EP3833678A1 - Peptides derives d'une beta-defensine 11 aviaire et leurs utilisations - Google Patents
Peptides derives d'une beta-defensine 11 aviaire et leurs utilisationsInfo
- Publication number
- EP3833678A1 EP3833678A1 EP19758345.3A EP19758345A EP3833678A1 EP 3833678 A1 EP3833678 A1 EP 3833678A1 EP 19758345 A EP19758345 A EP 19758345A EP 3833678 A1 EP3833678 A1 EP 3833678A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- avbdll
- seq
- peptide
- gga
- peptide molecule
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/465—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from birds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
Definitions
- the present invention relates to peptides and their uses, in particular in the veterinary and pharmaceutical field.
- the oviparous egg ensures the autonomous development of the bird embryo outside the mother's body. In chickens, embryonic development takes place in 21 days at a temperature of 37-38 ° C. The egg must therefore naturally contain all the molecules necessary for the growth of this embryo and its protection. To protect itself from microbial contamination, the egg has an important defense system based on the shell (physical barrier), on particular physicochemical properties (alkaline pH and viscosity of the egg white) and on the presence of '' an arsenal of antimicrobial proteins, the best known of which are lysozyme and ovotransferrin.
- egg white lysozyme is an antimicrobial protein currently used as a food preservative and as an active ingredient in several drugs.
- AvBDll (formerly Vitellin Membrane Outer rent protein II (or VMO-II) (Kido et al, 1992, Biochem J, 286, 17-22; Xiao et al, 2004, BMC Genomics, 5, 56) is part of the b-defensins avian or gallinacins (Harwig et al, 1994, FEBS Lett, 342, 281-285; Sugiarto et al, 2004, Biochem Biphys Res Commun, 323, 721-727).
- Defensins are antimicrobial peptides (2-5 kDa) from innate immunity, usually cationic. three-dimensional structure is organized in sheet b and has 3 disulfide bridges.
- Mammalian defensins are grouped into 3 subfamilies: alpha, beta and theta-defensins (Ganz, 2003, Nat Rev Immunol, 3, 710-720). Membership in these different subfamilies is determined by the three-dimensional structure, the distribution of cysteines and the pairing of the latter in the formation of disulfide bridges.
- defensins of family b classified into 2 subgroups, are found: ovodefensins (such as galline) and avian b-defensins (AvBD) of which AvBDll is a part (Van Dijk et al, 2008, Vet Immunol Immunopathol, 124, 1-18; Whenham et al, 2015, Biol Reprod, 92, 154).
- ovodefensins such as galline
- AvBD avian b-defensins
- Gallus gallus AvBDll has antimicrobial activities against Gram positive and negative bacteria such as Salmonella enterica serovar Enteritidis, Listeria monocytogenes and Staphyiococcus aureus (Hervé-Gr tonet et al, 2010, Antimicrob Agents Chemother, 54, 4401- 4409).
- AvBDll has a primary defensin sequence still absent in mammals. Its peptide sequence (82 amino acids, 9.28 kDa) is indeed longer than the other defensins due to the presence of 2 "b-defensin" motifs (ie 6 disulfide bridges).
- the C-terminal part could include the biologically active part of this b-defensin since it has a sequence identity of 27% with the corresponding region of b - human defensin 3.
- chicken avian b-defensin 11 initially described as antibacterial also has an antiparasitic, antiviral, anti-invasive and cytotoxic effect.
- the antibacterial activity of the N-terminal domain was demonstrated for both chicken b-defensin 11 (Gallus gallus) and cane b-defensin 11 (Anas platyrhynchos).
- a peptide derived from the N-terminal part retains these effects observed on the whole protein while a peptide derived from the C-terminal part has no effect or a much weaker effect.
- the peptide derived from the N-terminal part is devoid of the cytotoxic effect which has been observed for whole avian b-defensin 11.
- the present invention relates to a peptide molecule or a composition comprising this peptide molecule for its use as a medicament, the peptide molecule comprising a sequence chosen from the following sequences:
- the peptide molecule comprising at most 50, 55 or 60 amino acids.
- the present invention relates to a peptide molecule comprising a sequence chosen from the following sequences:
- X is not a cysteine and is chosen in particular from the group consisting of Ala, Arg, Asp, Asn, Gin, Glu, Gly, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Trp, Tyr and Val.
- the peptide molecule comprises a sequence chosen from the following sequences:
- the peptide molecules comprise three disulfide bridges, in particular between the cysteines: C1-C5, C 2 -C 4 and C 3 -C 6 .
- the peptide molecule comprises, consists essentially of or consists of one of the following sequences:
- peptide molecule for its uses can also be chosen from the group consisting of LPRDTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCV (SEQ. ID NO 2) LSLPRDTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCV (SEQ ID NO 10)
- the present invention also relates to a peptide molecule as described above for its use as an antibacterial, antiparasitic and / or anti-invasive agent.
- the peptide molecule for its use as a medicament is intended to be used in combination with another compound of therapeutic interest.
- the present invention also relates to a pharmaceutical or veterinary composition comprising a peptide molecule as described above, and optionally another compound of therapeutic interest. It also relates to this pharmaceutical or veterinary composition for its use for the treatment or prevention of a bacterial infection, the treatment or prevention of an infection by a parasite or for the treatment of cancer, in particular for its use to treat or prevent coccidiosis, the parasite being Eimeria.
- the present invention relates to the use of a peptide molecule as described above as a food preservative or as a food additive.
- FIG. 1 Protein sequences and isoelectric points of avian b-defensin 11 (AvBDll) from hens and the peptides AvBDll [1-40] and AvBDll [41-82].
- the protein precursor of AvBDll (Accession NP_001001779) is a protein of 104 amino acids.
- amino acid sequences of the N-terminal domain (AvBDll [1-40]) and of the C-terminal domain (AvBDll [41-82]), delimited by the exon-exon junction, have different charge properties with theoretical pl values of 9.34 and 6.88, respectively.
- FIG. 2A Dose effect of chicken AvBDll and the peptides AvBDll [1-40] and AvBDll [41-82] against Salmonella enterica Entendis ATCC 13076 and Listeria monocytogenes EGD. Antibacterial activities are visualized by the formation of an inhibition disc using the radial diffusion technique in agar medium. MSI-94 (antimicrobial peptide derived from magainin) is used as a positive control.
- Figure 2B Effect of heparin (0, 20, 100 ng / pL) on the antibacterial activity of chicken AvBDll and of the peptides AvBDll [1-40] and AvBDll [41-82], used at 12 mM, against Salmonella enterica Enteritidis ATCC 13076 and Listeria monocytogenes EGD.
