EP2114997A2 - Gene mit einem einzigen exon, für neue bioaktive peptide kodierend - Google Patents
Gene mit einem einzigen exon, für neue bioaktive peptide kodierendInfo
- Publication number
- EP2114997A2 EP2114997A2 EP07856590A EP07856590A EP2114997A2 EP 2114997 A2 EP2114997 A2 EP 2114997A2 EP 07856590 A EP07856590 A EP 07856590A EP 07856590 A EP07856590 A EP 07856590A EP 2114997 A2 EP2114997 A2 EP 2114997A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- amino acid
- seq
- polypeptide chain
- acid sequence
- dna
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 119
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 94
- 230000000975 bioactive effect Effects 0.000 title abstract description 13
- 108090000623 proteins and genes Proteins 0.000 title description 82
- 229920001184 polypeptide Polymers 0.000 claims abstract description 84
- 150000003839 salts Chemical class 0.000 claims abstract description 27
- 238000000034 method Methods 0.000 claims abstract description 14
- 238000004519 manufacturing process Methods 0.000 claims abstract description 5
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 56
- 239000002773 nucleotide Substances 0.000 claims description 51
- 125000003729 nucleotide group Chemical group 0.000 claims description 51
- 239000002243 precursor Substances 0.000 claims description 23
- 150000001413 amino acids Chemical class 0.000 claims description 20
- 150000001408 amides Chemical class 0.000 claims description 19
- 150000002148 esters Chemical class 0.000 claims description 18
- 238000006467 substitution reaction Methods 0.000 claims description 9
- 125000000539 amino acid group Chemical group 0.000 claims description 8
- 230000015572 biosynthetic process Effects 0.000 claims description 5
- 239000004480 active ingredient Substances 0.000 claims description 4
- 238000003786 synthesis reaction Methods 0.000 claims description 4
- 238000012217 deletion Methods 0.000 claims description 3
- 230000037430 deletion Effects 0.000 claims description 3
- 238000003780 insertion Methods 0.000 claims description 3
- 230000037431 insertion Effects 0.000 claims description 3
- 239000008194 pharmaceutical composition Substances 0.000 claims description 3
- 206010003210 Arteriosclerosis Diseases 0.000 claims description 2
- 206010061218 Inflammation Diseases 0.000 claims description 2
- 208000011775 arteriosclerosis disease Diseases 0.000 claims description 2
- 230000032823 cell division Effects 0.000 claims description 2
- 238000009833 condensation Methods 0.000 claims description 2
- 230000005494 condensation Effects 0.000 claims description 2
- 230000004054 inflammatory process Effects 0.000 claims description 2
- 239000007791 liquid phase Substances 0.000 claims description 2
- 239000007790 solid phase Substances 0.000 claims description 2
- 238000006664 bond formation reaction Methods 0.000 claims 1
- 239000000813 peptide hormone Substances 0.000 abstract description 18
- 239000003814 drug Substances 0.000 abstract description 9
- 239000003446 ligand Substances 0.000 abstract description 5
- 230000001225 therapeutic effect Effects 0.000 abstract description 5
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 abstract description 4
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 abstract description 4
- 101800001442 Peptide pr Proteins 0.000 abstract description 2
- 102000004169 proteins and genes Human genes 0.000 description 35
- 235000018102 proteins Nutrition 0.000 description 34
- 108020004414 DNA Proteins 0.000 description 20
- 235000001014 amino acid Nutrition 0.000 description 20
- 230000014509 gene expression Effects 0.000 description 20
- 229940024606 amino acid Drugs 0.000 description 17
- 201000010099 disease Diseases 0.000 description 13
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 13
- 108020004999 messenger RNA Proteins 0.000 description 13
- 239000000523 sample Substances 0.000 description 13
- 239000005556 hormone Substances 0.000 description 12
- 229940088597 hormone Drugs 0.000 description 12
- 210000004027 cell Anatomy 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- 108010076504 Protein Sorting Signals Proteins 0.000 description 8
- 229940079593 drug Drugs 0.000 description 8
- 238000003752 polymerase chain reaction Methods 0.000 description 8
- 238000002869 basic local alignment search tool Methods 0.000 description 7
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 238000003776 cleavage reaction Methods 0.000 description 5
- 238000011160 research Methods 0.000 description 5
- 230000007017 scission Effects 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 4
- 206010028980 Neoplasm Diseases 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 239000000090 biomarker Substances 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 239000012634 fragment Substances 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 208000024172 Cardiovascular disease Diseases 0.000 description 3
- 102000016911 Deoxyribonucleases Human genes 0.000 description 3
- 108010053770 Deoxyribonucleases Proteins 0.000 description 3
- -1 For example Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 206010012601 diabetes mellitus Diseases 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 230000004481 post-translational protein modification Effects 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 241000206602 Eukaryota Species 0.000 description 2
- 108700024394 Exon Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 102000006437 Proprotein Convertases Human genes 0.000 description 2
- 108010044159 Proprotein Convertases Proteins 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 208000007107 Stomach Ulcer Diseases 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 238000013528 artificial neural network Methods 0.000 description 2
- 229940009098 aspartate Drugs 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 210000001124 body fluid Anatomy 0.000 description 2
- 239000010839 body fluid Substances 0.000 description 2
- 238000010804 cDNA synthesis Methods 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 238000010195 expression analysis Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 201000005917 gastric ulcer Diseases 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- 239000003966 growth inhibitor Substances 0.000 description 2
