp Asp Val Glu Val His Thr Ala Gln Thr Gln Pro Arg Glu Glu
115 120 125
Gln Phe Asn Ser Thr Phe Arg Ser Val Ser Glu Leu Pro Ile Met His
130 135 140
Gln Asp Trp Leu Asn Gly Lys Glu Phe Lys Cys Arg Val Asn Ser Ala
145 150 155 160
Ala Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Arg
165 170 175
Pro Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro Pro Lys Glu Gln Met
180 185 190
Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr Asp Phe Phe Pro
195 200 205
Glu Asp Ile Thr Val Glu Trp Gln Trp Asn Gly Gln Pro Ala Glu Asn
210 215 220
Tyr Lys Asn Thr Gln Pro Ile Met Asp Thr Asp Gly Ser Tyr Phe Val
225 230 235 240
Tyr Ser Lys Leu Asn Val Gln Lys Ser Asn Trp Glu Ala Gly Asn Thr
245 250 255
Phe Thr Cys Ser Val Leu His Glu Gly Leu His Asn His His Thr Glu
260 265 270
Lys Ser Leu Ser His Ser Pro Gly Lys
275 280
<210> 43
<211> 843
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of BCMA_muFc
<400> 43
atgctgcaga tggccggcca gtgcagccag aacgagtact tcgacagcct gctgcacgcc 60
tgcatcccct gccagctgcg gtgcagcagc aacacccccc ccctgacctg ccagcggtac 120
tgcaacgcca gcgtgaccaa cagcgtgaag ggcaccaacg ccggatccag ggattgtggt 180
tgtaagcctt gcatatgtac agtcccagaa gtatcatctg tcttcatctt ccccccaaag 240
cccaaggatg tgctcaccat tactctgact cctaaggtca cgtgtgttgt ggtagacatc 300
agcaaggatg atcccgaggt ccagttcagc tggtttgtag atgatgtgga ggtgcacaca 360
gctcagacgc aaccccggga ggagcagttc aacagcactt tccgctcagt cagtgaactt 420
cccatcatgc accaggactg gctcaatggc aaggagttca aatgcagggt caacagtgca 480
gctttccctg cccccatcga gaaaaccatc tccaaaacca aaggcagacc gaaggctcca 540
caggtgtaca ccattccacc tcccaaggag cagatggcca aggataaagt cagtctgacc 600
tgcatgataa cagacttctt ccctgaagac attactgtgg agtggcagtg gaatgggcag 660
ccagcggaga actacaagaa cactcagccc atcatggaca cagatggctc ttacttcgtc 720
tacagcaagc tcaatgtgca gaagagcaac tgggaggcag gaaatacttt cacctgctct 780
gtgttacatg agggcctgca caaccaccat actgagaaga gcctctccca ctctcctggt 840
aaa 843
<210> 44
<211> 589
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of human BCMA with introduced restriction
sites MluI, SalI
<400> 44
acgcgtccta gcgctaccgg tcgccaccat gttgcagatg gctgggcagt gctcccaaaa 60
tgaatatttt gacagtttgt tgcatgcttg cataccttgt caacttcgat gttcttctaa 120
tactcctcct ctaacatgtc agcgttattg taatgcaagt gtgaccaatt cagtgaaagg 180
aacgaatgcg attctctgga cctgtttggg actgagctta ataatttctt tggcagtttt 240
cgtgctaatg tttttgctaa ggaagataaa ctctgaacca ttaaaggacg agtttaaaaa 300
cacaggatca ggtctcctgg gcatggctaa cattgacctg gaaaagagca ggactggtga 360
tgaaattatt cttccgagag gcctcgagta cacggtggaa gaatgcacct gtgaagactg 420
catcaagagc aaaccgaagg tcgactctga ccattgcttt ccactcccag ctatggagga 480
aggcgcaacc attcttgtca ccacgaaaac gaatgactat tgcaagagcc tgccagctgc 540
tttgagtgct acggagatag agaaatcaat ttctgctagg taagtcgac 589
<210> 45
<211> 365
<212> PRT
<213> Artificial sequence
<220>
<223> APRIL_huFc
<400> 45
His Ser Val Leu His Leu Val Pro Ile Asn Ala Thr Ser Lys Asp Asp
1 5 10 15
Ser Asp Val Thr Glu Val Met Trp Gln Pro Ala Leu Arg Arg Gly Arg
20 25 30
Gly Leu Gln Ala Gln Gly Tyr Gly Val Arg Ile Gln Asp Ala Gly Val
35 40 45
Tyr Leu Leu Tyr Ser Gln Val Leu Phe Gln Asp Val Thr Phe Thr Met
50 55 60
Gly Gln Val Val Ser Arg Glu Gly Gln Gly Arg Gln Glu Thr Leu Phe
65 70 75 80
Arg Cys Ile Arg Ser Met Pro Ser His Pro Asp Arg Ala Tyr Asn Ser
85 90 95
Cys Tyr Ser Ala Gly Val Phe His Leu His Gln Gly Asp Ile Leu Ser
100 105 110
Val Ile Ile Pro Arg Ala Arg Ala Lys Leu Asn Leu Ser Pro His Gly
115 120 125
Thr Phe Leu Gly Phe Val Lys Leu Gly Ser Asp Lys Thr His Thr Cys
130 135 140
Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu
145 150 155 160
Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu
165 170 175
Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys
180 185 190
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys
195 200 205
Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu
210 215 220
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
225 230 235 240
Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys
245 250 255
Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
260 265 270
Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Trp Cys Leu Val Lys
275 280 285
Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
290 295 300
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly
305 310 315 320
Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln
325 330 335
Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
340 345 350
His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
355 360 365
<210> 46
<211> 1095
<212> DNA
<213> Artificial sequence
<220>
<223> Nucleotide sequence of APRIL_huFc
<400> 46
cacagcgtgc tgcacctggt gcccatcaac gccaccagca aggacgacag cgacgtgacc 60
gaggtgatgt ggcagcccgc cctgcggcgg ggccggggcc tgcaggccca gggctacggc 120
gtgcggatcc aggacgccgg cgtgtacctg ctgtacagcc aggtgctgtt ccaggacgtg 180
accttcacca tgggccaggt ggtgagccgg gagggccagg gccggcagga gaccctgttc 240
cggtgcatcc ggagcatgcc cagccacccc gaccgggcct acaacagctg ctacagcgcc 300
ggcgtgttcc acctgcacca gggcgacatc ctgagcgtga tcatcccccg ggcccgggcc 360
aagctgaacc tgagccccca cggcaccttc ctgggcttcg tgaagctggg atccgacaaa 420
actcacacat gcccaccgtg cccagcacct gaactcctgg ggggaccgtc agtcttcctc 480
ttccccccaa aacccaagga caccctcatg atctcccgga cccctgaggt cacatgcgtg 540
gtggtggacg tgagccacga agaccctgag gtcaagttca actggtacgt ggacggcgtg 600
gaggtgcata atgccaagac aaagccgcgg gaggagcagt acaacagcac gtaccgtgtg 660
gtcagcgtcc tcaccgtcct gcaccaggac tggctgaatg gcaaggagta caagtgcaag 720
gtctccaaca aagccctccc agcccccatc gagaaaacca tctccaaagc caaagggcag 780
ccccgagaac cacaggtgta caccctgccc ccatcccggg atgagctgac caagaaccag 840
gtcagcctgt ggtgcctggt caaaggcttc tatcccagcg acatcgccgt ggagtgggag 900
agcaatgggc agccggagaa caactacaag accacgcctc ccgtgctgga ctccgacggc 960
tccttcttcc tctatagcaa gctcaccgtg gacaagagca ggtggcagca ggggaacgtc 1020
ttctcatgct ccgtgatgca tgaggctctg cacaaccact acacgcagaa gagcctctcc 1080
ctgtctccgg gtaaa 1095
<210> 47
<211> 242
<212> PRT
<213> Artificial sequence
<220>
<223> 47 7A12 scFv
<400> 47
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Arg Tyr Pro Tyr Leu Ala Phe Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110
Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125
Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser
130 135 140
Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser
145 150 155 160
Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala
165 170 175
Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro
180 185 190
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
195 200 205
Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr
210 215 220
Gly Tyr Pro Pro Ser Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile
225 230 235 240
Lys Arg
<210> 48
<211> 243
<212> PRT
<213> Artificial sequence
<220>
<223> 7G2 scFv
<400> 48
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Leu Ser Gly Asp Ala Ala Met Asp Tyr Trp Gly Gln Gly Thr
100 105 110
Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
115 120 125
Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu
130 135 140
Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln
145 150 155 160
Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln
165 170 175
Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile
180 185 190
Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
195 200 205
Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln
210 215 220
Tyr Gly Tyr Pro Pro Arg Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu
225 230 235 240
Ile Lys Arg
<210> 49
<211> 26
<212> DNA
<213> Artificial sequence
<220>
<223> Primer LMF
<400> 49
caggaaacag ctatgaccat gattac 26
<210> 50
<211> 80
<212> DNA
<213> Artificial sequence
<220>
<223> Primer BH1R
<220>
<221> misc_feature
<222> (44)..(45)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (47)..(48)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (50)..(51)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (53)..(54)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (56)..(57)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (59)..(60)
<223> n is a, c, g, or t
<400> 50
tgagacccac tccagcccct tccctggagc ctggcggacc camnnmnnmn nmnnmnnmnn 60
aaaggtgaat ccggaggctg 80
<210> 51
<211> 67
<212> DNA
<213> Artificial sequence
<220>
<223> Primer BH2F
<220>
<221> misc_feature
<222> (18)..(19)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (24)..(25)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (27)..(28)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (30)..(31)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (33)..(34)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (39)..(40)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (45)..(46)
<223> n is a, c, g, or t
<400> 51
ggctggagtg ggtctcannk attnnknnkn nknnkggtnn kacannktac gcagactccg 60
tgaaggg 67
<210> 52
<211> 30
<212> DNA
<213> Artificial sequence