- Figure 3A Observation by scanning electron microscopy of parasites after 1 h of incubation with PBS (control) or 10 ⁇ M of hen AvBDll. The scale bar represents 2 pm.
- Figure 3B Percentage viability of parasites, after incubation with peptides at different concentrations. The data presented are the means ⁇ SEM of three independent experiments. Nter: AvBDll [1-40]; Cter: AvBDll [41-82]; Nter + Cter: AvBDll [1-40] + AvBDll [41-82].
- Figure 3C The antiparasitic activity of hen AvBDll at 10 pM is abolished in the presence of heparin at 100 pg / mL.
- Figure 4A Relative ATP production in uninfected CLEC213 cells or infected cells in response to treatments with different concentrations of chicken AvBDll and the peptides AvBDll [1-40], AvBDll [41-82] or AvBDll [l -40] + AvBDll [41-82], The values of relative ATP production were calculated for the (un) infected cells and treated compared to the values of the average RLU (luminescence signals) obtained for the controls (cells not processed).
- FIG. 5 Effect of chicken AvBDll and the peptides AvBDll [1-40] and AvBDll [41-82]) on the invasion and viability of NCI-H460 cells (cell line derived from non-human pulmonary carcinoma with small cells).
- the invasion and viability results were analyzed after 48 hours of incubation. They are expressed as a percentage of invasion or viability of the cells incubated with AvBDll or the peptides, compared to that of the control cells.
- the results represent the median ⁇ 1st quartile / 3rd quartile of at least 5 independent experiments, each being carried out at least in duplicate.
- the Kruskal-Wallis and Dunn test was used to compare the results of cells treated with different concentrations of molecules compared to those of control cells.
- the Mann Whitney test was used to compare the invasion and viability results obtained for the same concentration of molecule tested. * p ⁇ 0.05; ** p ⁇ 0.01; *** p ⁇ 0.0001; **** p ⁇
- Figure 6 Effect of co-incubation of unfractionated heparin with 6 mM chicken AvBDll or AvBDll peptide [1-40] (N) on the invasion and viability of non-small cell lung tumor cells NCI-H460.
- the results of invasion (dark color) and MTS test (viability) (light color) were analyzed after 48 hours of incubation. They represent the median ⁇ 1st quartile / 3rd quartile of 3 independent experiments, each being carried out in duplicate.
- the Kruskal-Wallis and Dunn test was used to compare the results of cells treated with different concentrations of molecules compared to those of control cells.
- the Mann Whitney test was used to compare the invasion and viability results obtained for the same concentration of molecule tested.
- peptide oligopeptide
- polypeptide polypeptide
- protein protein
- amino acid refers to the 20 natural standard amino acid residues (G, P, A, V, L, I, M, C, F, Y, W, H, K, R, Q., N, E, D, S and T), to rare natural amino acid residues (e.g. hydroxyproline, hydroxylysine, allohydroxylysine, 6- N-methylysine, N-ethylglycine, N-methylglycine, N-ethylasparagine, allo-isoleucine, N-methylisoleucine, N-methylvaline or aminobutyric acid) and non-natural amino acids (for example norleucine , norvaline and cyclohexyl-alanine).
- this term refers to the 20 natural standard amino acid residues (G, P, A, V, L, I, M, C, F, Y, W, H, K, R, Q, N, E , D, S and T).
- substitution designates the replacement of one amino acid residue with another chosen from among 20 natural standard amino acid residues, rare natural amino acid residues and amino acid residues unnatural.
- substitution refers to the replacement of an amino acid residue with another chosen from among the 20 natural standard amino acid residues (G, P, A, V, L, I, M, C , F, Y, W, H, K, R, Q., N, E, D, S and T).
- the substitution (s) can be conservative or non-conservative substitutions.
- substitution refers to a substitution of an amino acid residue by another which has similar chemical or physical properties (size, charge or polarity). Examples of conservative substitutions are presented in the following tables.
- the peptide may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 additional amino acids at the N end and / or C-terminal, preferably 1, 2, 3, 4 or 5 additional amino acids, and / or 1, 2 or 3 substitutions, deletions, additions, or a mixture of these.
- the number of substitutions, additions, deletions or a mixture thereof depends on the length of the sequence. For example, the percentage of substitutions, deletions, additions or a mixture thereof may not exceed 30%, preferably not more than 25%.
- substitution refers to the exchange of one amino acid with another in a peptide sequence
- deletion refers to the elimination of a single amino acid from a peptide sequence
- insertion or “addition” is equivalent and refers to the addition of a single amino acid in a peptide sequence.
- sequence identity refers to the number (%) of matches (identical amino acid residues) at positions from an alignment of two polypeptide sequences. Sequence identity is determined by comparing the sequences when they are aligned to maximize overlap and identity while minimizing sequence interruptions. In particular, the sequence identity can be determined using any of the many global or local alignment algorithms, depending on the length of the two sequences. Sequences of similar length are preferably aligned using global alignment algorithms (eg Needleman & Wunsch, J. Mol.
- Biol 48: 443, 1970 which optimally align the sequences over the entire length, while sequences lengths substantially preferably different are aligned using a local alignment algorithm, for example the Smith and Waterman algorithm (Smith and Waterman, Adv. Appl. Math. 2: 482, 1981) or the AltschuI algorithm (Altschul and al (1997) Nucleic Acids Res. 25: 3389-3402; Altschul et al (2005) FEBS J. 272: 5101-5109). Alignment for the purpose of determining the percentage of amino acid sequence identity can be carried out by any method known to those skilled in the art, for example using software available on Internet sites such as http: // blast.ncbi.nlm.
- treatment includes preventive, curative, palliative treatment, as well as the management of subjects (reduction of suffering, improvement of lifespan, slowing down of the progression of the disease, reduction in tumor growth, reduction in tumor size, prevention or reduction of metastases and relapses etc.).
- terapéuticaally effective amount refers to an amount which results in an improvement in the condition of an organ or subject, or in a decrease in disease, disorder or symptoms of the disease or disorder in question.
- a "pharmaceutical composition” means a preparation of one or more of the active agents with other optional chemical components such as physiologically suitable carriers and / or excipients.
- the purpose of a pharmaceutical composition is to facilitate the administration of the active agent to an organism.
- the compositions of the present invention may be in a form suitable for any route of administration or conventional use.
- the pharmaceutical composition according to the invention includes the pharmaceutical compositions used in human medicine and the pharmaceutical compositions used in animal medicine, that is to say the veterinary compositions.
- the pharmaceutical composition further comprises a pharmaceutically acceptable vehicle.