- 230000003054 hormonal effect Effects 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000007030 peptide scission Effects 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 235000004400 serine Nutrition 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 235000008521 threonine Nutrition 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- 235000002374 tyrosine Nutrition 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- 108010064733 Angiotensins Proteins 0.000 description 1
- 102000015427 Angiotensins Human genes 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 108090000317 Chymotrypsin Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 108091029523 CpG island Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 102000004961 Furin Human genes 0.000 description 1
- 108090001126 Furin Proteins 0.000 description 1
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Natural products NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- 208000024556 Mendelian disease Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 108091036407 Polyadenylation Proteins 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 239000013614 RNA sample Substances 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 101710100170 Unknown protein Proteins 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 229940045988 antineoplastic drug protein kinase inhibitors Drugs 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-L aspartate group Chemical class N[C@@H](CC(=O)[O-])C(=O)[O-] CKLJMWTZIZZHCS-REOHCLBHSA-L 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 230000021523 carboxylation Effects 0.000 description 1
- 238000006473 carboxylation reaction Methods 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000010307 cell transformation Effects 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 229960002376 chymotrypsin Drugs 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- ATDGTVJJHBUTRL-UHFFFAOYSA-N cyanogen bromide Chemical compound BrC#N ATDGTVJJHBUTRL-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 208000016097 disease of metabolism Diseases 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 210000004907 gland Anatomy 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 210000002288 golgi apparatus Anatomy 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 150000002614 leucines Chemical class 0.000 description 1
- 238000007403 mPCR Methods 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 230000037353 metabolic pathway Effects 0.000 description 1
- 239000010445 mica Substances 0.000 description 1
- 229910052618 mica group Inorganic materials 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 210000004897 n-terminal region Anatomy 0.000 description 1
- 230000017066 negative regulation of growth Effects 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 239000003909 protein kinase inhibitor Substances 0.000 description 1
- 208000020016 psychiatric disease Diseases 0.000 description 1
- 230000036647 reaction Effects 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 230000029865 regulation of blood pressure Effects 0.000 description 1
- 239000003161 ribonuclease inhibitor Substances 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 238000005670 sulfation reaction Methods 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 239000012085 test solution Substances 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/515—Angiogenesic factors; Angiogenin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
Definitions
- the present invention relates to a novel bioactive peptide hormone, a process for producing the same and the use thereof.
- the present invention identified a novel bioactive peptide precursor and salts thereof known as
- Drugs for example, therapeutic polypeptides, ligands for characterizing relevant targets (eg GPCR) or targets for drug intervention.
- the present invention relates to a novel bioactive peptide hormone, a process for producing the same and the use thereof. More particularly, the present invention relates to a method of identifying bioactive peptide hormones derived from precursor proteins and useful as therapeutic polypeptides, drug intervention targets, ligands for characterizing relevant targets (eg, GPCR dephosphaning), or biomarkers for disease surveillance ,
- Peptide hormones are produced as precursors in various cell types and organs such as glands, neurons, intestines, brain, etc. Peptide hormones are generally synthesized as larger precursors or prohormones, and may undergo a series of post-translational modifications during transport through the endoplasmic reticulum and Golgi apparatus. They are processed and transported to their final destination, where they act as agents (First Messenger) to trigger cell reactions by binding to receptors on the cell surface.
- Physiological processes that are important in many areas of biomedical research, such as diabetes (insulin), blood pressure regulation (angiotensin), anemia (erythropoietin- ⁇ ), Multiple sclerosis (interferon /?) And others.
- Gene prediction usually refers to a field of bioinformatics that deals with the identification of sequences, usually genomic DNA, with biological functions using algorithms. These include in particular protein-coding genes, but other functional elements, such as RNA genes and regulatory regions, can also be detected. Gene prediction is one of the first and most important steps in understanding the genome of a species after its sequencing.
- the target genome is screened for sequences similar to extrinsic indicia in the form of the known sequence of a messenger RNA (mRNA) or a protein product. It is crucial to deduce a unique genomic DNA sequence from which a given mRNA sequence has been transcribed. With a particular protein sequence, a set of possible coding DNA sequences can be deduced by reverse translation of the genetic code. Once a DNA sequence candidate is determined, it is only a matter of algorithm to efficiently examine a target genome for full or partial, exact or inexact hits.
- BLAST is a widely used system developed for this purpose.