<220>
<223> Primer FdR
<400> 52
gacgttagta aatgaatttt ctgtatgagg 30
<210> 53
<211> 85
<212> DNA
<213> Artificial sequence
<220>
<223> Primer BL1R
<220>
<221> misc_feature
<222> (44)..(45)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (50)..(51)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (53)..(54)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (56)..(57)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (59)..(60)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (62)..(63)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (65)..(66)
<223> n is a, c, g, or t
<400> 53
gatgaggagc ctgggagcct ggccaggttt ctgctggtac camnntaamn nmnnmnnmnn 60
mnnmnnctga ctggccctgc aagag 85
<210> 54
<211> 58
<212> DNA
<213> Artificial sequence
<220>
<223> Primer BL2F
<220>
<221> misc_feature
<222> (23)..(24)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (26)..(27)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (29)..(30)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (32)..(33)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (35)..(36)
<223> n is a, c, g, or t
<400> 54
ccaggctccc aggctcctca tcnnknnknn knnknnkagg gccactggca tcccagac 58
<210> 55
<211> 244
<212> PRT
<213> Artificial sequence
<220>
<223> 23F10 scFv
<400> 55
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125
Ser Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
130 135 140
Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser
145 150 155 160
Gln Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly
180 185 190
Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln
210 215 220
Gln Tyr Phe Asn Pro Pro Glu Tyr Thr Phe Gly Gln Gly Thr Lys Val
225 230 235 240
Glu Ile Lys Arg
<210> 56
<211> 119
<212> PRT
<213> Artificial sequence
<220>
<223> 25C2 VH(AA)
<400> 56
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Gly Gly Asn
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Asn Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser
115
<210> 57
<211> 357
<212> DNA
<213> Artificial sequence
<220>
<223> 25C2 VH
<400> 57
gaggtgcaat tgctggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60
tcctgtgcag cctccggatt cacctttggc ggtaatgcca tgtcctgggt ccgccaggct 120
ccagggaagg ggctggagtg ggtctcagca attagtggta atggtggtag tacattctac 180
gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat 240
ctgcagatga acagcctgag agccgaggac acggccgtat attactgtgc gaaagttcgt 300
ccattctggg gtactttcga ctactggggc caaggaaccc tggtcaccgt ctcgagt 357
<210> 58
<211> 119
<212> PRT
<213> Artificial sequence
<220>
<223> 25D2 VH(AA)
<400> 58
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Arg Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Gly Gly Gly Asn Thr Phe Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser
115
<210> 59
<211> 357
<212> DNA
<213> Artificial sequence
<220>
<223> 25D2 VH
<400> 59
gaggtgcaat tgctggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60
tcctgtgcag cctccggatt cacctttagg agctatgcca tgagctgggt ccgccaggct 120
ccagggaagg ggctggagtg ggtctcagct attagtggcg gtggtggtaa cacattctac 180
gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat 240
ctgcagatga acagcctgag agccgaggac acggccgtat attactgtgc gaaagttcgt 300
ccattctggg gtactttcga ctactggggc caaggaaccc tggtcaccgt ctcgagt 357
<210> 60
<211> 5
<212> PRT
<213> Artificial sequence
<220>
<223> 25C2 HCDR1
<400> 60
Gly Asn Ala Met Ser
1 5
<210> 61
<211> 17
<212> PRT
<213> Artificial sequence
<220>
<223> 25C2 HCDR2
<400> 61
Ala Ile Ser Gly Asn Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val Lys
1 5 10 15
Gly
<210> 62
<211> 5
<212> PRT
<213> Artificial sequence
<220>
<223> 25D2 HCDR1
<400> 62
Ser Tyr Ala Met Ser
1 5
<210> 63
<211> 17
<212> PRT
<213> Artificial sequence
<220>
<223> 25D2 HCDR2
<400> 63
Ala Ile Ser Gly Gly Gly Gly Asn Thr Phe Tyr Ala Asp Ser Val Lys
1 5 10 15
Gly
<210> 64
<211> 732
<212> DNA
<213> Artificial sequence
<220>
<223> 25C2 scFv
<400> 64
gaggtgcaat tgctggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60
tcctgtgcag cctccggatt cacctttggc ggtaatgcca tgtcctgggt ccgccaggct 120
ccagggaagg ggctggagtg ggtctcagca attagtggta atggtggtag tacattctac 180
gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat 240
ctgcagatga acagcctgag agccgaggac acggccgtat attactgtgc gaaagttcgt 300
ccattctggg gtactttcga ctactggggc caaggaaccc tggtcaccgt ctcgagtggt 360
ggaggcggtt caggcggagg tggttctggc ggtggcggat cggaaatcgt gttaacgcag 420
tctccaggca ccctgtcttt gtctccaggg gaaagagcca ccctctcttg cagggccagt 480
cagagtgtta gcagcagcta cttagcctgg taccagcaga aacctggcca ggctcccagg 540
ctcctcatct atggagcatc cagcagggcc actggcatcc cagacaggtt cagtggcagt 600
ggatccggga cagacttcac tctcaccatc agcagactgg agcctgaaga ttttgcagtg 660
tattactgtc agcagtactt caacccacca gaatacacgt tcggccaggg gaccaaagtg 720
gaaatcaaac gt 732
<210> 65
<211> 244
<212> PRT
<213> Artificial sequence
<220>
<223> 25C2 scFv(AA)
<400> 65
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Gly Gly Asn
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Asn Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125
Ser Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
130 135 140
Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser
145 150 155 160
Gln Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly
180 185 190
Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln
210 215 220
Gln Tyr Phe Asn Pro Pro Glu Tyr Thr Phe Gly Gln Gly Thr Lys Val
225 230 235 240
Glu Ile Lys Arg
<210> 66
<211> 732
<212> DNA
<213> Artificial sequence
<220>
<223> 25D2 scFv
<400> 66
gaggtgcaat tgctggagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc 60
tcctgtgcag cctccggatt cacctttagg agctatgcca tgagctgggt ccgccaggct 120
ccagggaagg ggctggagtg ggtctcagct attagtggcg gtggtggtaa cacattctac 180
gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa cacgctgtat 240
ctgcagatga acagcctgag agccgaggac acggccgtat attactgtgc gaaagttcgt 300
ccattctggg gtactttcga ctactggggc caaggaaccc tggtcaccgt ctcgagtggt 360
ggaggcggtt caggcggagg tggttctggc ggtggcggat cggaaatcgt gttaacgcag 420
tctccaggca ccctgtcttt gtctccaggg gaaagagcca ccctctcttg cagggccagt 480
cagagtgtta gcagcagcta cttagcctgg taccagcaga aacctggcca ggctcccagg 540
ctcctcatct atggagcatc cagcagggcc actggcatcc cagacaggtt cagtggcagt 600
ggatccggga cagacttcac tctcaccatc agcagactgg agcctgaaga ttttgcagtg 660
tattactgtc agcagtactt caacccacca gaatacacgt tcggccaggg gaccaaagtg 720
gaaatcaaac gt 732
<210> 67
<211> 244
<212> PRT
<213> Artificial sequence
<220>
<223> 25D2 scFv(AA)
<400> 67
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Arg Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Gly Gly Gly Asn Thr Phe Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125
Ser Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
130 135 140
Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser
145 150 155 160
Gln Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly
180 185 190
Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln
210 215 220
Gln Tyr Phe Asn Pro Pro Glu Tyr Thr Phe Gly Gln Gly Thr Lys Val
225 230 235 240
Glu Ile Lys Arg
<210> 68
<211> 60
<212> DNA
<213> Artificial sequence
<220>
<223> PD-1 signal peptide sequence
<400> 68
atgcagatcc cacaggcgcc ctggccagtc gtctgggcgg tgctacaact gggctggcgg 60
<210> 69
<211> 450
<212> DNA
<213> Artificial sequence
<220>
<223> PD-1 extracellular segment sequence
<400> 69
ccaggatggt tcttagactc cccagacagg ccctggaacc cccccacctt ctccccagcc 60
ctgctcgtgg tgaccgaagg ggacaacgcc accttcacct gcagcttctc caacacatcg 120
gagagcttcg tgctaaactg gtaccgcatg agccccagca accagacgga caagctggcc 180
gccttccccg aggaccgcag ccagcccggc caggactgcc gcttccgtgt cacacaactg 240
cccaacgggc gtgacttcca catgagcgtg gtcagggccc ggcgcaatga cagcggcacc 300
tacctctgtg gggccatctc cctggccccc aaggcgcaga tcaaagagag cctgcgggca 360
gagctcaggg tgacagagag aagggcagaa gtgcccacag cccaccccag cccctcaccc 420
aggccagccg gccagttcca aaccctggtg 450
<210> 70
<211> 321
<212> DNA
<213> Artificial sequence
<220>
<223> DNA sequence of CH3 domain
<400> 70
cccccatgcc caccatgccc agcacctgag ttcctggggg gaccatcagt cttcctgttc 60
cccccaaaac ccaaggacac tctcatgatc tcccggaccc ctgaggtcac gtgcgtggtg 120
gtggacgtga gccaggaaga ccccgaggtc cagttcaact ggtacgtgga tggcgtggag 180
gtgcataatg ccaagacaaa gccgcgggag gagcagttca acagcacgta ccgtgtggtc 240
agcgtcctca ccgtcctgca ccaggactgg ctgaacggca aggagtacaa gtgcaaggtc 300
tccaacaaag gcctcccgtc c 321
<210> 71
<211> 49
<212> DNA
<213> Artificial sequence
<220>
<223> Primer
<400> 71
acgcgtccta gcgctaccgg tcgccaccat gcagatccca caggcgccc 49
<210> 72
<211> 41
<212> DNA
<213> Artificial sequence
<220>
<223> Primer
<400> 72
ctctcggggc tgcccaccat acaccagggt ttggaactgg c 41
<210> 73
<211> 27
<212> DNA
<213> Artificial sequence
<220>
<223> Primer
<400> 73
tatggtgggc agccccgaga gccacag 27
<210> 74
<211> 40
<212> DNA
<213> Artificial sequence
<220>
<223> Primer
<400> 74