- the terms “pharmaceutically acceptable carrier” or “pharmaceutically acceptable excipient” or “pharmaceutically acceptable carrier” are interchangeable and include any compounds or combinations of compounds which are known to those skilled in the art as being useful in the formulation of pharmaceutical or veterinary compositions.
- physiologically acceptable or “pharmaceutically acceptable” means any medium or additive which does not interfere with the effectiveness of the biological activity of the active principle (here, the peptide molecules), and which is not excessively toxic to the patient or subject, at the concentrations to which it is administered and / or which do not produce an adverse reaction when administered to a human or animal.
- a physiologically acceptable vehicle, carrier or excipient may be suitable for administration to humans and / or animals (particularly mammals).
- the present application therefore relates to a peptide derived from the N-terminal part of an avian b-defensin 11.
- This peptide or peptide molecule comprises, consists essentially of or consists of the following consensus sequence:
- X is any amino acid, different or identical, preferably excluding a cysteine.
- X can be chosen from the group consisting of Ala, Arg, Asp, Asn, Gin, Glu, Gly, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Trp, Tyr and Val.
- the peptide or peptide molecule comprises, consists essentially of or consists of the following consensus sequence:
- X is any amino acid, different or identical, preferably excluding a cysteine.
- X can be chosen from the group consisting of Ala, Arg, Asp, Asn, Gin, Glu, Gly, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Trp, Tyr and Val.
- the peptide or peptide molecule can comprise, consist essentially of or consist of the following consensus sequence: XXXDTXXC1XXXXGXC2XXXXXC3PXPFXXFGTC4XXXXXTC5C6X (SEQ ID NO 6) in which X is any amino acid, different or identical, preferably excluding a cysteine.
- X can be chosen from the group consisting of Ala, Arg, Asp, Asn, Gin, Glu, Gly, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Trp, Tyr and Val.
- the peptide or peptide molecule comprises, consists essentially of or consists of one of the following sequences:
- the peptide or peptide molecule can comprise 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 conservative substitutions, these substitutions not relating to cysteines. Preferably, these substitutions do not relate to the amino acid residues defined in the sequences of SEQ ID NOs 4-6.
- the peptide does not consist of the sequences
- the peptide or peptide molecule comprises, consists essentially of or consists of one of the following sequences:
- the peptide or peptide molecule comprises, consists essentially of or consists of one of the following sequences:
- the peptide or peptide molecule comprises, consists essentially of or consists of one of the following sequences:
- the peptide or peptide molecule comprises three disulfide bridges formed by the six cysteines Ci, C 2 , C 3 , C 4 , Cs and C 6 of the peptide. More particularly, the disulphide bridges are the following: C 1 -C 5 , C 2 -C 4 and C 3 -C 6 .
- a Ci-Cs disulfide bridge is meant a disulfide bridge between cysteine Ci and cysteine C 5 , etc.
- the peptide or peptide molecule according to the present invention can consist of one of the sequences SEQ ID NOs 10-11.
- the peptide or peptide molecule comprises at most 70, 65, 60, 55, 50 or 45 amino acids.
- the peptide used according to the invention preferably has a size of between 30 and 100 amino acids, more particularly preferably between 30 and 70 amino acids, and even more particularly preferably between 30 and 60, between 30 and 55 , between 30 and 50 or between 30 and 45 amino acids.
- the peptide used according to the invention has a size of 30 to 45 amino acids.
- the peptide molecule can further comprise other peptide sequences, on the N-terminal or C-terminal side.
- the peptide can also comprise, in N-terminal or C-terminal, a tag (or label) useful for the purification or the immobilization of the peptide.
- tags are well known to those skilled in the art and include, for example, the tags histidine (Hise), FLAG, HA (epitope derived from the hemagglutinin of the influenza virus), MYC (epitope derived from the human proto oncoprotein MYC ) or GST (glutathione-S-transferase).
- the peptide can comprise a site for cleavage by a protease or a chemical agent making it possible to remove this tag.
- the peptide may also include an element facilitating cell penetration of the molecule.
- this element is a peptide facilitating cell penetration of the molecule (element CPP).
- CPP a peptide facilitating cell penetration of the molecule
- the peptide facilitating cell penetration can be chosen by the group consisting of a Tat peptide, an antenapedia or penetatin peptide, and a peptide rich in arginine and lysine, preferably rich in arginine , in particular a peptide comprising at least 9 arginine residues.
- the peptide bond (s) of the peptide molecule according to the present invention can be modified to make them resistant to proteolysis.
- all peptide bonds can be replaced.
- the peptide molecule can comprise either a C terminal carboxylic (-COO) or amidated (-CONH2) end.
- the peptide can also be optionally modified at its N-terminal end, for example by an acetyl radical.
- the L and D isomers of amino acids are envisaged.
- the D isomers are not sensitive to proteases and the present invention also includes molecules comprising D amino acids, in particular molecules comprising only or essentially D amino acids.
- the amino acids L are preferred.
- the invention also relates to the salts of said peptide and their uses, preferably of pharmaceutically or veterinary acceptable salts.
- Salt acceptable on the plan pharmaceutical or veterinary is a salt which does not present any notable toxicity, at the dose where it is used.
- the salts can be, for example, the salts with acceptable mineral acids such as hydrochloric acid, hydrobromic acid, sulfuric acid and phosphoric acid; salts with acceptable organic acids such as acetic acid, citric acid, maleic acid, malic acid, succinic acid, ascorbic acid and tartaric acid; salts with acceptable mineral bases such as sodium, potassium, calcium, magnesium or ammonium salts; or salts with organic bases which have salifiable nitrogen.
- the salt is an ammonium sulfate. These salts are commonly used and their preparation methods are well known to those skilled in the art.
- the present invention also relates to a pharmaceutical or veterinary composition
- a pharmaceutical or veterinary composition comprising a peptide or a peptide molecule as described above.
- the pharmaceutical or veterinary composition may comprise a pharmaceutically acceptable carrier.
- the present invention also relates to new uses of an avian defensin 11 as described below, in particular as an antiparasitic agent, as an antiviral agent, as an anti-invasive agent and in as a cytotoxic agent.
- an avian defensin 11 as described below, in particular as an antiparasitic agent, as an antiviral agent, as an anti-invasive agent and in as a cytotoxic agent.
- AvBDll will be referred here to 11 avian defensins as described below in this section.
- Avian b defensin 11 can comprise, consist essentially of or consist of one of the sequences as described below:
- X can be chosen from the group consisting of Ala, Arg, Asp, Asn, Gin, Glu, Gly, His, Ile, Leu, Lys, Met, Phe, Pro, Ser, Thr, Trp, Tyr and Val.