- a high similarity with a known messenger RNA or a protein product is in many cases a good indication that a region of a target Genome is a gene coding for a protein.
- a systematic use of this approach requires comprehensive sequencing of mRNA and protein products. Not only is this expensive, but in complex organisms only a portion of all genes in the genome of the organism are expressed at any one time, which means that in a single-cell culture, an extrinsic indication is not readily available for many genes.
- To collect extrinsic evidence for most or all genes of a complex organism hundreds or thousands of different cell types need to be studied, which poses further difficulties. For example, some human genes can only be expressed during development in the embryo or fetus.
- transcript and protein sequence databases have been generated for humans as well as other biology-important model organisms, such as mice and yeasts.
- the RefSeq database contains transcript and protein sequences from many different species, and the Ensemble system maps these signs comprehensively to human and several other genomes.
- ab initio gene prediction in which only one genomic DNA sequence is systematically screened for certain telltale signs of protein-encoding genes. These signs can be broadly classified as either signals, specific sequences that indicate the presence of a nearby gene, or content, statistical properties of the protein coding sequence itself.
- Ab initio gene prediction can be described more accurately as a gene prophecy because extrinsic clues are generally required to convincingly demonstrate the viability of a putative gene.
- the splicing mechanisms used in eukaryotic cells means that a particular protein coding sequence in the genome is subdivided into several parts (exons) separated by non-coding sequences (introns). Spliced sites, in turn, are signals identified by numerous eukaryotic gene prediction programs.
- a typical human gene encoding human genes may be subdivided into as many as twelve exons, each less than two hundred base pairs in length, some of which may be as short as twenty or thirty. Thus, periodicities and other known content characteristics of the protein-encoding DNA of eukaryotes are much more difficult to recognize.
- Advanced gene prediction programs for both prokaryotic and eukaryotic genomes typically resort to complex probability models, such as hidden Markov models
- the mica system is a widely used and particularly accurate gene prediction program for prokaryotes.
- eukaryotic ab initio gene prediction programs have had limited success; a renewed exception here is the program GENSCAN.
- the present invention identified novel bioactive peptide hormone precursors by the identification of novel genes with a single exon responsible for
- Encode peptide hormone precursor sequences To find new genes with a single exon, the human genome (NCBI 33 assembly, July 1, 2003) and the mouse genome (NCBI 30 assembly, July 1, 2003) were translated into all six reading frames using normal genetic code. There were only such Sequence fragments selected that started with the amino acid methionine and had a length of 50 to 200 amino acids. The human and murine sets were compared using the BLAST program to find closely related sequences in both organisms. Only sequences were selected that appeared in both organisms (human and murine). For the screening of secreted proteins, potential signal sequences were predicted using the SignalP program and the absence of potential membrane permeation regions was confirmed using the TMHMM program.
- peptide hormones are characterized by their high specificity and efficacy in very low concentrations. Another characteristic of peptide hormones is that their corresponding mRNA is expressed in small numbers in specific tissues. An abundant expression pattern for peptide hormones is rarely observed in mammalian systems.
- Bioactive peptide hormones are of paramount importance to biomedical research and therefore of interest to the pharmaceutical industry.
- Various Peptide hormones are used to treat diseases.
- WO2004039956 discloses several bioactive polypeptide sequences, reference is not made to identification methods and the use of such sequences.
- the present invention identified novel genes encoding bioactive peptide hormone precursors.
- Peptide hormones are characterized by their high specificity and their efficacy in very low concentrations. bioactive
- Peptide hormones are of paramount importance to biomedical research. Various peptide hormones are used to treat diseases or to monitor disease states. Such polypeptide sequences can be used in therapeutically effective amounts as drugs and drugs for immune disorders.
- the problem can be defined as the identification of novel hormone polypeptide sequences useful for the treatment of human disease.
- the present invention solves this problem by providing eight novel peptide hormone precursors and fragments thereof which are useful for impairing physiological factors which increase the risk of arteriosclerosis, inflammation or uncontrolled cell division.
- the invention provides a novel inventory of hormonal polypeptides useful in the treatment of human diseases in the field of biomedical research.
- the present invention thus relates to a polypeptide chain which consists of an amino acid sequence according to SEQ ID Nos. 1-8 or an amino acid sequence resulting therefrom by deletion, substitution or insertion of at least one
- Amino acid residue is derived, the amide or ester or a salt of the peptide consists.
- One embodiment of the present invention relates to a polypeptide chain consisting of the following amino acid sequence:
- Another embodiment of the present invention relates to a polypeptide consisting of the following amino acid sequence: MPKWRLAWPKQTRASSCGLSLPSISCASSCSASRNGGDRCSLRTTTTRHTR
- An embodiment of the invention further provides a DNA comprising a nucleotide base sequence of SEQ ID NOs: 9-16 which encodes a polypeptide chain having an amino acid sequence represented by SEQ ID NOs: 1-8 or its amide, ester or salt including thereof.