aaaattcaaa gtctgtttca ctttacccgg agacagggag 40
<210> 75
<211> 465
<212> PRT
<213> Artificial sequence
<220>
<223> 7A12-BBZ
<400> 75
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Arg Tyr Pro Tyr Leu Ala Phe Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110
Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125
Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser
130 135 140
Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser
145 150 155 160
Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala
165 170 175
Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro
180 185 190
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
195 200 205
Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr
210 215 220
Gly Tyr Pro Pro Ser Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile
225 230 235 240
Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro Thr
245 250 255
Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro Ala
260 265 270
Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp Ile
275 280 285
Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu Leu Ser
290 295 300
Leu Val Ile Thr Leu Tyr Cys Lys Arg Gly Arg Lys Lys Leu Leu Tyr
305 310 315 320
Ile Phe Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln Glu Glu
325 330 335
Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys Glu
340 345 350
Leu Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Lys Gln
355 360 365
Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu
370 375 380
Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly
385 390 395 400
Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln
405 410 415
Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu
420 425 430
Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr
435 440 445
Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro
450 455 460
Arg
465
<210> 76
<211> 467
<212> PRT
<213> Artificial sequence
<220>
<223> 25C2-BBZ
<400> 76
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Gly Gly Asn
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Asn Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125
Ser Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
130 135 140
Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser
145 150 155 160
Gln Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly
180 185 190
Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln
210 215 220
Gln Tyr Phe Asn Pro Pro Glu Tyr Thr Phe Gly Gln Gly Thr Lys Val
225 230 235 240
Glu Ile Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala
245 250 255
Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg
260 265 270
Pro Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys
275 280 285
Asp Ile Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu
290 295 300
Leu Ser Leu Val Ile Thr Leu Tyr Cys Lys Arg Gly Arg Lys Lys Leu
305 310 315 320
Leu Tyr Ile Phe Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln
325 330 335
Glu Glu Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly
340 345 350
Cys Glu Leu Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr
355 360 365
Lys Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg
370 375 380
Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met
385 390 395 400
Gly Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu
405 410 415
Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys
420 425 430
Gly Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu
435 440 445
Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu
450 455 460
Pro Pro Arg
465
<210> 77
<211> 467
<212> PRT
<213> Artificial sequence
<220>
<223> 25D2-BBZ
<400> 77
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Arg Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Gly Gly Gly Asn Thr Phe Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125
Ser Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
130 135 140
Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser
145 150 155 160
Gln Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly
180 185 190
Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln
210 215 220
Gln Tyr Phe Asn Pro Pro Glu Tyr Thr Phe Gly Gln Gly Thr Lys Val
225 230 235 240
Glu Ile Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala
245 250 255
Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg
260 265 270
Pro Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys
275 280 285
Asp Ile Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu
290 295 300
Leu Ser Leu Val Ile Thr Leu Tyr Cys Lys Arg Gly Arg Lys Lys Leu
305 310 315 320
Leu Tyr Ile Phe Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln
325 330 335
Glu Glu Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly
340 345 350
Cys Glu Leu Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr
355 360 365
Lys Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg
370 375 380
Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met
385 390 395 400
Gly Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu
405 410 415
Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys
420 425 430
Gly Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu
435 440 445
Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu
450 455 460
Pro Pro Arg
465
<210> 78
<211> 466
<212> PRT
<213> Artificial sequence
<220>
<223> 7G2-BBZ
<400> 78
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Leu Ser Gly Asp Ala Ala Met Asp Tyr Trp Gly Gln Gly Thr
100 105 110
Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
115 120 125
Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu
130 135 140
Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln
145 150 155 160
Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln
165 170 175
Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile
180 185 190
Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
195 200 205
Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln
210 215 220
Tyr Gly Tyr Pro Pro Arg Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu
225 230 235 240
Ile Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro
245 250 255
Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro
260 265 270
Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp
275 280 285
Ile Tyr Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu Leu Leu
290 295 300
Ser Leu Val Ile Thr Leu Tyr Cys Lys Arg Gly Arg Lys Lys Leu Leu
305 310 315 320
Tyr Ile Phe Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln Glu
325 330 335
Glu Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys
340 345 350
Glu Leu Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Lys
355 360 365
Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu
370 375 380
Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly
385 390 395 400
Gly Lys Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu
405 410 415
Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly
420 425 430
Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser
435 440 445
Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro
450 455 460
Pro Arg
465
<210> 79
<211> 468
<212> PRT
<213> Artificial sequence
<220>
<223> 7A12-28Z
<400> 79
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Arg Tyr Pro Tyr Leu Ala Phe Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110
Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125
Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser
130 135 140
Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser
145 150 155 160
Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala
165 170 175
Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro
180 185 190
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
195 200 205
Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr
210 215 220
Gly Tyr Pro Pro Ser Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile
225 230 235 240
Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro Thr
245 250 255
Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro Ala
260 265 270
Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp Phe
275 280 285
Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu
290 295 300
Val Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg
305 310 315 320
Leu Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro
325 330 335
Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala
340 345 350
Tyr Arg Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr
355 360 365
Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg
370 375 380
Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met
385 390 395 400
Gly Gly Lys Pro Gln Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn
405 410 415
Glu Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met
420 425 430
Lys Gly Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly
435 440 445
Leu Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala
450 455 460
Leu Pro Pro Arg