- avian b defensin 11 can comprise, consist essentially of or consist of one of the sequences as described below:
- the peptide or peptide molecule can comprise 1 to 20 conservative substitutions, preferably 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 conservative substitutions, these substitutions not relating to cysteines. Preferably, these substitutions do not relate to the amino acid residues defined in the sequences of SEQ ID NOs 14-19.
- avian defensin b can have the sequence of a defensin as described in table 4 below or a sequence having at least 70, 75, 80, 85, 90 or 95% identity with one of these, preferably with the mature sequence thereof.
- b defensin 11 is mature, i.e. without the signal peptide.
- avian b defensin 11 has a sequence having at least 70, 75, 80, 85, 90 or 95% identity with one of the defensins described in table 4, preferably with the mature sequence thereof. , and includes a sequence chosen from SEQ ID NOs 14-19.
- avian b defensin 11 comprises, consists essentially of or consists of the sequence SEQ ID NO 1. In another particular embodiment, avian b defensin 11 comprises, consists essentially of or consists of the sequence SEQ ID NO 20.
- avian b defensin 11 comprises six disulfide bridges formed by the cysteines Ci, C 2 , C 3 , C 4 , Cs, C 6 , C 7 , Cs, Cg, Cio, Cn and C12. More in particular, the disulfide bridges are the following: C 1 -C 5 , C 2 -C 4 , C 3 -C 6 , C 7 -C 11 , Cs-Cio and C 9 - C12.
- Avian b defensin 11 can include modifications similar to those described above for peptides.
- the peptide molecules as described above are useful as an antibacterial agent.
- the present invention relates to peptide molecules as described above for their use for treating or preventing infection by a bacterium, to the use of peptide molecules as described above for the manufacture of a medicament intended treating or preventing infection with a bacterium, and a method of treating infection with a bacterium comprising administering a therapeutically effective amount of peptide molecules.
- the bacteria can be Gram positive or Gram negative.
- Gram-positive bacteria can belong to the genus Staphylococcus like 5. aureus, 5. epidermidis, S. saprophiticus, S. lugdunensis, S haemolyticus, S warneri, S schleiferi and 5 intermedius, to the genus Streptococcus like 5.
- pyogenes 5. agalactiae , S. dysgalactiae, S. bovis, S. anginosus, 5. sanguinis, 5. suis, S. mitis, 5. mutans, S. pneumonia and 5. oralis, to the genus Enterococcus like E. faecium, E.
- Gram-positive bacteria are bacteria of the Listeriaceae family such as a bacterium of the genus Brochothrix or Listeria typically, chosen from Listeria monocytogenes, Listeria innocua, Listeria ivanovii subsp. ivanovii, Listeria ivanovii subsp. londoniensis, Listeria grayi, Listeria seeligeri and Listeria welshimeri, preferably Listeria monocytogenes.
- the peptide molecules as described above are useful for the treatment of listeriosis.
- Gram-negative bacteria can be enterobacteria chosen from bacteria of the genera Escherichia, Shigella, Salmonella, Klebsiella, Enterobacter, Providencia, Morganella, Citrobacter, Hafnia and Yersinia. They can also be chosen from bacteria of the genera Pseudomonas, Acinetobacter, Stenotrophomonas, Burkholderia, and Alcaligenes, in particular Pseudomonas aeruginosa, Acinetobacter baumannii, Stenotrophomonas maltophilia, Burkholderia cepacia, and Alcaligenes xylosoxydans.
- Gram negative bacteria can be salmonella.
- the bacteria can be chosen from 5. Typhi (Eberth bacillus), 5. Paratyphi A, 5. Paratyphi B (Schotmüller's bacillus), 5. Paratyphi C (Hirschfeld bacillus), and 5. Sendai.
- the bacterium can also be any bacterium of the salmonella family such as Salmonella bongori, Salmonella enterica, Salmonella enterica arizonae, Salmonella enterica diarizonae, Salmonella enterica enterica, Salmonella enterica houtenae, Salmonella enterica indica, Salmonella enterica salamae or Salmonella subterranea.
- the peptide molecules as described above are useful for the treatment of typhoid fever, paratyphoid fever and salmonellosis.
- the bacteria can also be Escherichia coli.
- the peptide molecule can be used alone or in combination with another therapeutic agent, in particular one or more antibiotics.
- the peptide molecules as described above and / or the AvBD11s as described above are useful as an antiparasitic agent.
- the present invention relates to peptide molecules and / or AvBDll as described above for their use for treating or preventing infection by a parasite, to the use of peptide molecules and / or AvBDll as described above for the manufacture of a medicament for treating or preventing a parasite infection, and to a method of treating a parasite infection comprising administering a therapeutically effective amount of peptide molecules and / or AvBDll such as described above.
- the parasite can in particular be Eimeria.
- This parasite is known to cause coccidiosis, which can cause significant damage in farms. In particular, birds or poultry, rabbits, calves, cats and dogs and goats are concerned.
- the parasite may belong to the Eimeria tenella, Eimeria acervulina, or Eimeria maxima subclasses.
- the peptide and / or AvBDll molecules as described above can be used in combination with other therapeutic agents, in particular known treatments or vaccinations against coccidiosis, in particular those caused by Eimeria such as Eimeria tenella, Eimeria acervulina, or Eimeria maxima, for example coccidiosis drugs, prebiotics, probiotics, natural compounds and combinations thereof.
- the peptide molecules as described above and / or the AvBDlls as described above are useful as an anti-invasive agent.
- the present invention relates to peptide molecules and / or AvBDll as described above for their use for treating cancer, in particular by an anti-invasive effect, to the use of peptide molecules and / or AvBDll as described above for the manufacture of a medicament intended to treat cancer, in particular by an anti-invasive effect, and to a method of treatment of cancer, in particular by an anti-invasive effect, comprising the administration of an amount effective therapeutic of peptide molecules and / or AvBDll as described above.
- the peptide and / or AvBDll molecules as described above can be used to prevent or slow down metastases from cancer.
- AvBDlls as described above are useful as a cytotoxic agent. They are therefore of interest in the treatment of cancer.
- the cancer can be solid or hematopoietic cancer.
- the cancer can be sarcoma, carcinoma, or hematopoietic cancer.
- cancer is cancer associated with an ability to form metastases.
- the molecule can be used to treat lung, breast, colon, kidney, prostate, cervical cancer and melanoma.
- AvBDlls as described above are useful as an antiviral agent.