- This invention relates to a DNA consisting of a nucleotide base sequence according to SEQ ID NO: 9 which encodes a polypeptide chain consisting of an amino acid sequence according to SEQ ID NO: 1 or its amide, ester or a salt thereof.
- the present invention relates to a DNA consisting of a nucleotide base sequence according to SEQ ID NO: 10 which encodes the polypeptide chain described in paragraph 1, which consists of an amino acid sequence according to SEQ ID NO: 2 or their amide, ester or a salt thereof.
- a further embodiment of the present invention relates to a DNA consisting of a nucleotide base sequence according to SEQ ID NO: 11 which encodes a polypeptide chain consisting of an amino acid sequence according to SEQ ID NO 3 or its amide, ester or a salt thereof.
- Another embodiment of the present invention relates to a DNA consisting of a nucleotide base sequence according to SEQ ID NO: 12, which encodes a polypeptide chain consisting of an amino acid sequence according to SEQ ID NO: 4 or its amide, ester or a salt thereof.
- Another embodiment of the present invention relates to a DNA consisting of a nucleotide base sequence according to SEQ ID NO: 13, which encodes a polypeptide chain consisting of an amino acid sequence according to SEQ ID NO: 5 or its amide, ester or a salt thereof.
- a further embodiment of the present invention relates to a DNA which consists of a nucleotide base sequence according to SEQ ID No. 14 which encodes a polypeptide chain which consists of an amino acid sequence according to SEQ ID No. 6 or its amide, ester or a salt thereof.
- Another embodiment of the present invention relates to a DNA consisting of a nucleotide base sequence according to SEQ ID NO: 15 which encodes a polypeptide chain consisting of an amino acid sequence according to SEQ ID NO: 7 or its amide, ester or a salt thereof.
- a further embodiment of the present invention relates to a DNA which consists of a nucleotide base sequence according to SEQ ID No. 16 which encodes a polypeptide chain consisting of an amino acid sequence according to SEQ ID No. 8 or its amide, ester or a salt thereof.
- the present invention relates to a method of producing a polypeptide, the method comprising the step of providing the amino acid, synthesizing the amino acid by solid phase or liquid phase synthesis, extracting the polypeptide, purifying the polypeptide.
- the present invention also provides a process for producing the peptide, precursor or salt thereof, which comprises subjecting an amino acid or an amino-terminated peptide and an amino acid or a peptide with terminal carboxyl of a condensation, optionally followed by intramolecular disulfide bridge formation.
- An embodiment of the invention provides a pharmaceutical composition
- a pharmaceutical composition comprising as active ingredient a polypeptide chain or a precursor or a pharmaceutically acceptable amide, ester or salt thereof, wherein the polypeptide chain consists of an amino acid sequence of SEQ ID NOs: 1-8.
- the present invention also relates to the use of a pharmaceutical
- a composition comprising as active ingredient a polypeptide chain or a precursor or a pharmaceutically acceptable amide, ester or salt thereof, said polypeptide chain consisting of an amino acid sequence as shown in SEQ ID NOs: 1-8 and as therapeutic polypeptides, drug intervention targets, ligands to characterize relevant targets, biomarkers to monitor diseases.
- the invention also provides the use of a peptide, precursor or salt of the invention in the manufacture of an agent for the treatment or prevention of cardiovascular disease, hormone-producing tumors
- a hormone secretion inhibitor comprising at least one of the amino acid sequences defined in SEQ ID Nos. 1 to 8.
- An embodiment of the invention also produces an antibody for a polypeptide chain according to paragraph 1, which comprises an amino acid sequence according to SEQ ID Nos. 1-8 or their amide, ester or salts thereof.
- An antibody of the invention may also be used to detect a polypeptide of the invention present in a sample, such as a body fluid or tissue. It can also be used for the production of an antibody column for purifying a polypeptide according to the invention, for the detection of an inventive
- polypeptides in each fraction during purification or analysis of the behavior of a polypeptide of the invention in a test cell.
- polypeptide as used herein is to be understood to refer to any polymer consisting of covalently linked amino acids, which term also includes parts and fragments of full length proteins, such as For example, peptides, oligopeptides and shorter peptide sequences, which consist of at least 2 amino acids, in particular at least about 5 amino acid residues or more.
- polypeptide includes all moieties containing one or more amino acids linked via peptide bonds. Moreover, within its scope, the term includes polymers of modified amino acids, including amino acids, post-translationally, for example, by chemical modification, including, but not limited to, glycosylation, phosphorylation, acetylation and / or sulfation reactions that effectively alter the basic peptide backbone were modified. Accordingly, a polypeptide may be derived from a naturally occurring protein and, in particular, it may be derived from a full length protein by chemical or enzymatic cleavage with reagents such as CNBr, or proteases such as trypsin or chymotrypsin, among others.
- polypeptides may be derived by chemical synthesis using known peptide synthesis techniques.