465
<210> 80
<211> 510
<212> PRT
<213> Artificial sequence
<220>
<223> 7A12-28BBZ
<400> 80
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Arg Tyr Pro Tyr Leu Ala Phe Asp Tyr Trp Gly Gln Gly Thr Leu
100 105 110
Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125
Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser
130 135 140
Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser
145 150 155 160
Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala
165 170 175
Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro
180 185 190
Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
195 200 205
Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr
210 215 220
Gly Tyr Pro Pro Ser Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu Ile
225 230 235 240
Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro Thr
245 250 255
Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro Ala
260 265 270
Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp Phe
275 280 285
Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu Leu
290 295 300
Val Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser Arg
305 310 315 320
Leu Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly Pro
325 330 335
Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala Ala
340 345 350
Tyr Arg Ser Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln
355 360 365
Pro Phe Met Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser
370 375 380
Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu Arg Val Lys
385 390 395 400
Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln Asn Gln
405 410 415
Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu
420 425 430
Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Gln Arg
435 440 445
Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys
450 455 460
Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg Arg Arg
465 470 475 480
Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys
485 490 495
Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg
500 505 510
<210> 81
<211> 469
<212> PRT
<213> Artificial sequence
<220>
<223> 7G2-28Z
<400> 81
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Leu Ser Gly Asp Ala Ala Met Asp Tyr Trp Gly Gln Gly Thr
100 105 110
Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
115 120 125
Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu
130 135 140
Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln
145 150 155 160
Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln
165 170 175
Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile
180 185 190
Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
195 200 205
Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln
210 215 220
Tyr Gly Tyr Pro Pro Arg Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu
225 230 235 240
Ile Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro
245 250 255
Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro
260 265 270
Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp
275 280 285
Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu
290 295 300
Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser
305 310 315 320
Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly
325 330 335
Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala
340 345 350
Ala Tyr Arg Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala
355 360 365
Tyr Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg
370 375 380
Arg Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu
385 390 395 400
Met Gly Gly Lys Pro Gln Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr
405 410 415
Asn Glu Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly
420 425 430
Met Lys Gly Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln
435 440 445
Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln
450 455 460
Ala Leu Pro Pro Arg
465
<210> 82
<211> 511
<212> PRT
<213> Artificial sequence
<220>
<223> 7G2-28BBZ
<400> 82
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Leu Ser Gly Asp Ala Ala Met Asp Tyr Trp Gly Gln Gly Thr
100 105 110
Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser
115 120 125
Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu
130 135 140
Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln
145 150 155 160
Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln
165 170 175
Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile
180 185 190
Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
195 200 205
Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln
210 215 220
Tyr Gly Tyr Pro Pro Arg Tyr Thr Phe Gly Gln Gly Thr Lys Val Glu
225 230 235 240
Ile Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro
245 250 255
Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro
260 265 270
Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp
275 280 285
Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser Leu
290 295 300
Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg Ser
305 310 315 320
Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro Gly
325 330 335
Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe Ala
340 345 350
Ala Tyr Arg Ser Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys
355 360 365
Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys
370 375 380
Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu Arg Val
385 390 395 400
Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln Asn
405 410 415
Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val
420 425 430
Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Gln
435 440 445
Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp
450 455 460
Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg Arg
465 470 475 480
Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr
485 490 495
Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg
500 505 510
<210> 83
<211> 470
<212> PRT
<213> Artificial sequence
<220>
<223> 25C2-28Z
<400> 83
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125
Ser Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
130 135 140
Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser
145 150 155 160
Gln Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly
180 185 190
Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln
210 215 220
Gln Tyr Phe Asn Pro Pro Glu Tyr Thr Phe Gly Gln Gly Thr Lys Val
225 230 235 240
Glu Ile Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala
245 250 255
Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg
260 265 270
Pro Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys
275 280 285
Asp Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser
290 295 300
Leu Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg
305 310 315 320
Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro
325 330 335
Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe
340 345 350
Ala Ala Tyr Arg Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro
355 360 365
Ala Tyr Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly
370 375 380
Arg Arg Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro
385 390 395 400
Glu Met Gly Gly Lys Pro Gln Arg Arg Lys Asn Pro Gln Glu Gly Leu
405 410 415
Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile
420 425 430
Gly Met Lys Gly Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr
435 440 445
Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met
450 455 460
Gln Ala Leu Pro Pro Arg
465 470
<210> 84
<211> 512
<212> PRT
<213> Artificial sequence
<220>
<223> 25C2-28BBZ
<400> 84
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125
Ser Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
130 135 140
Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser
145 150 155 160
Gln Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly
180 185 190
Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln
210 215 220
Gln Tyr Phe Asn Pro Pro Glu Tyr Thr Phe Gly Gln Gly Thr Lys Val
225 230 235 240
Glu Ile Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala
245 250 255
Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg
260 265 270
Pro Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys
275 280 285
Asp Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser
290 295 300
Leu Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg
305 310 315 320
Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro
325 330 335
Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe
340 345 350
Ala Ala Tyr Arg Ser Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe
355 360 365
Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly
370 375 380
Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu Arg
385 390 395 400
Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln
405 410 415
Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp
420 425 430
Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro
435 440 445
Gln Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys
450 455 460
Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg
465 470 475 480
Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala
485 490 495
Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg
500 505 510
<210> 85
<211> 470
<212> PRT
<213> Artificial sequence
<220>
<223> 25D2-28Z
<400> 85
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Arg Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Gly Gly Gly Asn Thr Phe Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125
Ser Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
130 135 140
Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser
145 150 155 160
Gln Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly
180 185 190
Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln
210 215 220
Gln Tyr Phe Asn Pro Pro Glu Tyr Thr Phe Gly Gln Gly Thr Lys Val
225 230 235 240
Glu Ile Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala
245 250 255
Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg
260 265 270
Pro Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys
275 280 285
Asp Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser
290 295 300
Leu Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg
305 310 315 320
Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro
325 330 335
Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe
340 345 350
Ala Ala Tyr Arg Ser Arg Val Lys Phe Ser Arg Ser Ala Asp Ala Pro
355 360 365
Ala Tyr Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly
370 375 380
Arg Arg Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro
385 390 395 400
Glu Met Gly Gly Lys Pro Gln Arg Arg Lys Asn Pro Gln Glu Gly Leu
405 410 415
Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile
420 425 430
Gly Met Lys Gly Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu Tyr
435 440 445
Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His Met
450 455 460
Gln Ala Leu Pro Pro Arg
465 470
<210> 86
<211> 512
<212> PRT
<213> Artificial sequence
<220>
<223> 25D2-28BBZ
<400> 86
Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Arg Ser Tyr
20 25 30
Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ser Ala Ile Ser Gly Gly Gly Gly Asn Thr Phe Tyr Ala Asp Ser Val
50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95
Ala Lys Val Arg Pro Phe Trp Gly Thr Phe Asp Tyr Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125
Ser Gly Gly Gly Gly Ser Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
130 135 140
Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser
145 150 155 160
Gln Ser Val Ser Ser Ser Tyr Leu Ala Trp Tyr Gln Gln Lys Pro Gly
165 170 175
Gln Ala Pro Arg Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly
180 185 190
Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
195 200 205
Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln
210 215 220
Gln Tyr Phe Asn Pro Pro Glu Tyr Thr Phe Gly Gln Gly Thr Lys Val
225 230 235 240
Glu Ile Lys Arg Thr Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala
245 250 255
Pro Thr Ile Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg
260 265 270
Pro Ala Ala Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys
275 280 285
Asp Phe Trp Val Leu Val Val Val Gly Gly Val Leu Ala Cys Tyr Ser
290 295 300
Leu Leu Val Thr Val Ala Phe Ile Ile Phe Trp Val Arg Ser Lys Arg
305 310 315 320
Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met Thr Pro Arg Arg Pro
325 330 335
Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr Ala Pro Pro Arg Asp Phe
340 345 350
Ala Ala Tyr Arg Ser Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe
355 360 365
Lys Gln Pro Phe Met Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly
370 375 380
Cys Ser Cys Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu Arg
385 390 395 400
Val Lys Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln
405 410 415
Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp
420 425 430
Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro
435 440 445
Gln Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys
450 455 460
Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg
465 470 475 480
Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala
485 490 495
Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg
500 505 510
<210> 87
<211> 412
<212> PRT
<213> Artificial sequence
<220>
<223> C11D5.3-BBZ
<400> 87
Gln Ile Gln Leu Val Gln Ser Gly Pro Glu Leu Lys Lys Pro Gly Glu
1 5 10 15
Thr Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr
20 25 30
Ser Ile Asn Trp Val Lys Arg Ala Pro Gly Lys Gly Leu Lys Trp Met
35 40 45
Gly Trp Ile Asn Thr Glu Thr Arg Glu Pro Ala Tyr Ala Tyr Asp Phe
50 55 60
Arg Gly Arg Phe Ala Phe Ser Leu Glu Thr Ser Ala Ser Thr Ala Tyr
65 70 75 80
Leu Gln Ile Asn Asn Leu Lys Tyr Glu Asp Thr Ala Thr Tyr Phe Cys
85 90 95
Ala Leu Asp Tyr Ser Tyr Ala Met Asp Tyr Trp Gly Gln Gly Thr Ser
100 105 110
Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly
115 120 125
Gly Gly Gly Ser Asp Ile Val Leu Thr Gln Ser Pro Pro Ser Leu Ala
130 135 140
Met Ser Leu Gly Lys Arg Ala Thr Ile Ser Cys Arg Ala Ser Glu Ser
145 150 155 160
Val Thr Ile Leu Gly Ser His Leu Ile His Trp Tyr Gln Gln Lys Pro
165 170 175
Gly Gln Pro Pro Thr Leu Leu Ile Gln Leu Ala Ser Asn Thr Thr Thr
180 185 190
Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro
195 200 205
Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val
210 215 220
His Thr Arg Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro
225 230 235 240
Leu Ala Gly Thr Cys Gly Val Leu Leu Leu Ser Leu Val Ile Thr Leu
245 250 255
Tyr Cys Lys Arg Gly Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro
260 265 270
Phe Met Arg Pro Val Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys
275 280 285
Arg Phe Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu Arg Val Lys Phe
290 295 300
Ser Arg Ser Ala Asp Ala Pro Ala Tyr Lys Gln Gly Gln Asn Gln Leu
305 310 315 320
Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu Asp
325 330 335
Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Arg Arg Lys
340 345 350
Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala
355 360 365
Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg Arg Arg Gly Lys
370 375 380
Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr
385 390 395 400
Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg
405 410
Claims (28)
- (1) 서열번호 1, 60 또는 62에 의해 표시되는 HCDR1, 및/또는 서열번호 2, 61 또는 63에 의해 표시되는 HCDR2, 및/또는 서열번호 3, 4 또는 5에 의해 표시되는 HCDR3을 포함하는 중쇄 가변 영역을 포함하는 항체;
(2) 서열번호 6에 의해 표시되는 LCDR1, 및/또는 서열번호 7에 의해 표시되는 LCDR2, 및/또는 서열번호 8, 9 또는 10에 의해 표시되는 LCDR3을 포함하는 경쇄 가변 영역을 포함하는 항체;
(3) (1)에 따른 항체의 중쇄 가변 영역 및 (2)에 따른 항체의 경쇄 가변 영역을 포함하는 항체; 및
(4) (1) 내지 (3) 중 어느 하나에 따른 항체의 변이체이고 (1) 내지 (3) 중 어느 하나에 따른 항체와 동일하거나 유사한 활성을 갖는 항체
로 이루어진 군으로부터 선택되는 B 세포 성숙 항원(BCMA) 표적 항체. - 제1항에 있어서,
(1) 서열번호 1에 의해 표시되는 HCDR1, 서열번호 2에 의해 표시되는 HCDR2, 서열번호 3에 의해 표시되는 HCDR3, 서열번호 6에 의해 표시되는 LCDR1, 서열번호 7에 의해 표시되는 LCDR2 및 서열번호 8에 의해 표시되는 LCDR3을 포함하는 항체;
(2) 서열번호 1에 의해 표시되는 HCDR1, 서열번호 2에 의해 표시되는 HCDR2, 서열번호 4에 의해 표시되는 HCDR3, 서열번호 6에 의해 표시되는 LCDR1, 서열번호 7에 의해 표시되는 LCDR2 및 서열번호 9에 의해 표시되는 LCDR3을 포함하는 항체;
(3) 서열번호 1에 의해 표시되는 HCDR1, 서열번호 2에 의해 표시되는 HCDR2, 서열번호 5에 의해 표시되는 HCDR3, 서열번호 6에 의해 표시되는 LCDR1, 서열번호 7에 의해 표시되는 LCDR2 및 서열번호 10에 의해 표시되는 LCDR3을 포함하는 항체;
(4) 서열번호 60에 의해 표시되는 HCDR1, 서열번호 61에 의해 표시되는 HCDR2, 서열번호 5에 의해 표시되는 HCDR3, 서열번호 6에 의해 표시되는 LCDR1, 서열번호 7에 의해 표시되는 LCDR2 및 서열번호 10에 의해 표시되는 LCDR3을 포함하는 항체;
(5) 서열번호 62에 의해 표시되는 HCDR1, 서열번호 63에 의해 표시되는 HCDR2, 서열번호 5에 의해 표시되는 HCDR3, 서열번호 6에 의해 표시되는 LCDR1, 서열번호 7에 의해 표시되는 LCDR2 및 서열번호 10에 의해 표시되는 LCDR3을 포함하는 항체; 및
(6) (1) 내지 (5) 중 어느 하나에 따른 항체의 변이체이고 (1) 내지 (5) 중 어느 하나에 따른 항체와 동일하거나 유사한 활성을 갖는 항체
로 이루어진 군으로부터 선택되는 BCMA 표적 항체. - 제1항에 있어서,
(1) 중쇄 가변 영역이 서열번호 13에 의해 표시되는 아미노산 서열, 서열번호 17에 의해 표시되는 아미노산 서열, 서열번호 21에 의해 표시되는 아미노산 서열, 서열번호 56에 의해 표시되는 아미노산 서열, 또는 서열번호 58에 의해 표시되는 아미노산 서열을 갖는 항체;
(2) 경쇄 가변 영역이 서열번호 11에 의해 표시되는 아미노산 서열, 서열번호 15에 의해 표시되는 아미노산 서열, 또는 서열번호 19에 의해 표시되는 아미노산 서열을 갖는 항체;
(3) (1)에 따른 항체의 중쇄 가변 영역 및 (2)에 따른 항체의 경쇄 가변 영역을 포함하는 항체; 및
(4) (1) 내지 (3) 중 어느 하나에 따른 항체의 변이체이고 (1) 내지 (3) 중 어느 하나에 따른 항체와 동일하거나 유사한 활성을 갖는 항체
로 이루어진 군으로부터 선택되는 BCMA 표적 항체. - 제3항에 있어서,
(1) 중쇄 가변 영역이 서열번호 13에 의해 표시되는 아미노산 서열을 갖고 경쇄 가변 영역이 서열번호 11에 의해 표시되는 아미노산 서열을 갖는 항체;
(2) 중쇄 가변 영역이 서열번호 17에 의해 표시되는 아미노산 서열을 갖고 경쇄 가변 영역이 서열번호 15에 의해 표시되는 아미노산 서열을 갖는 항체;
(3) 중쇄 가변 영역이 서열번호 21에 의해 표시되는 아미노산 서열을 갖고 경쇄 가변 영역이 서열번호 19에 의해 표시되는 아미노산 서열을 갖는 항체;
(4) 중쇄 가변 영역이 서열번호 56에 의해 표시되는 아미노산 서열을 갖고 경쇄 가변 영역이 서열번호 19에 의해 표시되는 아미노산 서열을 갖는 항체;
(5) 중쇄 가변 영역이 서열번호 58에 의해 표시되는 아미노산 서열을 갖고 경쇄 가변 영역이 서열번호 19에 의해 표시되는 아미노산 서열을 갖는 항체; 및
(6) (1) 내지 (5) 중 어느 하나에 따른 항체의 변이체이고 (1) 내지 (5) 중 어느 하나에 따른 항체와 동일하거나 유사한 활성을 갖는 항체
로 이루어진 군으로부터 선택되는 BCMA 표적 항체. - 제1항 내지 제4항 중 어느 한 항에 따른 항체와 동일한 항원결정부위를 식별하는 항체.