- the present invention relates to AvBDlls as described above for their use for treating or preventing infection by a virus, to the use of AvBDlls as described above for the manufacture of a medicament intended to treat or prevent virus infection, and a method of treating virus infection, comprising administering a therapeutically effective amount of AvBDlls as described above.
- the virus is the influenza virus, preferably subtype A, especially the bird flu virus.
- the virus can be a virus chosen from H1N1, H5N1, H7N3, H7N7, H7N9, H9N2 and H10N8.
- AvBDlls can be used alone or in combination with other therapeutic agents, especially other antiviral agents.
- the subject to be treated is an animal.
- the animal is a farm animal or a pet.
- the farm animal is a cattle, a sheep, a goat, an equine, a pig or a poultry.
- poultry can be a hen, a chicken, an ostrich, a duck, a turkey, a quail, a pheasant, a guinea fowl, or a goose.
- the subject to be treated is a human.
- a composition according to the invention can be in any form suitable for administration, for example in the form of tablets, tablets, lozenges, dragees, capsules, capsules, pills, aggregates , powder, suspensions, emulsions, syrups, ointments, ampoule of liquid, bottle fitted with a dropper and other similar forms of liquid or powder preparations intended to be taken in small measured units, injectable solutions or suppositories.
- the molecules or compositions according to the invention can be administered in different ways and in different forms.
- they can be administered systemically, orally, by inhalation or by injection, such as for example by intravenous, intramuscular, subcutaneous, trans-dermal, intra-arterial, etc. routes, intravenous routes, intramuscular, subcutaneous, oral and inhalation are preferred.
- the molecules are generally packaged in the form of liquid suspensions, which can be injected using syringes or infusions, for example.
- the molecules are generally dissolved in saline, physiological, isotonic, buffered solutions, etc., compatible with pharmaceutical use and known to those skilled in the art.
- the compositions can contain one or more agents, supports or vehicles chosen from dispersants, solubilizers, stabilizers, preservatives, etc.
- the flow rate and / or the dose of peptide, peptide molecule or AvBDll can be adapted by a person skilled in the art depending on the subject, the pathology concerned, the mode of administration, etc.
- the molecules are administered in doses which can vary between 1 pg and 1000 mg / kg of body weight, more generally from 10 pg to 100 mg / kg, typically between 1 mg and 20 mg / kg.
- repeated injections can be given, if necessary.
- the peptide molecules described above can also be used in fields other than the pharmaceutical or veterinary field, in particular on the basis of their antibacterial, antiparasitic, antiviral, anti-invasive and / or cytotoxic properties against cancer cells.
- they can be used in the food industry as a preservative or as a food additive to increase the added value of a food ("functional food").
- the present invention relates to a method of preparing a food composition comprising the addition of a peptide molecule to the food composition.
- This food composition can have the advantage of improving the well-being of the subject, animal or man, in particular by preventing or reducing bacterial, parasitic, and / or viral infections or by reducing the incidence of cancers.
- the examples illustrate the present invention and are not intended to limit it.
- AvBDll is an atypical defensin predicted to have two defensin-like domains. Its abnormally long size (82 amino acids) and the number of cysteines (12) twice as large as most of the defensins encountered in nature initially suggested this two-domain structure.
- two synthetic peptides (Gga-AvBDll [1-40d and Gga-AvBDll [41-82j) representative of each domain were synthesized (Table 5).
- the boundary between the 2 areas has been set at the level of exon-exon junction identified on the basis of the data available in Ensembl and NCBI ( Figure 1).
- the disulfide bridges of each peptide were formed by oxidative folding.
- the peptide AvBDll [1-40] has the particularity of being amidated at its C-terminal end.
- the purity and the mass of the peptides were verified by HPLC and mass spectrometry.
- the structure and pairing of the disulfide bridges have been validated by RM N 3D (unpublished data generated by the Center for Molecular Biophysics: C. Landon, H. Meudal, K. Loth).
- the antibacterial activity of the peptides Gga-AvBDll [1-40] and Gga-AvBDll [41-82] was tested using the radial diffusion technique against two bacteria responsible for food-borne infections, Listeria monocytogenes (Gram +) and Salmonella enterica Enteritidis (Gram-), previously used to characterize the antibacterial activity of native Gga-AvBDll (Hervé-Gr tonet et al. 2010, supra).
- the results show that the peptide Gga-AvBDll [1-40] is active against the two bacteria (FIG. 2A) with CM I values similar or lower than MSI-94 (positive control) (Table 6).
- the peptide Gga-AvBDll [41- 82] does not seem to be active: no activity was detected at the maximum concentration of 30 mM (Figure 2A). The latter also has no effect (inhibitor or potentiator) on Gga-AvBDll [1-40] when the two peptides are used in combination ( Figure 2A, Table 6). These results therefore suggest that it is the N-terminal domain of Gga-AvBDll which carries the antibacterial activity, at least vis-à-vis these two pathogenic bacterial strains. The effect of the peptides was tested in the presence of heparin in order to evaluate the influence of the glycosaminoglycan on the antibacterial activity of the molecules.
- CM Minimum inhibitory concentrations
- Gga-AvBDll Gga-AvBDll [1-40], Gga-AvBDll [41-82]
- the CM I are determined using the agar radial diffusion test.
- MSI-94 antiimicrobial peptide derived from magainin is used as a positive control.
- the antiparasitic activity of native Gga-AvBDll and of each synthetic peptide derived from Gga-AvBDll [1-40] and Gga-AvBDll [41-82] was evaluated under acellular conditions, against parasites of Eimeria tenella which express the fluorescence marker YFP.
- the percentage of parasite viability obtained for each peptide is indicated in FIG. 3.
- Significant antiparasitic activity is observed for whole Gga-AvBDll and for the peptide Gga-AvBDll [1-40] (at p ⁇ 0.01 and p ⁇ 0.05, respectively), with a dose-dependent effect.
- Gga-AvBDll exhibits clear antiviral activity at concentrations 3 2.5 iM
- the anti-invasive effect of the protein at concentrations of 4, 6 and 8 mM is significantly greater than that altering cell viability.
- incubation of the cells with the peptide Gga-AvBDll [1-40] induces a reduction in the invasion of NCI-H460 cells from 2 mM without modification of the cell viability.
- the peptide Gga-AvBDll [41-82] has very little effect on the invasion and the viability of NCI-H460 cells.
- the two peptides were incubated together with the cells, anti-invasive and cytotoxic properties are found, but with less intensity than those observed with the whole Gga-AvBDll protein.