- amino acid sequence variants referred to herein as polypeptide variants. These may contain one or more, preferably conservative, amino acid substitutions, deletions or insertions in a naturally occurring amino acid sequence, leaving at least one essential property of the polypeptide, such as its biological activity, unchanged.
- polypeptides can be synthesized by chemical polypeptide synthesis. Conservative amino acid substitutions are well known in the art. For example, one or more amino acid residues of a native protein may be conservatively substituted with an amino acid residue of similar charge, size or polarity, with the resulting polypeptide retaining full functionality as described herein.
- conservative amino acid substitutions are those that are generally take place within an amino acid family, which are related via their side chains.
- substitutions within each group are alternatives which have substitution of aspartate by glutamate or of threonine by serine or of any other amino acid residue by an amino acid residue having a related structure in general a negligible effect on the function of the polypeptide formed.
- polypeptide includes amino acid sequence variants which are an unnatural modification such as, but not limited to, protection,
- polypeptide includes a peptide whose biological activity is predictable because its amino acid sequence corresponds to a functional domain. Also included within the term “polypeptide” is a peptide whose biological activity is not predictable by analysis of its amino acid sequence.
- An amino acid is any molecule that contains both a functional amino group and a functional carboxyl group.
- An amino acid residue is the residue of an amino acid after loss of a water molecule (an H + from the nitrogen side and an OH from the carboxyl side) in the formation of a peptide bond, the chemical bond linking amino acid monomers to a protein chain.
- Each protein has its own unique amino acid sequence known as its primary structure. Just as the letters of the alphabet can be put together in various ways to form an infinite variety of words, amino acids can interact with each other to form a vast variety be linked by proteins to different sequences. The unique form of each protein determines its function in the body.
- a precursor is a substance from which another, normally more active, or more mature substance is formed.
- a protein precursor is an inactive protein (or peptide) that can be converted into the active form by a post-translational modification.
- the designation of a precursor of a protein often begins with pro or prepro. Precursors are often used by an organism when the actual protein poses a potential hazard but must be available within a short time and / or in large quantities.
- polypeptide of the invention has hormonal activity.
- polypeptides, precursors or salts of the invention are useful as drugs, for example, as a therapeutic polypeptide, as a ligand for characterizing relevant targets (e.g., GPCR), as targets for
- Drug interventions eg targets for monoclonal antibodies or the like, receptor fragments
- biomarkers for disease surveillance in combination with instrumental antibodies for detection of peptide fragments in body fluids
- protein kinase inhibitors and substrates as protein kinase inhibitors and substrates
- T cell epitopes as Peptide mimotopes of receptor binding sites, as a biomarker for the determination of the expression level.
- the DNA encoding the peptide or precursor of the present invention is useful as, for example, an agent for gene therapy or for the treatment or prevention of cardiovascular disease, hormone-producing tumors, diabetes, gastric ulcer and the like, hormone secretion inhibitor, tumor growth inhibitor, neural Activity etc. useful. Further, the DNA of the present invention is useful as a means of genetically diagnosing diseases such as cardiovascular disease, hormone-producing tumors, diabetes, gastric ulcer and the like.
- a vector is a vehicle for delivery of genetic material, such as DNA, to a human Cell.
- DNA itself can be considered as a vector, for example, especially when used for cell transformation.
- a vector in this sense is a DNA construct, such as a plasmid or an artificial bacterial chromosome, that contains an origin of replication.
- An appropriate origin of replication causes a cell to copy the construct along with the chromosomes of the cell and deliver it to their offspring.
- a single cell so transformed with a vector multiplies into a whole cell culture in which all contain the vector as well as each gene that was bound to it in the construct. Since the constructs can be extracted from cells by purification techniques, transformation with a vector provides the opportunity to multiply a small number of DNA molecules.
- a vector may be an E.
- coli -derived plasmid eg, pBR322, pBR325, pUC12, pUC13
- Bacillus subtilis-derived plasmid e.g., pUB110, pTP5, pC194
- yeast-derived plasmid e.g. B. pSH19, pSH15
- bacteriophage such as the [Iambda] phage
- animal virus such as a retrovirus, vaccine virus, baculovirus, and the like.
- the antibodies for the peptide according to the invention, the precursor according to the invention or the salt according to the invention can specifically recognize the peptide according to the invention, the precursor according to the invention or the salt according to the invention. It may also be used to prepare an antibody column for purifying a polypeptide of the invention, for detecting a polypeptide of the invention in each fraction during purification, or for analyzing the behavior of a novel polypeptide in a test cell. Thus, it can be used to assay the peptide of the present invention or its equivalent in test solutions.
- SignalP Version 2.0 Task This program was used to detect potential signal sequences using a 0.98 cutoff score.
- SignalP version 2.0 predicts the presence and location of signal peptide cleavage sites in the amino acid sequences of different organisms: the method contains a cleavage site prediction and a signal peptide / non-signal peptide prediction based on a combination of several artificial neural networks and hidden Markov models.