- 제1항 내지 제5항 중 어느 한 항에 따른 항체를 코딩하는 핵산.
- 제6항에 따른 핵산을 포함하는 발현 벡터.
- 제7항에 따른 발현 벡터를 포함하거나 게놈 중에 제6항에 따른 핵산이 통합되는 숙주 세포.
- BCMA를 발현하는 종양 세포를 특이적 표적으로 하는 표적 약물, 항체 약물 접합체 또는 다기능 항체를 제조하거나;
BCMA를 발현하는 종양을 진단하는 시약을 제조하거나;
바람직하게는, T 림프구, NK 세포 또는 NKT 림프구를 포함하는, 키메라 항원 수용체 변형된 면역 세포를 제조하기 위한,
제1항 내지 제5항 중 어느 한 항에 따른 항체의 용도. - 제1항 내지 제5항 중 어느 한 항에 따른 항체; 및
상기 항체와 연결되는 기능성 분자로서, 종양 표면 마커 표적 분자, 종양 억제 분자, 면역 세포의 표면 마커 표적 분자 및 검출가능 표지로부터 선택되는 기능성 분자
를 포함하는 다기능 면역접합체. - 제10항에 있어서,
종양 억제 분자가 항종양 사이토카인 또는 항종양 독소이고, 바람직하게는, 상기 사이토카인이 IL-12, IL-15, I형 인터페론, TNF-α를 포함하는, 다기능 면역접합체. - 제10항에 있어서,
면역 세포의 표면 마커 표적 분자가 면역 세포 표면 마커에 결합하는 항체 또는 리간드이고, 바람직하게는, 상기 면역 세포 표면 마커가 CD3, CD16, CD28을 포함하고, 보다 바람직하게는, 상기 면역 세포 표면 마커에 결합하는 항체가 항-CD3 항체인, 다기능 면역접합체. - 제12항에 있어서,
면역 세포의 표면 마커 표적 분자가 T 세포 표면 마커에 결합하는 항체인, 다기능 면역접합체. - 제10항 내지 제13항 중 어느 한 항에 따른 다기능 면역접합체를 코딩하는 핵산.
- 항종양 약물을 제조하거나;
BCMA를 발현하는 종양을 진단하는 시약을 제조하거나;
바람직하게는, T 림프구, NK 세포 또는 NKT 림프구를 포함하는, 키메라 항원 수용체 변형된 면역 세포를 제조하기 위한,
제10항 내지 제13항 중 어느 한 항에 따른 다기능 면역접합체의 용도. - 세포외 도메인, 막관통 도메인 및 세포내 신호 도메인을 포함하는 키메라 항원 수용체로서,
상기 세포외 도메인이 제1항 내지 제5항 중 어느 한 항에 따른 항체를 포함하고, 바람직하게는, 상기 항체가 단일 쇄 항체 또는 도메인 항체인, 키메라 항원 수용체. - 제16항에 있어서,
세포내 신호 도메인이 하나 이상의 공자극 신호 도메인 및/또는 1차 신호 도메인을 포함하는, 키메라 항원 수용체. - 제16항에 있어서,
힌지 도메인을 추가로 포함하는 키메라 항원 수용체. - 제17항에 있어서,
막관통 도메인이 TCR의 α 쇄, β 쇄 및 ζ 쇄, 및 CD3ε, CD3ζ, CD4, CD5,CD8α, CD9, CD16, CD22, CD27, CD28, CD33, CD37, CD45, CD64, CD80, CD86, CD134, CD137, CD152, CD154 및 PD1의 막관통 영역으로 이루어진 군으로부터 선택되고/거나;
공자극 신호 도메인이 CARD11, CD2, CD7, CD27, CD28, CD30, CD40, CD54, CD83, OX40, CD137, CD134, CD150, CD152, CD223, CD270, PD-L2, PD-L1, CD278, DAP10, LAT, NKD2C SLP76, TRIM, FcεRIγ, MyD88 및 41BBL의 세포내 신호 영역으로 이루어진 군으로부터 선택되고/거나;
1차 신호 도메인이 TCRξ, FcRγ, FcRβ, CD3γ, CD3δ, CD3ε, CD5, CD22, CD79a, CD79b, CD278("ICOS"로도 지칭됨), CD66d 및 CD3ζ로 이루어진 군으로부터 선택되고,
바람직하게는, 상기 막관통 도메인이 CD8α, CD4, CD45, PD1, CD154 및 CD28의 막관통 도메인으로 이루어진 군으로부터 선택되고/거나;
상기 공자극 신호 도메인이 CD137, CD134, CD28 및 OX40으로 이루어진 군으로부터 선택되고/거나;
상기 1차 신호 도메인이 CD3ζ로부터 선택되고,
가장 바람직하게는, 상기 막관통 도메인이 CD8α 및 CD28로부터 선택되고, 상기 공자극 신호 도메인이 CD137 또는 CD28의 세포내 신호 도메인으로부터 선택되고, 상기 1차 신호 도메인이 CD3ζ로부터 선택되는,
키메라 항원 수용체. - 제16항에 있어서,
제1항 내지 제5항 중 어느 한 항에 따른 항체, CD8의 막관통 영역 및 CD3ζ;
제1항 내지 제5항 중 어느 한 항에 따른 항체, CD8의 막관통 영역, CD137의 세포내 신호 영역 및 CD3ζ;
제1항 내지 제5항 중 어느 한 항에 따른 항체, CD28의 막관통 영역, CD28의 세포내 신호 영역 및 CD3ζ; 또는
제1항 내지 제5항 중 어느 한 항에 따른 항체, CD28의 막관통 영역, CD28의 세포내 신호 영역, CD137 및 CD3ζ
의 순서로 연결되는 항체, 막관통 영역 및 세포내 신호 영역을 포함하는 키메라 항원 수용체. - 제16항 내지 제20항 중 어느 한 항에 따른 키메라 항원 수용체를 코딩하는 핵산.
- 제21항에 따른 핵산을 포함하는 발현 벡터.
- 제22항에 따른 발현 벡터를 포함하는 바이러스.
- BCMA를 발현하는 종양 세포 표적 유전자 변형된 면역 세포를 제조하기 위한, 제16항 내지 제20항 중 어느 한 항에 따른 키메라 항원 수용체, 제21항에 따른 핵산, 제22항에 따른 발현 벡터 또는 제23항에 따른 바이러스의 용도.
- 제21항에 따른 핵산, 제22항에 따른 발현 벡터 또는 제23항에 따른 바이러스가 형질도입되거나; 제16항 내지 제20항 중 어느 한 항에 따른 키메라 항원 수용체가 발현되는, 유전자 변형된 면역 세포로서,
바람직하게는, T 림프구, NK 세포 및 NKT 세포로부터 선택되는 유전자 변형된 면역 세포. - 제25항에 있어서,
제16항 내지 제20항 중 어느 한 항에 따른 키메라 항원 수용체 이외의 다른 서열을 추가로 발현하되, 상기 다른 서열이 사이토카인, 다른 키메라 항원 수용체, 케모카인 수용체, PD-1 발현을 감소시키는 siRNA, PD-L1을 차단하는 단백질, TCR 또는 안전 스위치를 포함하는, 유전자 변형된 면역 세포로서,
바람직하게는, 상기 사이토카인이 IL-12, IL-15, IL-21 또는 I형 인터페론을 포함하고;
바람직하게는, 상기 케모카인 수용체가 CCR2, CCR5, CXCR2 또는 CXCR4를 포함하고;
바람직하게는, 상기 안전 스위치가 iCaspase-9, 절두된 EGFR 또는 RQR8을 포함하는,
유전자 변형된 면역 세포. - BCMA를 발현하는 종양을 억제하는 약물을 제조하기 위한, 제25항 또는 제26항에 따른 유전자 변형된 면역 세포의 용도.