- Examples 1-5 were carried out with hen AvBD11 and the N- and C-terminal fragments thereof. The inventors then studied the potential of cane AvBDll Anas platyrhynchos (Accession N ° XP_005028303.2). Table 7. Sequences of synthetic peptides derived from cane AvBDll
- cane AvBDll cane AvBDll
- the native protein and its derived peptides (Apl-AvBDll [1-40] and Apl-AvBDll [41-82]) were tested on 4 bacteria: two Gram positive bacteria (Listeria monocytogenes and Staphylococcus aureus) and two Gram negative bacteria (Salmonella enterica Enteritidis and Escherichia coli).
- the antibacterial activities were evaluated by the method of radial agar diffusion (Lehrer method) where the activity is detected by the presence of a halo of inhibition of bacterial growth.
- the activity of Apl-AvBDll was compared to chicken AvBDll (Gga-AvBDll).
- the two synthetic domains corresponding to the “beta-defensin” motifs of each molecule were also tested, alone or in combination. All molecules were tested at different concentrations (30; 12; 4.8; 1.92; 0.768 and 0.3072 mM) to determine the minimum inhibitory concentrations (MIC).
- MIC minimum inhibitory concentrations
- MSI-94 A broad spectrum antimain microbial peptide derived from magainin, MSI-94, was used as a positive control.
- the MICs obtained for each molecule are reported in Table 8. The results show that the two native proteins, Apl-AvBDll and Gga-AvBDll, are active against the 4 bacteria tested. The MIC values are less than 0.5 pM for Listeria monocytogenes, Salmonella enterica Enteritidis and E coli.
- the peptide syntheses on solid support were carried out according to the Fmoc strategy using a Prelude synthesizer (Protein Technologies), on a scale of 25 pmol, on a Tentagel R NH 2 resin.
- Standard side chain protecting groups were used: Arg (Pbf), Asp (OtBu), Cys (Trt), Glu (OtBu), Gln (Trt), His (Trt), Lys (Boc), Ser (tBu) , Thr (tBu), Trp (Boc) and Tyr (tBu).
- the resin was treated with a TFA / H 2 0 // Pr 3 SiH / phenol mixture (88: 5: 2: 5) for 2 h, then the peptide was precipitated by dilution ( ⁇ 10) in a 1: 1 ether mixture diethyl / petroleum ether cooled to 0 ° C, collected by centrifugation, then washed three times with diethyl ether and dried under reduced pressure.
- ESI-HRMS High resolution ESI-MS mass spectrometry analyzes
- ESI-HRMS Q.-TOF maXis mass spectrometer
- the multi-loaded envelope was deconvoluted using Bruker Data Analysis 4.1 software.
- MALDI-TOF analyzes were performed in reflectron mode on an Autoflex instrument (Bruker Daltonics) using a-cyano-4-hydroxycinnamic acid as a matrix.
- the theoretical and experimental values of [M] or [M + H] + correspond to the monoisotopic species.
- HPLC analyzes were performed using a Chromolith HR RP-18e column (150 A, 10 x 4.6 mm, flow rate of 3 mL / min) or a Jupiter C4 column (300 ⁇ , 5 pm, 250 x 4.6 mm, flow rate of 1 mL / min).
- HPLC purifications were performed using a Nucleosil C18 column (300 ⁇ , 5 ⁇ m, 250 x 10 mm, flow rate of 3 mL / min).
- Solvents A and B were 0.1% TFA in H 2 0 and 0.1% TFA in MeCN, respectively.
- AvBDll [1-40] (cysteines with their free thiol functions) was synthesized according to the general protocol of Fmoc-SPPS, using a linker of the Rink amide type incorporated in the form of Fmoc-Rink-OH.
- AvBDll [41-82] was synthesized according to the general protocol of Fmoc-SPPS, using a Wang type linker, incorporated by the coupling of Fmoc- 82 lle- (4-oxymethylphenoxypropionic acid) (Fmoc-lle -mppa-OH).
- AvBDll [1-40] (cysteines with their free thiol functions) was synthesized according to the general protocol of Fmoc-SPPS, using a linker of the Rink amide type incorporated in the form of Fmoc-Rink-OH.
- AvBDll [41-82] (cysteines with their free thiol functions) was synthesized according to the general protocol of Fmoc-SPPS, using a Wang resin pre-grafted with a methionine.
- Antibacterial activities were measured according to the radial diffusion technique described by Lehrer et al (J Immunol Methods, 1991, 137 (2), 167-73) and used previously for the antibacterial characterization of native AvBDll (Hervé-Gr tonet and al 2010).
- the bacteria are grown in Brain Heart Infusion (Listeria monocytogenes) or Tryptical Soy Broth (Salmonella enterica serovar Enteritidis ATCC 13076, Escherichia coli ATCC 25922, Staphylococcus aureus ATCC 29740) media with shaking (180 rpm) at 37 ° C until in the exponential phase, then washed once in cold 10 mM sodium phosphate buffer (pH 7.4) then taken up in a small volume of this same buffer.
- a volume containing 7.5 x 10 6 CFU (Colony-forming Unit) is introduced into an agar medium poor in nutrients (10 mM sodium phosphate buffer, pH 7.4, containing 0.03% [weight / volume] of TSB, 1% [weight / volume] of agarose of low electro-endosmosis [Sigma-Aldrich, St Quentin Fallavier, France] and 0.02% of Tween-20) maintained in supercooling.
- This medium, containing the bacteria is then poured into a petri dish to form a uniform layer about 1 mm thick. Thirty-six wells of 2.75 mm in diameter, evenly spaced, are dug in the agar using a cookie cutter.
- a solution containing the molecules to be tested (AvBDll, AvBDll [1-40], AvBDll [41-82]) at different concentrations (0 - 0.3072 - 0.768 - 1.92 - 4.8 - 12 - 30 ⁇ M in ultrapure water) are added to each well, then the petri dish is incubated for 3 h at 37 ° C. in order to allow the molecules to diffuse / act.
- the agar containing the bacteria is then covered with a nutrient-rich agar (10 mM sodium phosphate buffer, pH 7.4, containing 6% [weight / volume] of TSB and 1% [weight / volume] of low agarose.
- MSI-94 a variant of magainin with a broad antimicrobial spectrum, is used as a positive control.
- the protein AvBDll purified from chicken egg (Gga-AvBDll) and its peptides derived Gga-AvBDll [1-40] and Gga-AvBDll [41-82] (alone or combined) ) have been tested on two different bacterial strains: Salmonella enterica serovar Enteritidis ATCC 13076 (Gram-) and Listeria monocytogenes EGD (Gram +). These two strains were supplied by the International Center for Microbial Resources - Pathogenic Bacteria (INRA, ISP, Nouzilly, France). For each bacterial strain, at least four identical independent measurements of the antibacterial activity were carried out.