- TMHMM version 2.0 is used to predict transmembrane helices in proteins. Predicted TM segments in the n-terminal region sometimes turn out to be signal peptides.
- This program was used to detect potential cleavage sites in protein sequences. It was used with a score of 0.09. The program predicts arginine and lysine propeptide cleavage sites in eukaryotic protein sequences using a neural network ensemble. The default is a furin-specific prediction. It is also possible to make a general prediction for Proprotein Convertase (PC). The program is integrated with the SignalP program and predicts the presence and location of signal peptide cleavage sites.
- PC Proprotein Convertase
- InterPro is a database of protein families, domains, and functional sites, where identifiable features of known proteins can be applied to unknown protein sequences.
- InterProScan is the program used to compare amino acid sequences with the InterPro database becomes.
- the Basic Local Alignment Search Tool finds regions of local similarity between sequences.
- the program compares nucleotide or protein sequences with sequences in the database and determines the statistical significance of matches.
- BLAST can be used to elucidate functional and evolutionary relationships of sequences and to identify members of gene families.
- BLAST uses Karlin-Altschul statistics to determine the statistical significance of the generated orders.
- the basic algorithm can be implemented in a variety of ways and used in a variety of environments, including straightforward database searches in DNA and protein sequences, motif searches, gene identification searches, and analysis of multiple similar regions in long DNA sequences. In addition to the flexibility and formability of mathematical analysis, BLAST is an order of magnitude faster than existing sequence comparison tools of comparable sensitivity.
- the biological role of the hormone peptides according to the invention was investigated by means of expression profile studies (FIGS. 1 to 6). It has been shown that the hormone peptides differ depending on the respective sequence in different tissues. The differential expression of hormone peptides of the invention in various tissues is considered to be a good indication of their important biological role. Adjustment of the concentration of one or more of the hormone peptides of the invention by increasing or decreasing the amount of such hormone peptides could have a pronounced effect on the treatment of a disease in which there is a need for lower or higher concentration of one or more of such hormone peptides (e.g., heart - Circulatory disease, metabolic disease, mental illness, cancer, by one Virus, a bacterial or a yeast-induced infection and others).
- a disease e.g., heart - Circulatory disease, metabolic disease, mental illness, cancer, by one Virus, a bacterial or a yeast-induced infection and others.
- Tissue expression analysis was performed using TaqMan gene expression analyzes.
- PCR Polymerase Chain Reaction
- Quantitative PCR is used to rapidly determine the amount of a PCR product (preferably in real time) and thus is an indirect method for quantifying the initial levels of DNA, cDNA or RNA. This is commonly used to determine the presence or absence of a sequence and, if present, the number of copies in a sample.
- RNA samples of the tissues to be tested Various suppliers purchased RNA samples of the tissues to be tested.
- Products for cDNA were purchased from Applera, reverse transcriptase kit (N8080234), RNase inhibitor (N8080119).
- the cDNA synthesis was performed with 10 ⁇ g of RNA.
- PCR Products for PCR were purchased from Applera. For each reaction, TaqMan Universal PCR Master Mix (4305719) was used. Target Forward Primer, Target Reverse Primer or Target Probe, labeled FAM on each gene (see Primer Sequence Table).
- the PCR was performed using ABI Phsm 7900 (Applera) under the following PCR conditions: 2 minutes at 50 0 C, 10 minutes at 95 0 C, 40 cycles of 95 0 C for 15 s, and 1 min at 60 0 C.
- the PCR was designed as a multiplex PCR with B2M as an endogenous control for normalization.
- Fig. 1 shows the mRNA expression profile of AC105940 on ATAQ 1 for SEQ ID NO: 1
- Fig. 2 shows the mRNA expression profile of AC005291 on ATAQ 1 for SEQ ID NO: 3
- Fig. 3 shows the mRNA expression profile of AC090617 on ATAQ 1 for SEQ ID NO: 4
- Fig. 4 shows the mRNA expression profile of AC114684 on ATAQ 1 for SEQ ID NO: 5
- Fig. 5 shows the mRNA expression profile of AC063920 on ATAQ 1 for SEQ ID NO: 7
- Fig. 6 shows the mRNA expression profile of AC074389 on ATAQ 1 for SEQ ID NO: 8
- Fig. 7 shows the amino acid sequence of SEQ ID NO: 1
- Fig. 8 shows the amino acid sequence of SEQ ID NO: 2
- Fig. 9 shows the amino acid sequence of SEQ ID NO: 3
- Fig. 10 shows the amino acid sequence of SEQ ID NO: 4
- Fig. 11 shows the amino acid sequence of SEQ ID NO: 5
- Fig. 12 shows the amino acid sequence of SEQ ID NO: 6
- Figure 13 shows the amino acid sequence of SEQ ID NO: 7
- Figure 14 shows the amino acid sequence of SEQ ID NO: 8
- Figure 15 shows the nucleotide sequence of SEQ ID NO: 9
- Figure 16 shows the nucleotide sequence of SEQ ID NO Fig. 17: shows the nucleotide sequence of SEQ ID NO: 11
- Fig. 18 shows the nucleotide sequence of SEQ ID NO: 12
- Fig. 19 shows the nucleotide sequence of SEQ ID NO: 13
- Fig. 20 shows the nucleotide sequence of SEQ ID No. 14
- Fig. 21 shows the nucleotide sequence of SEQ ID NO: 15
- Fig. 22 shows the nucleotide sequence of SEQ ID NO: 16
- Fig. 23 shows the nucleotide probe sequence of SEQ ID NO: 1
- Fig. 24 shows the nucleotide forward primer sequence of SEQ ID NO: 1
- Fig. 25 shows the nucleotide reverse primer sequence of SEQ ID NO: 1.