- 제1항 내지 제5항 중 어느 한 항에 따른 항체 또는 상기 항체를 코딩하는 핵산;
제10항 내지 제13항 중 어느 한 항에 따른 면역접합체 또는 상기 면역접합체를 코딩하는 핵산;
제16항 내지 제20항 중 어느 한 항에 따른 키메라 항원 수용체 또는 상기 키메라 항원 수용체를 코딩하는 핵산; 또는
제25항 또는 제26항에 따른 유전자 변형된 면역 세포
를 포함하는 약학 조성물.
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201710058581 | 2017-01-23 | ||
CN201710058581.8 | 2017-01-23 | ||
CN201710920346 | 2017-09-30 | ||
CN201710920346.7 | 2017-09-30 | ||
PCT/CN2018/073863 WO2018133877A1 (zh) | 2017-01-23 | 2018-01-23 | 靶向bcma的抗体及其应用 |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20190130562A true KR20190130562A (ko) | 2019-11-22 |
KR102658660B1 KR102658660B1 (ko) | 2024-04-17 |
Family
ID=62908274
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020197024625A KR102658660B1 (ko) | 2017-01-23 | 2018-01-23 | Bcma 표적 항체 및 이의 용도 |
Country Status (12)
Country | Link |
---|---|
US (1) | US11525006B2 (ko) |
EP (1) | EP3572427A4 (ko) |
JP (1) | JP7280828B2 (ko) |
KR (1) | KR102658660B1 (ko) |
CN (2) | CN108341872B (ko) |
AU (1) | AU2018209012A1 (ko) |
BR (1) | BR112019014986A8 (ko) |
CA (1) | CA3050835A1 (ko) |
CL (1) | CL2019002036A1 (ko) |
IL (1) | IL268206B2 (ko) |
SG (1) | SG11201906780SA (ko) |
WO (1) | WO2018133877A1 (ko) |
Families Citing this family (37)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
FI3298033T4 (fi) | 2015-05-18 | 2023-09-22 | Tcr2 Therapeutics Inc | Koostumuksia ja lääkinnällisiä käyttöjä fuusioproteiineja käyttävälle tcr:n uudelleenohjelmoinnille |
JP7101621B2 (ja) | 2016-05-20 | 2022-07-15 | ハープーン セラピューティクス,インク. | 単一ドメイン血清アルブミン結合タンパク質 |
US11623958B2 (en) | 2016-05-20 | 2023-04-11 | Harpoon Therapeutics, Inc. | Single chain variable fragment CD3 binding proteins |
US11851491B2 (en) | 2016-11-22 | 2023-12-26 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
US11535668B2 (en) | 2017-02-28 | 2022-12-27 | Harpoon Therapeutics, Inc. | Inducible monovalent antigen binding protein |
JP7090347B2 (ja) | 2017-05-12 | 2022-06-24 | ハープーン セラピューティクス,インク. | メソテリン結合タンパク質 |
AU2018346955A1 (en) | 2017-10-13 | 2020-04-30 | Harpoon Therapeutics, Inc. | B cell maturation antigen binding proteins |
CN111630070A (zh) | 2017-10-13 | 2020-09-04 | 哈普恩治疗公司 | 三特异性蛋白质及使用方法 |
KR20210016390A (ko) | 2018-06-01 | 2021-02-15 | 노파르티스 아게 | Bcma에 대한 결합 분자 및 이의 용도 |
MX2021000488A (es) | 2018-07-19 | 2021-04-12 | Regeneron Pharma | Anticuerpos anti-bcma x anti-cd3 biespecificos y usos de estos. |
EP3834849A4 (en) * | 2018-07-24 | 2022-08-03 | CRAGE medical Co., Limited | METHOD OF TREATMENT OF A TUMOR USING AN IMMUNE EFFECTOR CELL |
JP7425049B2 (ja) | 2018-09-25 | 2024-01-30 | ハープーン セラピューティクス,インク. | Dll3結合タンパク質および使用方法 |
CN109293772B (zh) * | 2018-09-25 | 2020-09-29 | 上海邦耀生物科技有限公司 | 靶向bcma蛋白的抗体、嵌合抗原受体和药物 |
EA202190926A1 (ru) | 2018-10-01 | 2021-06-25 | Эдисет Био, Инк. | Композиции и способы в отношении сконструированных и несконструированных t-клеток для лечения гематологических опухолей |
CN109485733B (zh) * | 2018-12-28 | 2020-04-24 | 广州百暨基因科技有限公司 | 一种全人源的抗bcma嵌合抗原受体及其应用 |
CA3144549A1 (en) * | 2019-06-28 | 2020-12-30 | Cafa Therapeutics Limited | Cell for resisting transplant reaction and method |
WO2021016091A1 (en) * | 2019-07-19 | 2021-01-28 | St. Jude Children's Research Hospital, Inc. | Chimeric antigen receptors for direct and indirect targeting of fibronectin-positive tumors |
AU2020322588A1 (en) * | 2019-07-30 | 2022-02-03 | Jiangsu Hansoh Pharmaceutical Group Co., Ltd. | Anti-BCMA antibody, antigen-binding fragment thereof and medical use thereof |
JP2024500254A (ja) * | 2019-08-29 | 2024-01-09 | クレージュ メディカル カンパニー,リミテッド | 移植拒絶反応に抵抗する細胞及び方法 |
CN111944062B (zh) * | 2019-12-09 | 2023-11-07 | 深圳市体内生物医药科技有限公司 | 一种识别Fc片段的嵌合抗原受体及其应用 |
CN112979807B (zh) * | 2019-12-17 | 2022-07-26 | 深圳市菲鹏生物治疗股份有限公司 | Bcma结合抗体及其用途 |
JP7456075B2 (ja) * | 2020-01-03 | 2024-03-27 | ビオシオン インコーポレイテッド | 抗体結合bcma及びその使用 |
CN112851814B (zh) * | 2020-03-17 | 2023-07-07 | 西安宇繁生物科技有限责任公司 | 一种靶向bcma的全人源单链抗体及其制备方法与应用 |
CN113087798B (zh) * | 2020-12-31 | 2022-05-24 | 北京艺妙神州医药科技有限公司 | 一种抗bcma的抗体及其应用 |
CN114763383A (zh) * | 2021-01-13 | 2022-07-19 | 博生吉医药科技(苏州)有限公司 | 靶向人bcma的单克隆抗体及其应用 |
EP4321533A1 (en) | 2021-04-08 | 2024-02-14 | Crage Medical Co., Limited | Cellular immunotherapy use |
CA3214280A1 (en) | 2021-04-16 | 2022-10-20 | Julie Ann RYTLEWSKI | T cell therapy in patients who have had prior stem cell transplant |
CN117730094A (zh) * | 2021-07-16 | 2024-03-19 | 克莱格医学有限公司 | 用于肿瘤免疫学的组合物和方法 |
WO2023081735A1 (en) | 2021-11-03 | 2023-05-11 | Celgene Corporation | Chimeric antigen receptors specific for b-cell maturation antigen for use in treating myeloma |
CN116284385A (zh) * | 2021-12-07 | 2023-06-23 | 信达细胞制药(苏州)有限公司 | 靶向bcma的p329g抗体及其与嵌合抗原受体细胞的组合和应用 |
WO2023147515A1 (en) | 2022-01-28 | 2023-08-03 | Juno Therapeutics, Inc. | Methods of manufacturing cellular compositions |
WO2023220655A1 (en) | 2022-05-11 | 2023-11-16 | Celgene Corporation | Methods to overcome drug resistance by re-sensitizing cancer cells to treatment with a prior therapy via treatment with a t cell therapy |
WO2023220641A2 (en) | 2022-05-11 | 2023-11-16 | Juno Therapeutics, Inc. | Methods and uses related to t cell therapy and production of same |
WO2023230581A1 (en) | 2022-05-25 | 2023-11-30 | Celgene Corporation | Methods of manufacturing t cell therapies |
WO2023230548A1 (en) | 2022-05-25 | 2023-11-30 | Celgene Corporation | Method for predicting response to a t cell therapy |
CN114891108B (zh) * | 2022-05-30 | 2022-11-15 | 上海驯鹿生物技术有限公司 | 一种靶向bcma的全人源抗体及其应用 |