- heparin The effect of heparin on the antibacterial activity of chicken AvBDll and Gga-AvBDll [1-40] and Gga-AvBDll [41-82] derived peptides (alone or in combination) was tested using molecules at a final concentration of 12 mM in the presence of heparin (H3149, Sigma-Aldrich, St Quentin Fallavier, France) at 0, 20 and 100 ng / pL in TBS buffer (50 mM Tris- HCl, 150 mM NaCl, pH 7.4). The samples were analyzed as previously against Listeria monocytogenes and Salmonella enterica Enteritidis.
- the Et-YFP strain is a recombinant strain, stably expressing the fluorescence marker YFP (Yellow Fluorescent Protein) (Gras et al, 2014, Eukaryot Cell, 13, 884-895).
- the parasites (5.10 5 ) suspended in 20 ⁇ L of a 10 mM phosphate-buffered saline solution (PBS), pH 7.4 containing Gga-AvBDll, the peptide Gga-AvBDll [1-40], the peptide Gga-AvBDll [41-82] or the 2 peptides in a mixture (final concentration of 0, 1.25, 2.5, 5, 10 ⁇ M) were incubated for 1 h at 41 ° C. (temperature corresponding to the body temperature of the chicken and the hen). At the end of the incubation, the viability of the parasites was evaluated by staining with aqueous Evans blue (vol / vol).
- PBS phosphate-buffered saline solution
- the living (green) and dead (red) parasites were counted using a Zeiss Axiovert 200 microscope. The results are expressed as a percentage of viability relative to the parasites incubated in PBS alone. The results represent the average of 2 technical replicates carried out in 3 independent experiments. Competition with heparin was carried out for whole AvBDll (Gga-AvBDll) at 10 pM, in the presence of heparin at 100 pg / ml, under the conditions described above. Two independent experiments with 2 replicates per condition were carried out.
- the parasites were fixed for 24 h in 4% paraformaldehyde, 1% glutaraldehyde in 0.1 M phosphate buffer (pH 7.2). They were then washed in PBS and post-fixed by incubation with 2% osmium tetroxide for 1 h. The samples were then completely dehydrated in a graduated series of ethanol solutions and dried in hexamethyldisilazane (HMDS, Sigma, St. Louis, MO, USA). The parasites were observed using a Zeiss Ultra plus FEG-SEM scanning electron microscope (Oberkochen, Germany) at the IBiSA Platform for Electronic Microscopy (Institut Rabelais University of Tours, France). Antiviral effect
- Gga-AvBDll The antiviral activities of Gga-AvBDll, Gga-AvBDll [l-40], Gga-AvBDll [41-82] and Gga-AvBDll [l-40] + Gga-AvBDll [41-82] were tested in a d model avian influenza virus infection using a chicken pulmonary epithelial cell line (CLEC213) (Esnault et al., 2011, Virus Research, 159, 32-42).
- CLEC213 chicken pulmonary epithelial cell line
- CLEC213 cells were cultured in DMEM-F12 medium (Dulbecco's modified Eagle medium / Nutrient F-12 Ham) (Gibco) supplemented with 7.5% fetal calf serum (FCS), 100 U / ml of penicillin and 100 pg / ml streptomycin at 41 ° C and 5% C0 2 .
- FCS fetal calf serum
- the viral strain A / Mallard / Marquenterre / Z237 / 83 (H1N1-MZ) used for the infection experiments of CLEC213 cells was recovered by reverse genetics and amplified in MDCK cells (Madin Darby canine kidney) as described previously (Munier et al., 2010, J. Virol., 84, 940-952).
- the titer (PFU / ml) of the viral stock was determined by a standard plaque test in MDCK cells.
- the magnitude of the cytopathic effect induced by serial dilutions of the H1N1-MZ virus in CLEC213 cells was determined using the ToxGIo TM viral test (Promega), a luminescence test measuring GATR as a surrogate for viability. cell or viral cytopathogenicity (Noah et al., 2007, Antiviral Research, 73, 50-59).
- CLEC213 cells were seeded in 96-well plates (5 x 10 3 cells per well) and cultured for 16-18 h in complete medium at 41 ° C and 5% C0 2 .
- the cells were then washed with PBS and infected with 1/2 log dilutions of the viral stock in DMEM-F12 without SVF (8 wells per dilution). Uninfected control cells were coated with DMEM-F12 without SVF (8 wells).
- the cells were washed, covered with 100 ⁇ l of ATP Detection Reagent (Promega) and incubated for 20 min at room temperature.
- the luminescence signals (RLU - relative light units) were measured using a GloMax ® -Multi (Promega) detection system and the TCID50 (50% tissue culture infectious dose, i.e.
- the cells (6 wells per condition) were untreated (controls) or treated with 0.31-5.00 mM Gga-AvBDll, Gga-AvBDll [1-40], Gga-AvBDll [41-82] or Gga -AvBDll [l-40] + Gga-AvBDll [41-82] in DMEM-F12 medium and the values of luminescence were determined at 48 hours post-treatment (hpt).
- Relative ATP production values were calculated for the (un) infected and treated cells compared to the mean RLU values obtained for the controls (untreated cells).
- the effects of heparin treatment on the cytotoxic and / or antiviral activities of Gga-AvBDll were evaluated using the protocol described above, with the following modifications: Gga-AvBDll at a final concentration of 0.50 pM or 5.00 pM was co-incubated (15 min at room temperature) with 100 pg / ml (final concentration) of heparin (Sigma) dissolved in sterile water or with an equal volume of water (- heparin ) before being mixed with the H1N1-MZ virus or being added directly to the CLEC213 cells.
- NCI-H460 HTB-177TM bronchial tumor cells from a pleural effusion of non-small cell lung cancer were used to assess the anti-invasive capabilities of the whole protein Gga-AvBDll and synthetic peptides Gga -AvBDll [1-40] and Gga-AvBDll [41-82j.
- NCI-H460 cells were cultured in RPMI 1640 medium (Invitrogen, Cergy Pontoise, France) supplemented with 2 mM L-glutamine, 10 mM HEPES, 1 mM sodium pyruvate, 25 mM sodium bicarbonate, 2 mM glucose, 100 units / mL of penicillin, 100 pg / mL of streptomycin and 10% endotoxin-free fetal calf serum (SVF, Lonza, Basel, Switzerland). The culture flasks were placed at 37 ° C. in a humid atmosphere containing 5% of CO 2 . Culture supernatants were tested regularly to detect the presence of mycoplasmas (PlasmoTest mycoplasma detection kit, InvivoGen, Toulouse, France).
- the inserts were then placed in wells of a 24-well plate containing 700 ⁇ L of RPMI medium containing 10% of FCS used as chemoattractant. The plates were then incubated for 48 hours at 37 ° C. in a humid atmosphere containing 5% of CO 2 . The cells which migrated under the insert and those adhered to the surface of the well were detached using a solution of 0.05% trypsin / 0.02% EDTA and then counted using a hematimeter of Malassez. Two technical replicates were made for cells incubated with the different molecules and 3 replicates for control cells. The results are expressed as a percentage of invasion relative to the cells which have migrated in the absence of a molecule. The results represent the median +/- 1st quartile / 3rd quartile of 5 independent experiments.
- MTS cell viability test Cell viability was assessed using an MTS test (CelITiter 96 ® Aqueous One Solution Cell Proliferation Assay, Promega, Charbonippos, France).
- MTS test carried out in parallel with the invasion test, 10 4 NCI-H460 cells per well were deposited in a 96-well plate and cultured in 100 ⁇ L of medium without serum containing either Gga-AvBDll or the Gga-AvBDll peptide [1-40] or Gga-AvBDll [41-82], or the two peptides combined at a final concentration of 0, 2, 4, 6, 8 pM.
- the cells were then incubated for 1 hour with the MTS reagent and then the formation of formazan, proportional to the number of viable cells, was quantified by measuring the absorbance at 490 nm, following the instructions of the supplier. The median of the absorbances obtained with the cells alone corresponds to the reference value 100% of cell viability.
- Five independent experiments with 2 replicates per condition were carried out for the MTS tests carried out in parallel with the invasion.
- Three independent experiments with 8 replicates per condition were carried out for the MTS tests carried out in parallel with the quantification of cytokines.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Marine Sciences & Fisheries (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR1857411A FR3084887A1 (fr) | 2018-08-09 | 2018-08-09 | Peptides derives d'une beta-defensine 11 aviaire et leurs utilisations |
| PCT/EP2019/071388 WO2020030773A1 (fr) | 2018-08-09 | 2019-08-09 | Peptides derives d'une beta-defensine 11 aviaire et leurs utilisations |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP3833678A1 true EP3833678A1 (fr) | 2021-06-16 |
Family
ID=63896391
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP19758345.3A Withdrawn EP3833678A1 (fr) | 2018-08-09 | 2019-08-09 | Peptides derives d'une beta-defensine 11 aviaire et leurs utilisations |
Country Status (3)
| Country | Link |
|---|---|
| EP (1) | EP3833678A1 (fr) |
| FR (1) | FR3084887A1 (fr) |
| WO (1) | WO2020030773A1 (fr) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN107022549B (zh) * | 2017-04-19 | 2021-06-01 | 华中农业大学 | 黄颡鱼β防御素基因及其β防御素抗菌肽及其应用 |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2010006260A1 (fr) * | 2008-07-10 | 2010-01-14 | Ilan Elias | Procédés d'utilisation de polypeptides de coquille d'œuf |
| FR2960877B1 (fr) * | 2010-06-04 | 2014-08-29 | Agronomique Inst Nat Rech | Fraction de proteines et peptides issus du blanc d'oeuf et proteine issue du blanc d'oeuf et leur utilisation comme agent anti-listeria |
-
2018
- 2018-08-09 FR FR1857411A patent/FR3084887A1/fr not_active Withdrawn
-
2019
- 2019-08-09 EP EP19758345.3A patent/EP3833678A1/fr not_active Withdrawn
- 2019-08-09 WO PCT/EP2019/071388 patent/WO2020030773A1/fr not_active Ceased
Also Published As
| Publication number | Publication date |
|---|---|
| WO2020030773A1 (fr) | 2020-02-13 |
| FR3084887A1 (fr) | 2020-02-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| RU2472805C2 (ru) | Антибиотические пептиды | |
| Zhou et al. | An optimized analog of antimicrobial peptide Jelleine-1 shows enhanced antimicrobial activity against multidrug resistant P. aeruginosa and negligible toxicity in vitro and in vivo | |
| Loth et al. | The ancestral N-terminal domain of big defensins drives bacterially triggered assembly into antimicrobial nanonets | |
| JP2016526020A (ja) | 抗菌性ペプチド | |
| EP2782589A2 (fr) | Peptides antimicrobiens et procédés d'utilisation de ces derniers | |
| KR20180002618A (ko) | 항균 펩티드 및 이의 사용방법 | |
| ES2710785T3 (es) | Péptidos antimicrobianos basados en CMAP27 | |
| CN101333247B (zh) | 从东北林蛙皮肤中分离出的抗菌肽及其在抗菌药物中的应用 | |
| Fliss et al. | Synthesis and structure–activity study of the antimicrobial lipopeptide brevibacillin | |
| CA2755472C (fr) | Analogues de la temporine-sha et leurs utilisations | |
| EP3833678A1 (fr) | Peptides derives d'une beta-defensine 11 aviaire et leurs utilisations | |
| US20250320261A1 (en) | Antibacterial peptide | |
| KR101667278B1 (ko) | 미국산 굴에서 유래한 항균 펩타이드 및 이를 함유하는 항균용 약학 조성물 | |
| CN104628869B (zh) | 一类兼具抗菌和抗流感病毒活性的融合肽衍生物 | |
| JP4410100B2 (ja) | 抗微生物性を有するペプチド、及びそれらを含む、特に食品保存用の組成物 | |
| EP2197899B1 (fr) | Peptides cycliques comprenant au moins un residu aza-beta-3 aminoacycle et leurs utilisations | |
| US20250051403A1 (en) | Antimicrobial peptides, variants and chemical analogues thereof and their uses | |
| US11065296B2 (en) | Antimicrobial peptide, its analog and use | |
| US10633420B2 (en) | Antimicrobial peptides with wound healing activity | |
| Fu et al. | Characterization and functional analysis of liver-expressed antimicrobial peptide-2 (LEAP-2) in Pelodiscus sinensis | |
| Ponnusamy et al. | Therapeutic Efficacy of Antibacterial Ocellatin Peptides: A Comprehensive Review | |
| KR102146935B1 (ko) | 광대노린재로부터 유래된 포에실로코리신-1 펩타이드, 이를 유효성분으로 포함하는 항균, 항진균 또는 항염증용 조성물 | |
| CN107513100A (zh) | 虎纹蛙抗菌肽及其基因和应用 | |
| CN106674329A (zh) | 具备抗微生物、抗癌/促进伤口愈合活性的肽及其用途 | |
| WO2015099535A1 (fr) | Peptides antimicrobiens dérivés de thrombocidine |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20210126 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20240301 |