- 1 Figure 26 shows the nucleotide probe sequence of SEQ ID NO: 2
- Figure 27 shows the nucleotide forward primer sequence of SEQ ID NO: 2
- Figure 28 shows the nucleotide reverse primer sequence of SEQ ID NO: 2
- Figure 29 shows the nucleotide probe sequence of SEQ ID NO: 3
- Figure 30 shows the nucleotide forward primer sequence of SEQ ID NO: 3
- Figure 31 shows the nucleotide reverse primer sequence of SEQ ID No. 3
- Fig. 32 shows the nucleotide probe sequence of SEQ ID NO: 4
- Fig. 33 shows the nucleotide forward primer sequence of SEQ ID NO: 4
- Fig. 34 shows the nucleotide reverse primer sequence of SEQ ID NO: 4
- Fig. 35 shows the nucleotide probe sequence of SEQ ID NO: 4.
- 5 Figure 36 shows the nucleotide forward primer sequence of SEQ ID NO: 5
- 37 shows the nucleotide reverse primer sequence of SEQ ID NO: 5
- 38 shows the nucleotide probe sequence of SEQ ID NO: 5
- Fig. 39 shows the nucleotide forward primer sequence of SEQ ID NO: 6
- Fig. 40 shows the nucleotide reverse primer sequence of SEQ ID NO: 6
- Fig. 41 shows the nucleotide probe sequence of SEQ ID # 7 Fig.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Genetics & Genomics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Zoology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Toxicology (AREA)
- Vascular Medicine (AREA)
- Diabetes (AREA)
- Biomedical Technology (AREA)
- Endocrinology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Epidemiology (AREA)
- Obesity (AREA)
- Immunology (AREA)
- Urology & Nephrology (AREA)
- Rheumatology (AREA)
- Physics & Mathematics (AREA)
- Emergency Medicine (AREA)
- Pain & Pain Management (AREA)
Abstract
Description
Claims
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE102006059825 | 2006-12-19 | ||
| PCT/EP2007/010842 WO2008074424A2 (de) | 2006-12-19 | 2007-12-12 | Gene mit einem einzigen exon, die für neue bioaktive peptide kodieren |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP2114997A2 true EP2114997A2 (de) | 2009-11-11 |
Family
ID=39446236
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP07856590A Withdrawn EP2114997A2 (de) | 2006-12-19 | 2007-12-12 | Gene mit einem einzigen exon, für neue bioaktive peptide kodierend |
Country Status (13)
| Country | Link |
|---|---|
| US (1) | US20100184660A1 (de) |
| EP (1) | EP2114997A2 (de) |
| JP (1) | JP2010512763A (de) |
| KR (1) | KR20090100359A (de) |
| CN (1) | CN101600734A (de) |
| AR (1) | AR064390A1 (de) |
| AU (1) | AU2007334933B2 (de) |
| BR (1) | BRPI0721282A2 (de) |
| CA (1) | CA2672945A1 (de) |
| IL (1) | IL225806A0 (de) |
| MX (1) | MX2009006438A (de) |
| TW (1) | TW200846467A (de) |
| WO (1) | WO2008074424A2 (de) |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2322200A3 (de) * | 2002-10-29 | 2011-07-27 | Genentech, Inc. | Gestaltungen und Methoden für die Behandlung von immune verwandte Krankheiten |
| EP2266500B1 (de) * | 2003-08-01 | 2015-04-01 | CellSeed Inc. | Dreidimensional gewebe-struktur |
| DE102006021257A1 (de) * | 2006-04-28 | 2007-11-08 | Eberhard-Karls-Universität Tübingen Universitätsklinikum | Nachweis von transgener DNA (t DNA) |
-
2007
- 2007-12-12 US US12/519,978 patent/US20100184660A1/en not_active Abandoned
- 2007-12-12 BR BRPI0721282-8A patent/BRPI0721282A2/pt not_active IP Right Cessation
- 2007-12-12 KR KR1020097012489A patent/KR20090100359A/ko not_active Ceased
- 2007-12-12 EP EP07856590A patent/EP2114997A2/de not_active Withdrawn
- 2007-12-12 CN CNA2007800472886A patent/CN101600734A/zh active Pending
- 2007-12-12 AU AU2007334933A patent/AU2007334933B2/en not_active Expired - Fee Related
- 2007-12-12 WO PCT/EP2007/010842 patent/WO2008074424A2/de not_active Ceased
- 2007-12-12 CA CA002672945A patent/CA2672945A1/en not_active Abandoned
- 2007-12-12 MX MX2009006438A patent/MX2009006438A/es active IP Right Grant
- 2007-12-12 JP JP2009541837A patent/JP2010512763A/ja active Pending
- 2007-12-17 AR ARP070105665A patent/AR064390A1/es not_active Application Discontinuation
- 2007-12-17 TW TW096148161A patent/TW200846467A/zh unknown
-
2013
- 2013-04-17 IL IL225806A patent/IL225806A0/en unknown
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2008074424A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2010512763A (ja) | 2010-04-30 |
| CA2672945A1 (en) | 2008-06-26 |
| MX2009006438A (es) | 2009-08-07 |
| TW200846467A (en) | 2008-12-01 |
| BRPI0721282A2 (pt) | 2014-04-08 |
| AU2007334933A1 (en) | 2008-06-26 |
| AR064390A1 (es) | 2009-04-01 |
| CN101600734A (zh) | 2009-12-09 |
| IL225806A0 (en) | 2013-06-27 |
| US20100184660A1 (en) | 2010-07-22 |
| AU2007334933B2 (en) | 2014-01-30 |
| WO2008074424A2 (de) | 2008-06-26 |
| WO2008074424A3 (de) | 2008-10-23 |
| KR20090100359A (ko) | 2009-09-23 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE3856121T2 (de) | Amyloid-Peptide | |
| DE69835751T2 (de) | 5' ests für proteine, die nicht gewebespezifisch sind | |
| DE60035860T2 (de) | Rationale auswahl von mutmasslichen peptiden aus identifizierten nukleotid- beziehungsweise peptidsequenzen | |
| EP0393438A2 (de) | TNF-Rezeptor, TNF bindende Proteine und dafür kodierende DNAs | |
| EP1236799A2 (de) | Menschliche Nukleinsäuresequenzen aus Brusttumorgewebe | |
| DE69834727T2 (de) | 5' ests für sekretierte proteine die in verschiedenen geweben expremiert werden | |
| Richter et al. | Comparative analyses of glycerotoxin expression unveil a novel structural organization of the bloodworm venom system | |
| CA2296398A1 (en) | 5' ests for secreted proteins expressed in endoderm | |
| EP0736095B1 (de) | Humanes zirkulierendes cytokin cc-1 | |
| DE19818620A1 (de) | Menschliche Nukleinsäuresequenzen aus Blase-Normal | |
| EP1234879A2 (de) | Menschliche Nukleinsäuresequenzen aus Prostatatumorgewebe | |
| EP1073742A2 (de) | Menschliche nukleinsäuresequenzen aus blasentumorgewebe | |
| DE68923496T2 (de) | Verfahren zur Herstellung von motilinähnlichen Polypeptiden und seine Expression. | |
| DE60123109T2 (de) | Mit schizophrenie in zusammenhang stehendes gen, das für ein potential-abhängiges ionkanal kodiert | |
| EP2114997A2 (de) | Gene mit einem einzigen exon, für neue bioaktive peptide kodierend | |
| DE60117788T2 (de) | Menschliche wingless-ähnliche gene | |
| EP1007671B1 (de) | Fanconi-gen ii | |
| Nagle et al. | The egg-laying hormone family: Precursors, products, and functions | |
| DE69832447T2 (de) | Gen kodierend für Afadin-1 | |
| DE4427531A1 (de) | Humanes zirkulierendes beta-Defensin hBD-1 | |
| DE60123754T2 (de) | Neuer transkriptionsfaktor carp-2 | |
| AU715449B2 (en) | Human SMCY cDNA and related products | |
| EP1082420A2 (de) | Menschliche nukleinsäuresequenzen, die in pankreasnormalgewebe überexprimiert sind | |
| Eum et al. | Characterization of a novel repetitive secretory protein specifically expressed in the modified salivary gland of Hydropsyche sp.(Trichoptera; Hydropsychidae) | |
| DE19730786C2 (de) | Humanes zirkulierendes hNLP (humanes Neutrophilen-Lymphocyten-Peptid) |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20090608 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LI LT LU LV MC MT NL PL PT RO SE SI SK TR |
|
| DAX | Request for extension of the european patent (deleted) | ||
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: SANOFI |
|
| 17Q | First examination report despatched |
Effective date: 20111108 |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: SANOFI |
|
| RAP1 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: SANOFI |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION HAS BEEN WITHDRAWN |
|
| 18W | Application withdrawn |
Effective date: 20140311 |