WO2024097905A1 (en) | 2022-11-02 | 2024-05-10 | Celgene Corporation | Methods of treatment with t cell therapy and immunomodulatory agent maintenance therapy |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2015112900A1 (en) * | 2014-01-24 | 2015-07-30 | Dana-Farber Cancer Institue, Inc. | Antibody molecules to pd-1 and uses thereof |
WO2016014565A2 (en) * | 2014-07-21 | 2016-01-28 | Novartis Ag | Treatment of cancer using humanized anti-bcma chimeric antigen receptor |
Family Cites Families (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
DK0672142T3 (da) | 1992-12-04 | 2001-06-18 | Medical Res Council | Multivalente og multispecifikke bindingsproteiner samt fremstilling og anvendelse af disse |
HUE063461T2 (hu) * | 2011-05-27 | 2024-01-28 | Glaxo Group Ltd | BCMA (CD269/TNFRSF17)-kötõ fehérjék |
UA112434C2 (uk) * | 2011-05-27 | 2016-09-12 | Ґлаксо Ґруп Лімітед | Антигензв'язувальний білок, який специфічно зв'язується з всма |
TW201425336A (zh) | 2012-12-07 | 2014-07-01 | Amgen Inc | Bcma抗原結合蛋白質 |
US9963513B2 (en) | 2013-02-05 | 2018-05-08 | Engmab Sàrl | Method for the selection of antibodies against BCMA |
US9209965B2 (en) | 2014-01-14 | 2015-12-08 | Microsemi Semiconductor Ulc | Network interface with clock recovery module on line card |
JOP20200096A1 (ar) | 2014-01-31 | 2017-06-16 | Children’S Medical Center Corp | جزيئات جسم مضاد لـ tim-3 واستخداماتها |
WO2015124297A1 (en) | 2014-02-19 | 2015-08-27 | Merck Patent Gmbh | Cancer-targeted il-12 immunotherapy |
KR20170108944A (ko) | 2014-12-05 | 2017-09-27 | 메모리얼 슬로안-케터링 캔서 센터 | B-세포 성숙화 항원을 표적화하는 항체 및 사용 방법 |
CN105777911B (zh) | 2016-04-12 | 2019-07-02 | 上海优卡迪生物医药科技有限公司 | 抗bcma嵌合抗原受体、编码基因、重组表达载体及其构建方法和应用 |
CN109503715B (zh) | 2017-09-15 | 2023-12-15 | 科济生物医药(上海)有限公司 | Il-4r的融合蛋白及其应用 |
EP3834849A4 (en) * | 2018-07-24 | 2022-08-03 | CRAGE medical Co., Limited | METHOD OF TREATMENT OF A TUMOR USING AN IMMUNE EFFECTOR CELL |
CA3122131A1 (en) * | 2018-09-21 | 2020-03-26 | Zonghai Li | Method for gene editing of cell on the basis of crispr/cas system |
CA3144549A1 (en) * | 2019-06-28 | 2020-12-30 | Cafa Therapeutics Limited | Cell for resisting transplant reaction and method |
-
2018
- 2018-01-23 BR BR112019014986A patent/BR112019014986A8/pt unknown
- 2018-01-23 JP JP2019539840A patent/JP7280828B2/ja active Active
- 2018-01-23 CN CN201810065525.1A patent/CN108341872B/zh active Active
- 2018-01-23 IL IL268206A patent/IL268206B2/en unknown
- 2018-01-23 CN CN202010442827.3A patent/CN111574628B/zh active Active
- 2018-01-23 KR KR1020197024625A patent/KR102658660B1/ko active IP Right Grant
- 2018-01-23 AU AU2018209012A patent/AU2018209012A1/en active Pending
- 2018-01-23 CA CA3050835A patent/CA3050835A1/en active Pending
- 2018-01-23 EP EP18741764.7A patent/EP3572427A4/en active Pending
- 2018-01-23 WO PCT/CN2018/073863 patent/WO2018133877A1/zh active Application Filing
- 2018-01-23 SG SG11201906780SA patent/SG11201906780SA/en unknown
- 2018-01-23 US US16/479,365 patent/US11525006B2/en active Active
-
2019
- 2019-07-19 CL CL2019002036A patent/CL2019002036A1/es unknown
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2015112900A1 (en) * | 2014-01-24 | 2015-07-30 | Dana-Farber Cancer Institue, Inc. | Antibody molecules to pd-1 and uses thereof |
WO2016014565A2 (en) * | 2014-07-21 | 2016-01-28 | Novartis Ag | Treatment of cancer using humanized anti-bcma chimeric antigen receptor |
Also Published As
Publication number | Publication date |
---|---|
JP7280828B2 (ja) | 2023-05-24 |
SG11201906780SA (en) | 2019-08-27 |
CA3050835A1 (en) | 2018-07-26 |
RU2019123366A3 (ko) | 2021-10-27 |
IL268206A (en) | 2019-09-26 |
EP3572427A4 (en) | 2021-04-28 |
WO2018133877A1 (zh) | 2018-07-26 |
BR112019014986A2 (pt) | 2020-04-28 |
RU2019123366A (ru) | 2021-02-24 |
IL268206B2 (en) | 2024-05-01 |
US20190359726A1 (en) | 2019-11-28 |
JP2020506688A (ja) | 2020-03-05 |
CN108341872A (zh) | 2018-07-31 |
US11525006B2 (en) | 2022-12-13 |
CN111574628A (zh) | 2020-08-25 |
BR112019014986A8 (pt) | 2022-10-18 |
IL268206B1 (en) | 2024-01-01 |
CL2019002036A1 (es) | 2019-10-04 |
KR102658660B1 (ko) | 2024-04-17 |
AU2018209012A1 (en) | 2019-09-12 |
EP3572427A1 (en) | 2019-11-27 |
CN108341872B (zh) | 2020-05-19 |
NZ756635A (en) | 2023-10-27 |
CN111574628B (zh) | 2023-08-08 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR102658660B1 (ko) | Bcma 표적 항체 및 이의 용도 | |
US20220064319A1 (en) | Human monoclonal antibody human cd134 (ox40) and methods of making and using same | |
KR102493282B1 (ko) | Tim3에 대한 항체 및 그의 용도 | |
CA2719924C (en) | Cd37 immunotherapeutic and combination with bifunctional chemotherapeutic thereof | |
CN110719920B (zh) | 蛋白质异二聚体及其用途 | |
CN1911965B (zh) | 结合域-免疫球蛋白融合蛋白 | |
KR101251157B1 (ko) | Cd37-특이적 결합 분자 및 cd20-특이적 결합 분자를사용한 b-세포 감소 | |
KR20200110358A (ko) | 항-pd-1 항체 및 치료 방법 | |
KR20190015733A (ko) | Bcma에 결합하는 키메라 항원 수용체 및 car-t 세포 | |
KR20110083730A (ko) | Cd37 면역치료제 병용 요법 및 이의 용도 | |
TW200823235A (en) | Prophylactic and therapeutic agent for cancers | |
KR20110043643A (ko) | 인터루킨 6 면역치료제 | |
KR20210089179A (ko) | Cll1을 표적으로 하는 항체 및 이의 응용 | |
KR20200044899A (ko) | 암의 치료 및 진단을 위한 tim-3 길항제 | |
KR20200109339A (ko) | Tim3에 대한 항체를 사용하여 암을 치료하는 방법 | |
CN113166727A (zh) | 对消融方案耐受的基因修饰的hspc | |
KR20200108870A (ko) | Tim3에 대한 항체 및 그의 용도 | |
TW201915017A (zh) | 標靶bcma的抗體及其應用 | |
RU2799655C2 (ru) | Антитело, нацеленное на всма, и его применение |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
N231 | Notification of change of applicant | ||
E902 | Notification of reason for refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant |