EP0793676A1 - Nouvelles proteines membranaires d'helicobacter pylori - Google Patents
Nouvelles proteines membranaires d'helicobacter pyloriInfo
- Publication number
- EP0793676A1 EP0793676A1 EP96933489A EP96933489A EP0793676A1 EP 0793676 A1 EP0793676 A1 EP 0793676A1 EP 96933489 A EP96933489 A EP 96933489A EP 96933489 A EP96933489 A EP 96933489A EP 0793676 A1 EP0793676 A1 EP 0793676A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- protein
- centrifugation
- recovered
- subjected
- nacl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/205—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Campylobacter (G)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
Definitions
- the present invention relates to proteins of Helicobacter pylori newly obtained in substantially purified form, as well as the pharmaceutical compositions which contain them.
- Helicobacter is a bacterial genus characterized by gram negative spiral bacteria. Several species colonize the gastrointestinal tract of mammals. We cite in particular H. pylori, H. heilmanii, H. felis and H. mustelae. Although H. pylori is the species most commonly associated with human infections, in some cases certainly rare. H. heilmanii and H. felis have been isolated from humans.
- Helicobacter infects more than 50% of the adult population in developed countries and almost 100% of that of developing countries; making it one of the predominant infectious agents worldwide.
- H. pylori is found exclusively to date on the surface of the stomach lining in humans and more particularly around crater lesions of gastric and duodenal ulcers. This bacterium is currently recognized as the etiological agent of antral gastritis and appears as one of the cofactors required for the development of ulcers. Furthermore, it seems that the development of gastric carcinomas may be associated with the presence of H. pylori.
- H. proteins. pylori have been characterized or isolated to date. These include urease, composed of two subunits A and B of 30 and 67 kDa respectively ( ⁇ u & Mobley, Infect. Immun. (1990) 58: 992; Dunn et al, J. Biol. Chem .
- HpaA fibrillar hemaglutinin
- Hpn fibrillar hemaglutinin
- a 15 kDa protein rich in histidine Hpn
- a 30 kDa outer membrane protein Bolin et al, J. Clin. Microbiol. (1995) 33: 381
- a 20 kDa lipoprotein associated with the membrane Kostrcynska et al, J. Bact.
- urease is recognized as being a first choice antigen which can be used for this purpose (WO 94/9823; WO95 / 3824; WO 95/22987; Michetti et al, Gastroenterology (1994) 107: 1002).
- WO 94/9823 WO95 / 3824
- WO 95/22987 Michetti et al, Gastroenterology (1994) 107: 1002
- the subject of the invention is in particular an H. protein. pylori in substantially purified form, capable of being obtained from a membrane fraction of H. pylori, and whose molecular weight after electrophoresis on 10% polyacrylamide gel in the presence of SDS, appears to be of the order of 54, 50, 32-35 or 30 kDa.
- the protein has a molecular weight of approximately 54 kDa, it is further specified that it does not react with an anti-catalase antiserum.
- H. catalase antiserum. pylori can in particular be prepared according to the immunization method described in Example 5 below, using a catalase preparation obtained by chromatography. as described in Example 6.
- substantially purified form is meant that the protein is separated from the environment in which it exists naturally. Among others, it may be a preparation in particular devoid of the cytoplasmic and periplasmic proteins of H. pylori. d -
- the membrane protein whose apparent molecular weight is of the order of 54 kDa can be obtained by a process in which:
- a bacterial pellet is recovered which is treated with lysozyme and which is subjected to sonication, followed by centrifugation;
- the membrane fraction is subjected to anion exchange chromatography on a Q-Sepharose column in a 0-1.5 M NaCl gradient, advantageously in a carbonate buffer p ⁇ 9.5 to 0.1% of zwittergent 3-14 , followed by washing with 1 M NaCl, advantageously in a carbonate buffer p ⁇ 9.5 to 0.1% of zwittergent 3-14;
- the membrane protein whose apparent molecular weight is of the order of 50 kDa can be obtained by a process in which:
- the membrane fraction is subjected to anion exchange chromatography on a Q-Sepharose column in 0 - 0.5 M NaCl gradient, advantageously in a carbonate buffer pH 9.5 at 0.1% of zwittergent 3-14 , followed by washing with 1 M NaCl, advantageously in a carbonate buffer pH 9.5 at 0.1% of zwittergent 3-14;
- the membrane protein whose apparent molecular weight is of the order of 30 kD can be obtained by a process in which:
- the membrane fraction is subjected to anion exchange chromatography on a Q-Sepharose column in a 0-1.5M NaCl gradient, advantageously in a carbonate buffer pH 9.5 at 0.1% of zwittergent 3-14;
- the membrane protein whose apparent molecular weight is of the order of 32-35 kDa is capable of being obtained by a process in which:
- a bacterial pellet is recovered which is treated with lysozyme and which is subjected to sonication, followed by centrifugation;
- the membrane fraction consisting of the centrifugation pellet is recovered which is resuspended in an aqueous medium, advantageously in carbonate buffer pH 9.5;
- the suspension obtained in (iv) is centrifuged at approximately 200,000 xg and the supernatant is recovered;
- the preparation obtained in (vi) is subjected to a cation exchange chromatography on a column of SP-Sepharose in 0-1.5 M NaCl gradient, advantageously in a pH 7 phosphate buffer;
- the proteins of 54, 50, 32 and 30 kDa according to the invention are probably intrinsic membrane proteins or proteins associated with the membrane.
- the 54 kDa protein does not react with anti-catalase antibodies, neither in western blot nor in dot blot.
- the 30 kDa protein does not react with antibodies against the urease A subunit, neither in western blot nor in dot blot.
- the 32 kDa protein turns out to be an alkaline protein; its molecular weight may appear slightly higher e.g. of the order of 35 kDa under certain experimental conditions.
- N-terminal sequence of the 50 kDa protein of an H. strain. pylori is as follows (one letter code): MKEKFNRTKP ⁇ VNIGTIG ⁇ VD ⁇ .
- This information does not exclude the fact that equivalent proteins capable of being purified according to the process indicated above may have a slightly different N-terminal sequence, insofar as they are derived from another bacterial strain. Such a difference would indeed reflect the phenomenon of allelic variance commonly encountered within the same species. For example, a bacterial species is usually represented by a set of strains which differ from each other by minor allelic characteristics. A polypeptide that performs the same biological function in different strains may have an amino acid sequence that is not the same for all strains. Such an allelic variation is also found at the DNA level.
- allelic differences in the amino acid sequence may consist of one or more substitutions, deletions or additions of amino acids, which do not alter the biological function.
- biological function is meant the function of the protein which participates in the survival of cells in which the protein exists naturally (even if the function is not absolutely essential).
- the function of a porine is to allow compounds present in the external environment to enter the interior of the cell.
- the biological function is distinct from the antigenic function.
- a protein can have more than one biological function.
- the subject of the invention is also a protein in substantially purified form and capable of having been purified according to one of the methods described above from a bacterium of the genus Helicobacter eg, H. pylori, H heilmanii, H. felis and H. mustelae.
- the subject of the invention is also any other protein or polypeptide, in substantially purified form, insofar as it is analogous in terms of antigenicity to a Helicobacter protein capable of being purified according to one of the methods described above.
- polypeptides these are in particular polypeptides derived by fragmentation or by mutation of one or more amino acids, e.g. by deletion. addition or substitution of a protein which exists in nature and whose purified form can be obtained according to one of the methods described above.
- Such polypeptides can in particular be obtained by enzymatic digestion using proteases such as pepsin or trypsin. It is not necessary that such polypeptides can be purified by one of the methods described above.
- polypeptide is reserved to denote a product derived from a protein by fragmentation or mutation.
- a protein or polypeptide according to the invention must be capable of being recognized by monospecific antibodies established against a Helicobacter protein capable of being purified according to one of the methods described above. This specific antigenicity can be revealed by a number of methods; for example by
- the product intended to be tested eg either in the form of a purified preparation, or in the form of a bacterial extract, is subjected to an electrophoresis in SDS gel Page (10% polyacrylamide) as described by Laemmli UK, Nature (1970) 227: 680. After transfer to a nitrocellulose membrane, the latter is incubated with a monospecific hyperimmune serum diluted in the range of dilutions from 1: 50 to 1 : 5000, preferably from 1: 100 to 1: 500. The specific antigenicity is demonstrated as soon as a band corresponding to the product tested exhibits reactivity to one of the dilutions included in the range established above.
- the product to be tested is preferably used to cover the wells. It is preferred to use a purified preparation, although a total extract may also be used.
- 100 ⁇ l of a preparation at 10 ⁇ g of protein / ml are distributed in the wells of a 96-well plate. The plate is incubated for 2 hrs at 37 ° C. and then overnight at 4 ° C. The plate is washed with PBS buffer (phosphate buffered saline) containing 0.05% Tween 20 (PBS / Tween buffer). The wells are saturated with 250 ⁇ l of PBS containing 1% bovine serum albumin (BSA).
- BSA bovine serum albumin
- the medium is incubated for 1 hour at 37 ° C., then the plate is washed with PBS / Tween buffer.
- a monospecific rabbit antiserum is serially diluted in PBS / Tween buffer containing 0.5% BSA.
- One hundred ⁇ l of a dilution is added to each well.
- the plate is incubated for 90 min at 37 ° C. and then washed.
- the plate is revealed according to standard methods. For example, a rabbit anti-immunoglobulin goat peroxidase-immunoglobulin conjugate is added to the wells.
- the incubation is continued for 90 min at 37 ° C., then the plate is washed.
- the reaction is developed with the appropriate substrate.
- the reaction is measured by colorimetry (absorbance measured by spectrophotometry). Under these conditions, a positive reaction is observed when an OD value of 1 is associated with a dilution of at least 1:50, preferably at least 1: 500.
- the appropriate wavelength at which the optical density depends on the substrate.
- a preparation of the product to be tested with 100 ⁇ g of protein / ml is diluted in series twice in 50 mM Tris-HCl pH 7.5.
- 50 mM Tris-HCl pH 7.5 One hundred ⁇ l of each dilution is applied to a 0.45 ⁇ m nitrocellulose membrane in a 96-well dot blot device (Biorad).
- the buffer is removed by vacuum.
- the wells are washed by adding 50 mM Tris-HCl pH 7.5 and the membrane is air dried.
- the membrane is saturated with blocking buffer (50 mM Tris-HCl pH 7.5, 0.15 M NaCl, skimmed milk 10 g / 1) then incubated with a monospecific antiserum diluted in the range of 1: 50 to 1: 5000. preferably 1: 50 to 1: 500.
- the reaction is revealed according to standard methods. For example, a goat peroxidase-immunoglobulin conjugate rabbit anti-immunoglobulin is added to the wells. Incubation is continued 90 min at 37 ° C then the plate is washed. The reaction is developed with the appropriate substrate. The reaction is measured by colorimetry or chemiluminescence.
- a reaction is positive when a coloration is observed at the level of the deposition on the nitrocellulose sheet directly for revelation by colorimetry or on photographic film for revelation by chemiluminescence, associated with a dilution of at least 1:50, preferably at least 1: 500.
- a protein according to the invention can in particular be obtained by purification from Helicobacter or expressed by recombinant way in a heterologous system (which can also be the case for a polypeptide according to the invention).
- the protein may have post-translational modifications which are not identical to those of the corresponding protein derived from the original strain.
- the therapeutic or prophylactic efficacy of a protein or a polypeptide according to the invention can be evaluated according to standard methods; for example by measuring the induction of a mucosal immune response or the induction of an immune response with a therapeutic or protective effect using e.g. the mouse / H. felis model and the procedures described in Lee et al, Eur. J. Gastroenterology & ⁇ epatology, (1995) 7: 303 or Lee et al, J. Infect. Say. (1995) 172: 161, provided that the following precaution is taken: When the protein originates from a species other than H. felis, the strain of H.
- felis must be replaced by a strain of Helicobacter belonging to the species from which the protein originates and adapted for this purpose (the other experimental conditions remaining identical).
- a strain of H. pylori to induce a protective or therapeutic effect, by substituting a strain of H. pylori.
- Such a strain is proposed by e.g. Kleanthous et al. Abstr. presented at the VlIIth International Workshop on Gastroduodenal Pathology 7-9th July 1995, Edinburgh, Scotland.
- a protective effect is noted when an infection in the gastric tissue is less compared to a control group. Infection is assessed by testing urease activity, bacterial load or leukocyte infiltration. For example, when a reduction in urease activity in the gastric tissue is found after the test, even if it is not completely abolished, it is fair to say that there is partial protection.
- the invention also relates to (i) a composition of matter comprising a protein or a polypeptide according to the invention and a diluent or a support; in particular (ii) a pharmaceutical composition, in particular intended for the prevention or treatment of a Helicobacter infection.
- a protein or polypeptide according to the invention which includes as active ingredient a protein or polypeptide according to the invention, in an amount effective from a prophylactic or therapeutic point of view; (iii) the use of a protein or a polypeptide according to the invention as a therapeutic or prophylactic agent; (iv) the use of a protein or a polypeptide according to the invention for the manufacture of a medicament intended for the prevention or the treatment of a Helicobacter infection; as well as (v) a method of inducing an immune response against Helicobacter eg, H. pylori, H. heilmanii, H. felis and H.
- a mammal according to which said mammal is administered a quantity immunologically effective of a protein or polypeptide according to the invention in order to develop an immune response; in particular (vi) a method of preventing or treating a Helicobacterlle infection, an individual is administered a prophylactically or therapeutically effective amount of a protein or a polypeptide according to the invention.
- the methods and pharmaceutical compositions according to the invention can treat or prevent infections with Helicobacter and consequently, the gastrointestinal diseases associated with such infections.
- infections include, in particular, acute chronic atrophic gastritis; peptic ulcers e.g. gastric and duodenal ulcers; gastric cancers; chronic hyperopia; refractory non-ulcerative dyspepsia; intestinal metaplasia and certain lymphomas (e.g. low grade MALT lymphoma).
- a composition according to the invention can be administered by any conventional route in use in the field of vaccines, in particular through a mucosal surface (eg ocular, nasal, oral, gastric, intestinal, rectal, vaginal, or urinary tract) or parenterally (eg subcutaneous, intradermal, intramuscular, intravenous, or intraperitoneal).
- a mucosal surface eg ocular, nasal, oral, gastric, intestinal, rectal, vaginal, or urinary tract
- parenterally eg subcutaneous, intradermal, intramuscular, intravenous, or intraperitoneal.
- the choice of administration route depends on a certain number of parameters such as the adjuvant associated with the protein or the polypeptide according to the invention. For example, if a mucosal adjuvant is used, the nasal or oral route is preferred. If a lipid formulation is used, the parenteral route will be chosen, preferably the subcutaneous or intramuscular route.
- a composition according to the invention can comprise, in addition to a protein or a polypeptide according to the invention, at least one other Helicobacter antigen such as the urease apoenzyme. or a subunit, fragment, homolog, mutant or derivative of this urease.
- a protein or a polypeptide according to the invention can be formulated in or with liposomes, preferably neutral or anionic liposomes, microspheres. ISCOMs or viral pseudo-particles (VLPs), to promote targeting of the protein or polypeptide or to increase the immune response.
- liposomes preferably neutral or anionic liposomes, microspheres.
- ISCOMs or viral pseudo-particles (VLPs) to promote targeting of the protein or polypeptide or to increase the immune response.
- Adjuvants other than liposomes can also be used. Many are known to those skilled in the art. Such adjuvants are referenced below:
- aluminum compounds such as aluminum hydroxide, aluminum phosphate and aluminum hydroxyphosphate are mentioned.
- the antigen can be adsorbed or precipitated on an aluminum compound according to standard methods.
- Other adjuvants such as RIBI from ImmunoChem (Hamilton, MT) can be used for parenteral administration.
- bacterial toxins e.g. cholera toxin (CT), toxin from E. coli. heat labile coli (LT) Clostridium difficile toxin and pertussis toxin (PT) as well as the detoxified forms (subunit, toxoid or mutant) of these toxins.
- CT cholera toxin
- LT heat labile coli
- PT pertussis toxin
- a preparation containing the CT subunit B (CTB) and a smaller amount of CT can be used.
- Fragments, homologs and derivatives of these toxins are likewise suitable insofar as they retain an adjuvant activity.
- a mutant having reduced toxicity is used.
- Such mutants are described eg in WO 95/17211 (Arg-7-Lys CT mutant), WO 95/34323 (Arg-9-Lys Glu-129-Gly PT mutant) and WO 96/6627 (Arg-192-Gly Mutant LT).
- Other adjuvants such as the major bacterial lipopolysaccharide (MPLA) of e.g. E. coli, Salmonella minnesota, Salmonella typhimurium or Shigella flexneri, can be used for mucosal administration.
- MPLA major bacterial lipopolysaccharide
- Adjuvants useful for both mucosal and parenteral administration include in particular polyphosphazene (WO 95/2415).
- DC-chol (3 betâ- [N- (N'.N'-dimethyl aminomethane) -carbamoyl] cholesterol) (USP 5,283,185 and WO 96/14831) and QS-21 (WO 88/9336).
- the administration can take place in single or repeated dose one or more times after a certain delay.
- the appropriate dosage varies depending on various parameters, for example. of the individual treated (adult or child) of the vaccine antigen itself of the mode and frequency of administration, of the presence or absence of adjuvant and if present, of the type of adjuvant and of the effect desired (eg protection or treatment), as can be determined by those skilled in the art.
- an antigen according to the invention can be administered in an amount ranging from 10 ⁇ g to 500 mg, preferably from 1 mg to 200 mg.
- a parenteral dose should not exceed 1 mg, preferably 100 ⁇ g. Higher doses may be prescribed for eg oral use.
- the amount of protein administered to humans by the oral route is, for example, of the order of 1 to 10 mg per dose, and at least 3 doses are recommended at 4-week intervals.
- a composition according to the invention can be produced in a conventional manner.
- a protein or a polypeptide according to the invention is combined with a diluent or a support which is acceptable from a pharmaceutical point of view, eg water or a saline solution such as a phosphate salt buffer (PBS), supplemented. optionally with a bicarbonate salt such as sodium bicarbonate eg 0.1 to 0.5 M when the composition is intended for oral or intragastric administration.
- a diluent or carrier is selected based on the mode and route of administration and standard pharmaceutical practices. Pharmaceutically acceptable diluents and carriers and all that is necessary for their use in pharmaceutical formulations are described in Remington's Pharmaceutical Sciences, a standard reference text in this area and in the USP / NP.
- a protein or a polypeptide according to the invention can be encapsulated alone or in the presence of other H. pylori proteins in gelatin capsules in order to protect the antigen against degradation by gastric juice or else administered in presence of sodium bicarbonate.
- Such formulations have already been used for pharmaceutical compositions (Black et al. Dev. Biol. Stand. (1983) 5_3: 9).
- the protein can also be encapsulated in microspheres of
- PLGA copolymers of glycolic acid and lactic acid
- a protein or polypeptide according to the invention can be administered parenterally. To do this, a protein or polypeptide according to the invention is adsorbed on alumina gel in a completely conventional manner.
- the protein in solution at 1 mg / ml in a buffer whose pH is close to 6.5 is contacted for 1 hour with aluminum hydroxide at 10 mg / ml measured at AL " 1-1" 1 " .
- the final composition of the preparation is as follows: protein 50 ⁇ g / ml, AL +++ 250 ⁇ g / ml, merthiolate 1 / 10,000, all in PBS. As in the case of oral administration, 3 injections are recommended each spaced 4 weeks from the previous one.
- a polypeptide according to the invention can also be useful as a diagnostic reagent, for example for detecting the presence of anti-Helicobacter antibodies in a biological sample e.g. a blood sample.
- a polypeptide advantageously comprises 5 to 80 amino acids, preferably 10 to 50 amino acids.
- a polypeptide reagent according to the invention may or may not be labeled. according to the diagnostic method used. Diagnostic methods are described further in the text.
- the invention provides a monospecific antibody capable of recognizing a protein or a polypeptide according to the invention.
- an antibody capable of reacting mainly with a single Helicobacter protein. Such an antibody can only be obtained by using a substantially purified protein, as an immunogen.
- An antibody according to the invention can be polyclonal or monoclonal; the monoclonals can be chimeric (for example, constituted by a variable region of murine origin associated with a constant human region) or humanized (only the hypervariable regions are of animal origin, for example of murine origin) and / or by a single chain.
- the polyclonal as the monoclonal can also be in the form of fragments of immunoglobulins for example a fragment F (ab) '2 or Fab.
- An antibody according to the invention can also be of any isotype, for example IgG or IgA; a polyclonal can be of a single isotype or a mixture of all or part of them.
- An antibody which is directed against a protein according to the invention can be produced and subsequently identified using a standard immunoassay, for example Western blot, dot blot or ELISA analysis (see for example Coligan et al, Current Protocols in Immunology (1994) John Wiley & sons Inc., New York, NY); Antibodies: A laboratory Manual, D. Lane, (1988) Harlow Ed.).
- a standard immunoassay for example Western blot, dot blot or ELISA analysis (see for example Coligan et al, Current Protocols in Immunology (1994) John Wiley & sons Inc., New York, NY); Antibodies: A laboratory Manual, D. Lane, (1988) Harlow Ed.).
- An antibody according to the invention can be useful in diagnosis, as well as in affinity chromatography for purifying on a large scale, a protein or a polypeptide according to the invention; such an antibody is also potentially useful as a therapeutic agent in a passive immunization procedure.
- the invention also provides (i) a reagent for detecting the presence of Helicobacter in a biological sample, which comprises an antibody or a polypeptide according to the invention; and (ii) a diagnostic method for detecting the presence of Helicobacter in a biological sample, according to which the biological sample is brought into contact with an antibody or a polypeptide according to the invention, so that an immune complex is formed; optionally, the unbound material is eliminated. and detecting the immune complex formed between the sample and the antibody or the polypeptide according to the invention, as an indicator of the presence of Helicobacter in the sample or in the organ in which the sample has been collected.
- an antibody according to the invention makes it possible to test the presence of Helicobacter in a gastric extract.
- the reagent to be presented in free form or immobilized on a solid support can be any support commonly used in this field, for example, a tube, a ball or a well.
- Immobilization can be obtained by direct or indirect means.
- the direct means include passive adsorption (non-covalent bond) or covalent bonds between the support and the reagent.
- indirect means it is meant that an anti-reagent compound capable of interacting a reagent is first of all attached to a solid support. For example, if you use a polyvinyl reagent.
- an antibody capable of binding it can be used as an anti-reagent, provided that it can bind to an epitope of the polypeptide which is not involved in the recognition of the antibodies present in the biological samples.
- the indirect means can also be implemented via a ligand-receptor system. for example by grafting a molecule, such as a vitamin, onto a polypeptide reagent and then immobilizing the corresponding receptor in solid form. This is illustrated eg by the biotin-streptavidin system.
- we use indirect means for example by adding a peptide tail to the reagent eg by chemical means, and by immobilizing the grafted product by passive adsorption or by covalent bonding of the peptide tail.
- the invention also relates to a method for purifying a protein or a polypeptide according to the invention from a biological sample, according to which the biological sample is subjected to an affinity chromatography using a monospecific antibody according to the invention.
- the antibody can be polyclonal or monoclonal, preferably of the type
- IgG IgG. Purified IgGs can be prepared from an antiserum according to commonly practiced methods (see for example Coligan et al).
- a biological sample preferably in a buffer solution
- chromatography equipment preferably equilibrated with the buffer used for diluting the biological sample so that the protein or the polypeptide according to the invention (antigen ) can be adsorbed on the material.
- Chromatography equipment such as a gel or a resin associated with an antibody according to the invention, can be in the form of a bath or a column.
- the components which remain unbound are eliminated by washing and the antigen is then eluted in an appropriate elution buffer, such as for example, a glycine buffer or a buffer containing a chaotropic agent eg guanidine HCl, or a rich concentration. salt (for example, 3M MgCl 2 ).
- the eluted fractions are recovered and the presence of the antigen is then demonstrated, for example by measuring the absorbance at 280 nm.
- Such a purification process can, for example, be used to purify a protein from a total extract.
- the material intended to be subjected to immunoaffinity chromatography should first be enriched. in quantity of protein to be purified.
- such a method can be used to perfect the purification of the 32 kDa protein as obtained according to the method described above comprising a purification step on SP-Sepharose.
- the therapeutic or prophylactic utility of an antibody according to the invention can be demonstrated according to the protection test of Lee et al. proposed above for the proteins or polypeptides according to the invention.
- the subject of the invention also also is (i) a composition of matter comprising a monospecific antibody according to the invention, and a diluent or a support; in particular, (ii) a pharmaceutical composition comprising a monospecific antibody according to the invention in an amount effective from a therapeutic or prophylactic point of view; (iii) the use of a monospecific antibody according to the invention in the preparation of a medicament for treating or preventing a Helicobacter infection; as well as (iv) a method for treating or preventing a Helicobacter infection (eg H. pylori. H. felis, H. mustelae or H. heilmanii), according to which a therapeutically or prophylactically effective amount of an antibody is administered according to the invention, to an individual in need of such treatment.
- a Helicobacter infection eg H. pylori. H. felis, H. mustelae or H. heilmanii
- the monospecific antibody can be polyclonal or monoclonal, preferably of the IgA isotype (predominantly).
- the antibody is administered mucosally to a mammal, for example in the gastric mucosa, either orally or intragastrically, advantageously in the presence of a bicarbonate buffer.
- a monospecific antibody according to the invention can be administered as the sole active component or as a mixture comprising at least one monospecific antibody specific to each Helicobacter polypeptide.
- the dose of antibody to be used in this method can be readily determined by those of skill in the art. For example, it is indicated that a dosage can be characterized by a daily administration of between 100 and 1000 mg of antibody for one week; or a dose comprising 100 to 1000 mg of antibody administered three times a day for two to three days.
- a pharmaceutical composition comprising an antibody according to the invention can be produced according to the rules set out above for a composition comprising a protein or a polypeptide according to the invention. Likewise, identical medical indications apply.
- FIG 1 is a summary diagram of the protocol for preparing the membrane fractions I. II and III of H. pylori.
- Figure 2 presents the analysis of the membrane fractions I. II and III by electrophoresis on 10% polyacrylamide gel and staining with Coomassie blue. The samples deposited are: the membrane fraction I (column 2), the membrane fraction II (column 3), the membrane fraction III (column 4) and the molecular weight markers (column 1).
- Figure 3 presents the analysis by electrophoresis on 10% polyacrylamide gel and staining with Coomassie blue, proteins purified from a preparative gel (columns 3 to 7).
- the samples deposited are: the HpP1 fraction (column 3), the HpP2 fraction (column 4), the HpP4 fraction (column 5), the HpP5 fraction (column 6), the HpP6 fraction (column 7), the molecular weight markers (columns 1 and 8) and the membrane fraction I (column 2).
- Figure 4 presents the analysis of the fractions resulting from the passage on DEAE Sepharose, fractions 7 and 9 (obtained after elution on Q Sepharose). The fractions were separated by electrophoresis on 10% or 12.5% polyacrylamide gel and stained with Coomassie blue. The samples deposited are: fraction 7 (column 2A). fraction 7.1 (column 3 A), fraction 7.2 (column 4A), fraction 9 (column 2B). fraction 9.1 (column 3B), fraction 9.2 (column 4B). fraction 9.3 (column 5B) and the molecular weight markers (kDa) (column 1 A and IB).
- FIG. 5 shows, after electrophoresis on 10% polyacrylamide gel and staining with Coomassie blue, the electrophoretic profile of fraction D resulting from chromatography on a Q-Sepharose column of the membrane fraction III (column 3) and of the fraction From chromatography on column of S-Sepharose of fraction D (column 4).
- Column 1 corresponds to the molecular weight markers and column 2 to the membrane fraction III.
- the H. pylori ATCC 43579 strain is cultured in a liquid medium in a 10 L fermenter.
- a freezer of germs in glycerol is used to inoculate a 75 cm ⁇ bottle containing medium called "biphasic" (a solid phase in Colombia agar containing 6% fresh sheep blood and a liquid phase in soy trypticase containing 20% fetal calf serum).
- the liquid phase of this culture is used to inoculate several 75 cm 3 flasks in a biphasic medium in the absence of sheep blood.
- the liquid phase makes it possible to inoculate a biofermenter of 2 1 in a soy trypticase liquid medium containing beta cyclodextrin at 10 g / 1.
- This culture at OD 1.5-1.8 is inoculated in a 10 L fermenter in liquid medium. After 24 hours of culture, the bacteria are harvested by centrifugation at 4000 x g for 30 minutes at 4 ° C. A culture of 10 liters of H. pylori ATCC 43579 in a fermenter makes it possible to obtain approximately 20 to 30 g (wet weight) of bacteria.
- the pellet of germs obtained previously is washed with 500 ml of PBS (phosphate buffered saline; NaCl 7.650 g, disodium phosphate 0.724 g monopotassium phosphate 0.210 g for one liter; p ⁇ 7.2) per liter of culture. Then the germs are again centrifuged under the same conditions.
- PBS phosphate buffered saline
- NaCl 7.650 g disodium phosphate 0.724 g monopotassium phosphate 0.210 g for one liter; p ⁇ 7.2
- the bacterial pellet obtained (Cj) is resuspended in a 1% solution of OG (Sigma) (30 ml / liter of culture). The bacterial suspension is incubated for
- the pellet (C2) is kept for further processing.
- the precipitate formed during dialysis is recovered by centrifugation at 2
- the pellet (C2) obtained after centrifugation of the germs treated with the OG is resuspended in 20 mM Tris-HCl buffer pH 7.5 and 100 ⁇ M Pefabloc (buffer
- the procedure can be continued by a double washing of the C4 pellet to remove the peripheral membrane proteins.
- the C4 pellet is resuspended in 50 mM NaC03 buffer pH 9.5, Pefabloc and 100 ⁇ M (buffer B).
- the suspension is ultracentrifuged at 210,000 x g for 30 minutes at 4 ° C.
- the supernatant (S5) is eliminated then the pellet (C5) is washed and ultracentrifuged under the same conditions as above.
- the pellet (C ⁇ ) which essentially contains intrinsic membrane proteins, is stored at -20 ° C.
- fractions C4, C6 and C ⁇ 2d are hereinafter called membrane fractions I, II and III respectively.
- the profile of the membrane fraction I shows 7 major protein bands of respective molecular weights 87. 76, 67, 54, 50, 47 and 32-35 kDa (column 2).
- the band at 67 kDa corresponded to the B subunit of urease and the band at 54 kD corresponded to catalase.
- These two proteins are not found in the profile of fraction II (column 3) since washing in carbonate buffer eliminates the proteins weakly associated with the membrane.
- the protein profile of the membrane fraction III shows the presence of 4 major bands at 76, 67, 50 and 30 kDa (column 4).
- Electrophoresis is carried out on polyacrylamide gel according to the method of Laemmli (1970) with a gel of concentration of 5% and a separation gel of 10%.
- the membrane fraction is resuspended in buffer A, then diluted to half in the 2X sample buffer. The mixture is heated for 5 minutes to 95 ° C. About 19 mg of protein are deposited on a gel of dimension 16 x 12 cm and thickness 5 mm. Premigration is carried out at 50 V for 2 hours, followed by migration at 65 V overnight.
- the coloring of the gel with Coomassie R250 blue (0.05% in ultrafiltered water) allows good visualization of the bands.
- PMSF phenyl methyl sulfonyl fluoric acid
- Each pellet is taken up in 2 ml of 10 mM NaP04 solubilization buffer pH 7.0, 1 M Sarkosyl 0.1% NaCl, 100 ⁇ M PMSF, 100 ⁇ M Pefabloc and 6 M urea (buffer D).
- the solubilized sample is dialyzed successively against 100 ml of buffer D with 4 M urea and 0.1% of Sarkosyl, against 100 ml of buffer D with 2 M of urea and 0.5% of Sarkosyl and against 2 times 100 ml of buffer D without urea and 0.5% Sarkosyl. Dialysis is carried out for 1 hour with magnetic stirring at room temperature.
- the final dialysate is incubated for 30 minutes in an ice bath, then centrifuged at low speed for 10 minutes at 4 ° C (Biofuge A, Heraeus Sepatech). The supernatant is recovered, filtered on a Millipore filter at 0.45 ⁇ m and stored at -20 ° C.
- HpP1, HpP2 and HpP4 fractions are pure with a single band on gel for each of these fractions (at 87, 76 and 54 kDa respectively).
- the HpP5 fraction presents a high intensity band at 50 kDa slightly contaminated by a band at 47 kDa; similarly, the HpP6 fraction presents a high intensity band at 32 kDa slightly contaminated by a band at 35 kDa.
- the equilibration buffer NaCO ⁇ 50 mM pH 9.5, Pefabloc lOO ⁇ M and Zwittergent 3-14 0.1%) until absorbance at 280 nm is stabilized.
- Proteins are eluted by a gradient of 0.1 to 0.5 M NaCl in the equilibrium buffer (10 times V d ), followed by washing in equilibration buffer containing 0.5 and 1 M NaCl (2 times Vj).
- the collected fractions are analyzed by SDS-PAGE and pooled into different pools according to their electrophoretic profile, then stored at -20 ° C.
- the fractions are as follows:
- the protein balance shows that 53% of the proteins are eluted during the 0-0.5 M NaCl gradient. 14% of the proteins are not fixed on the column and 33% of the proteins are eluted during the NaCl 1 washing. M (Table 5). The proteins not fixed on the column, correspond to alkaline proteins positively charged at pH 7.5, while the proteins eluted in 1 M NaCl correspond to acid proteins highly charged at this pH.
- the column is washed, then equilibrated with the 50 mM Tris-HCl buffer pH 7.5, Pefabloc 100 ⁇ M and 0.1% Zwittergent 3-14.
- the chromatography is followed as above by UV detection at 280 nm at the outlet of the column. Fraction 7 dialyzed beforehand against the balancing buffer (Tris-HCl 50 mM pH 7.5.
- Pefabloc 100 ⁇ M and Zwittergent 3-14 0.1%) containing 10 mg of proteins is deposited on the DEAE Sepharose column.
- the column is washed in equilibration buffer until the absorbance at 280 nm is stabilized.
- the proteins are eluted by a gradient from 0 to 0.5 M NaCl in the equilibration buffer (10 times Vj), followed by washing with equilibration buffer containing 1 M NaCl (2 times x Vr).
- the collected fractions are analyzed by SDS-PAGE, then collected in different pools according to their protein profile and stored at -20 ° C. By SDS-PAGE, we show that fraction 7.1 (direct eluate) is of interest.
- fraction 9 containing 31 mg of proteins.
- SDS-PAGE SDS-PAGE it is shown that the fractions 9.1, 9.2 and 9.3 respectively eluted at 0.1 -0.25 M NaCl, 0.3 -0.4 M NaCl and 1 M NaCl are of interest.
- the membrane fraction I is dissolved in 50 mM NaC ⁇ 3 buffer pH 9.5 at room temperature for 30 min with stirring. The suspension is then centrifuged at 200,000 xg for 30 min at + 4 ° C. The supernatant is dialyzed against 50 mM NaPO 4 buffer pH 7.0 and then deposited on a column of SP-Sepharose previously equilibrated with this same buffer. After washing the column with the same buffer, the column is subjected to a 0-0.5 M NaCl gradient. The fraction eluted between 0.26 and 0.31 M contains the protein of 32 kDa. EXAMPLE 5 Preparation of hyperimmune sera against the HpP5 and HpP6 fractions.
- the anti-HpP5 antiserum reacts with the protein of 50 kDa isolated in fraction 9.2 obtained in Example 3.
- the anti-HpP6 antiserum reacts with the protein of 32 kDa isolated in the fraction eluted between 0.26-0, 31 M NaCl on SP-Sepharose, as obtained in Example 4.
- the immunization protocol described above can be used in a similar manner to produce antisera against each of the proteins purified in Example 3.
- the preparations obtained in these examples may advantageously be subjected to electrophoresis preparative on SDS-PAGE gel.
- the protein bands will be treated as above in order to obtain a preparation intended for immunization.
- Example IA A culture is carried out as described in Example IA.
- the washed bacterial pellet is resuspended in 50 mM sodium phosphate buffer p ⁇ 7.5 containing PMSF (phenvlmethylsulfonyl fluoride Sigma) 100 ⁇ M (buffer A) at a final concentration of 0.1 g (wet weight) per milliliter.
- the suspension is homogenized using an Ultraturrax type mixer.
- the bacterial cells are then broken by sonication with a device of the Sonifier type (Branson) equipped with a probe with a diameter of 1.8 cm. Sonication is done intermittently. 1 min of sonication and 1 min of rest on ice. A 10 min sonication is enough to completely break 5 g of suspended germs.
- the lysate thus obtained is centrifuged for 15 min at 4 ° C at 4,000 g.
- the supernatant is recovered then centrifuged again at 100,000 g for 30 min at 4 ° C.
- the supernatant from this second centrifugation (S2) is recovered for chromatographic purification.
- the S2 fraction prepared in this way retains about 90% of the total "catalase” enzymatic activity, as measured according to the technique of Hazell et al (supra) or Beers & Sizer. J. Biol. Chem. (1952) 195: 133.
- the fraction S2 is loaded onto an S-Sepharose column (Pharmacia) previously equilibrated with buffer A.
- the column is washed with the same buffer.
- the chromatography is followed with a UV detector at 280 nm for the proteins and by the enzymatic activity for the catalase. After elimination of the non-fixed proteins (the absorption at 280 nm returns to the baseline), the column is then washed with a NaCl gradient, 0 to IM in buffer A.
- the fractions corresponding to the peak of the activity catalase are collected, concentrated in an Amicon-type concentration cell equipped with a membrane, the cutoff threshold of which is 100,000 Daltons.
- the concentrated fraction thus obtained is loaded onto a Sephacryl S-300 HR column previously equilibrated with PBS buffer.
- the fractions containing catalase activity are collected, concentrated to 1 mg / ml and dialyzed against the PBS buffer.
- the final solution is filtered through a membrane with a porosity of 0.22 ⁇ m and stored at -70 ° C.
- Example 5 An anti-HpP5 anti-fraction serum as prepared in Example 5 is deposited on a Protein A Sepharose 4 Flast Flow column (Pharmacia) previously balanced in 100 mM Tris-HCl pH 8.0. The resin is washed with 10 column volumes of 100 mM Tris-HCl pH 8.0 and then with 10 column volumes of
- IgGs 10 mM Tris-HCl pH 8.0.
- IgGs are eluted in 0.1 M pH 3.0 glycine buffer.
- the IgGs are collected as 5 ml fractions to which 0.25 ml of 1 M Tris-HCl pH 8.0 is added.
- the optical density of the eluate is measured at 280 nm and the fractions containing the IgGs are combined and if necessary, frozen at -70 ° C.
- CNBr - activated Sepharose 4B gel (knowing that 1 g of dry gel gives approximately 3.5 ml of hydrated gel and that the capacity of the gel is 5 to 10 mg of IgG per ml of gel) manufactured by Pharmacia ( ref: 17-0430-01) is suspended in 1 mM NaCl buffer. The gel is then washed using a buchner by adding small amounts of 1 mM HCl. The total volume of 1 mM HCl used is 200 ml per gram of gel.
- the purified IgGs are dialyzed for 4 hrs at 20 + 5 ° C against 50 vol. 500 mM sodium phosphate buffer pH 7.5. They are then diluted in 500 mM sodium phosphate buffer pH 7.5 to a final concentration of 3 mg / ml.
- the IgGs are incubated with the gel overnight at 5 + 3 ° C with rotary shaking.
- the gel is placed in a chromatography column and washed with 2 vol. column of 500 mM phosphate buffer pH 7.5.
- the gel is then transferred to a tube and incubated in 100 mM ethanolamine pH 7.5 at room temperature with stirring. It is then washed by 2 vol. PBS column.
- the gel can be stored in PBS merthiolate 1 / 10,000.
- the amount of IgGs coupled to the gel can be determined by measuring the difference in optical density at 280 nm from the initial solution of IgGs and the direct eluate plus washes . 7.C - Adsorption and elution of the antigen
- a protein preparation of antigen in 50 mM Tris-HCl pH 8.0 2 mM EDTA for example the membrane fraction I or II (fraction C4 or C6 as obtained in Example 1 C and dissolved in zwittergent) is filtered through of a 0.45 ⁇ m membrane and is then deposited on the column equilibrated beforehand with 50 mM Tris-HCl pH 8.0 2 mM EDTA, at a flow rate of approximately 10 ml / hr. Then the column is washed with 20 vol. 50 mM Tris-HCl pH 8.0 2 mM EDTA. alternatively, the adsorption can be carried out in a bath; incubation is continued at 5 + 3 ° C overnight and with shaking.
- the gel is washed with 2 to 6 vol. 10 mM sodium phosphate buffer, pH 6.8.
- the antigen is eluted with 100 mM glycine buffer, pH 2.5.
- the eluate is collected in 3 ml fractions to which are added 150 ⁇ l of sodium phosphate buffer.
- Example 7 is repeated using the anti-fraction antiserum HpP6, in order to continue the purification of the fraction eluted between 0.26 and 0.31 M NaCl as described in Example 4.
- the fractions collected after elution and containing the protein are brought together in a single preparation; this is analyzed by electrophoresis on SDS Page 10% gel. A single band appears at 32 kDa.
- the biphasic medium comprises a solid phase consisting of 10 ml of Colombia agar (BioMérieux) supplemented with 6% fresh sheep blood and a liquid phase consisting of 3 ml of Trypticase soy broth (Difco) containing 20% fetal calf serum.
- the bottles are placed in a waterproof bag called “generbag” (BBL) and incubated with gentle rotary shaking at 37 ° C for 48 hours under microaerophilic conditions (8-10% C0 2 , 5-7% 0 2 and 85-87 % N 2 ) obtained by the System
- This 48 hour culture is used to re-inoculate vials containing biphasic medium.
- the initial absorbance of this culture at 600 nm must be between 0.15 and 0.2.
- the flasks are incubated under conditions identical to those described above.
- the bacterial suspension is transferred to a test tube.
- the absorbance of this culture is measured and it should be between 3.0 and 3.5 at 600nm.
- the appearance of the germs is checked under a microscope after staining with
- Example 5 An antiserum as obtained in Example 5 is filtered through a 0.45 ⁇ m membrane to remove the small aggregates if they exist before use.
- mice Groups of ten Swiss Webster mice aged 6 to 8 weeks (Taconic Labs. Germantown, NY) are immunized intragastrically with 1, 5, 25. 50 or 100 ⁇ g of the 54. 50 or 50 antigen 30 kDa purified by chromatography as described in Example 3; or 32 kDa antigen purified by chromatography as described in Example 4 or by immunoaffinity as described in Example 8; or 50 kDa antigen purified by immunoaffinity as described in Example 7 (preferred).
- the antigen is diluted in PBS or in PBS containing 0.24 M sodium bicarbonate.
- the antigen is supplemented with 5 or 10 ⁇ g of cholera toxin (CT) (Calbiochem, San Diego) or heat-labile toxin (LT) (Berna Products, Coral Gables FL).
- CT cholera toxin
- LT heat-labile toxin
- the mice are first anesthetized with isoflurane; then the dose is administered in a volume of approximately 0.5 ml using a cannula. Four doses are administered to each mouse 7-10 days apart. Two weeks after the last antigen administration, the mice are tested by a single dose of the H. pylori strain ORV2002 (1 ⁇ 10 7 of live bacteria in 200 ⁇ l of PBS; OD 550 of approximately 0.5) administered intragastrically. A group having received no dose of antigen and serving as a control is likewise tested.
- mice Two weeks after the test, the mice are sacrificed. The percentage of protection is determined either by measuring the urease activity or by evaluating the bacterial load by histology as described in Lee et al (supra) or directly by quantitative culture of H. pylori. Under these conditions, it is possible to observe for each of the proteins of 54, 50 30 and 32 kDa. a significant reduction in the infectious load in most mice immunized with 25 ⁇ g compared to the control group; this makes it possible to conclude that the antigens of 54, 50, 30 and 32 kDa of H. pylori are at least partially protective: the best results being obtained with the 32 kDa protein (100% protection) LIST OF SEQUENCES
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Veterinary Medicine (AREA)
- Biophysics (AREA)
- Oncology (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Communicable Diseases (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
L'invention a pour objet une protéine d'H. pylori sous forme substantiellement purifiée, susceptible d'être obtenue à partir d'une fraction membranaire d'H. pylori et dont le poids moléculaire après électrophorèse sur gel de polyacrylamide 10 % en présence de SDS apparaît de l'ordre de 54, 50, 32-35 ou 30 kDa.
Description
NOUVELLES PROTEINES MEMBRANAIRES O' HELICOBACTER PYLORI
La présente invention a pour objet des protéines d'Hélicobacter pylori nouvellement obtenues sous forme substantiellement purifiées, ainsi que les compositions pharmaceutiques qui les contiennent.
Helicobacter est un genre bactérien caractérisé par des bactéries spiralées à gram négatif. Plusieurs espèces colonisent le tractus gastrointestinal des mammifères. On cite en particulier H. pylori, H. heilmanii, H. felis et H. mustelae. Bien que H. pylori soit l'espèce la plus communément associée aux infections humaines, dans certains cas certes rares. H. heilmanii et H. felis ont pu être isolés chez l'homme.
Helicobacter infecte plus de 50 % de la population adulte dans les pays développés et près de 100 % de celle des pays en voie de développement ; ce qui en fait un des agents infectieux prédominants au plan mondial.
H. pylori est retrouvée exclusivement à ce jour à la surface de la muqueuse de l'estomac chez l'homme et plus particulièrement autour des lésions de cratère des ulcères gastriques et duodénaux. Cette bactérie est à l'heure actuelle reconnue comme l'agent étiologique des gastrites antrales et apparaît comme un des cofacteurs requis pour le développement des ulcères. Par ailleurs, il semble que le développement des carcinomes gastriques puisse être associé à la présence d'H. pylori.
II apparaît donc hautement souhaitable de mettre au point un vaccin en vue de prévenir ou de traiter les infections à H. pylori. Un tel vaccin serait très probablement de nature sous-unitaire.
Différentes protéines d'H. pylori ont été caractérisées ou isolées à ce jour. Il s'agit notamment de l'uréase, composée de deux sous-unités A et B de 30 et 67 kDa respectivement (Ηu & Mobley, Infect. Immun. (1990) 58 : 992 ; Dunn et al, J. Biol. Chem.
(1990) 265 : 9464 ; Evans et al. Microbial Pathogenesis (1991) 10 : 15 : Labigne et al. J.
Bact, (199) 173 : 1920) ; de la cytotoxine vacuolaire de 87 kDa (VacA) (Cover & Blaser. J.
Biol. Chem. (1992) 267 : 10570 ; Phadnis et al, Infect. Immun. (1994) 62 : 1557 ; WO 93/18150) ; d'un antigène immunodominant de 128 kDa associé à la cytotoxine (CagA. also called TagA) (WO 93/18150 ; USP 5 403 924) ; des heat shock protéines ΗspA et
HspB de 13 et 58 kDa respectivement (Suerbaum et al, Mol. Microbiol. (1994) 14 : 959 ; WO 93/18150) ; d'une catalase de 54 kDa (Hazell et al. J. Gen. Microbiol. (1991) 127 : 57) ; d'une hémaglutinine fibrillaire (HpaA) de 20kDa ; d'une protéine de 15 kDa riche en histidine (Hpn) (Gilbert et al, Infect. Immun. (1995) 63 : 2682) ; d'une protéine de la membrane externe de 30 kDa (Bôlin et al, J. Clin. Microbiol. (1995) 33 : 381) ; d'une lipoprotéine de 20 kDa associée à la membrane (Kostrcynska et al, J. Bact. (1994) 176 : 5938) ainsi que d'une famille de porines HopA, HopB, HopC et HopD, de poids moléculaires compris entre 48 et 67 kDa (Exner et al. Infect. Immun. (1995) 63 : 1567).
Certaines de ces protéines ont déjà été proposées comme antigènes vaccinaux potentiels. En particulier, l'uréase est reconnue comme étant un antigène de premier choix pouvant être utilisé à cette fin (WO 94/9823 ; WO95/3824 ; WO 95/22987 ; Michetti et al, Gastroenterology (1994) 107 : 1002). Il reste que la recherche de nouveaux antigènes doit être poursuivie, notamment dans la mesure où l'on prévoit que, pour obtenir un effet vaccinal optimisé, plusieurs antigènes devront être vraisemblablement incorporés dans un vaccin.
En résumé, il apparaît toujours nécessaire d'identifier des antigènes supplémentaires en vue de les incorporer dans un vaccin à forte efficacité.
C'est pourquoi l'invention a notamment pour objet une protéine d'H. pylori sous forme substantiellement purifiée, susceptible d'être obtenue à partir d'une fraction membranaire d'H. pylori, et dont le poids moléculaire après électrophorèse sur gel de polyacrylamide 10 % en présence de SDS, apparaît de l'ordre de 54, 50, 32-35 ou 30 kDa. Lorsque la protéine a un poids moléculaire d'environ 54 kDa on précise en outre qu'elle ne réagit pas avec un antisérum anti-catalase.
Un antisérum anti-catalase d'H. pylori peut être notamment préparé selon le procédé d'immunisation décrit dans l'Exemple 5 ci-après, en utilisant une préparation de catalase obtenue par chromatographie. tel que décrit dans l'Exemple 6.
Par "forme substantiellement purifiée", on entend que la protéine est séparée de l'environnement dans lequel elle existe de manière naturelle. Entre autres, il peut s'agir d'une préparation notamment dépourvue des protéines cytoplasmiques et périplasmiques d'H. pylori.
j -
La protéine membranaire dont le poids moléculaire apparent est de l'ordre de 54 kDa sceptible d'être obtenue par un procédé dans lequel :
(i) on procède à une extraction des bactéries H. pylori par du n-octyl β-D glucopyranoside 1%, suivie d'une centrifugation ;
(ii) on récupère un culot bactérien que l'on traite par du lysozyme et que l'on soumet à sonication, suivie d'une centrifugation ;
(iii) on récupère un culot de centrifugation que l'on soumet à un lavage en tampon
Tris ΗC1 20 mM pΗ 7,5, suivi d'une centrifugation ;
(iv) on récupère la fraction membranaire constituée du culot de centrifugation que l'on resuspend en milieu aqueux, avantageusement en tampon carbonate pΗ 9,5 contenant 5 % de zwittergent 3-14 ;
(v) on soumet la fraction membranaire à une chromatographie échangeuse d'anions sur colonne Q-Sépharose en gradient de NaCl 0 - 0,5 M, avantageusement dans un tampon carbonate pΗ 9,5 à 0,1 % de zwittergent 3-14, suivi d'un lavage en NaCl 1 M, avantageusement dans un tampon carbonate pΗ 9,5 à 0.1 % de zwittergent 3-14 ;
(vi) on récupère la fraction éluée en début de lavage en NaCl 1 M que l'on soumet à une chromatographie échangeuse d'anions sur colonne de DEAE Sépharose en gradient de NaCl 0 - 0,5 M, avantageusement en tampon Tris-ΗCl pΗ 7,5 à 0,1
% de zwittergent 3-14 (de manière avantageuse, la fraction en NaCl 1 M est d'abord dialysée contre du tampon Tris-ΗCl pΗ 7,5 à 0,1 % de zwittergent 3- 14) ; et
(vii) on récupère la fraction éluée en NaCl 0,1 - 0,25 M.
La protéine membranaire dont le poids moléculaire apparent est de l'ordre de 50 kDa sceptible d'être obtenue par un procédé dans lequel :
(i) on procède à une extraction des bactéries H. pylori par du n-octyl β-D glucopyranoside 1%, suivie d'une centrifugation ;
(ii) on récupère un culot bactérien que l'on traite par du lysozyme et que l'on soumet à sonication, suivie d'une centrifugation ;
(iii) on récupère un culot de centrifugation que l'on soumet à un lavage en tampon
Tris HCl 20 mM pH 7,5, suivi d'une centrifugation ;
(iv) on récupère la fraction membranaire constituée du culot de centrifugation que l'on resuspend en milieu aqueux, avantageusement en tampon carbonate pH 9,5 contenant 5 % de zwittergent 3-14 ;
(v) on soumet la fraction membranaire à une chromatographie échangeuse d'anions sur colonne Q-Sépharose en gradient de NaCl 0 - 0,5 M, avantageusement dans un tampon carbonate pH 9,5 à 0,1 % de zwittergent 3-14, suivi d'un lavage en NaCl 1 M, avantageusement dans un tampon carbonate pH 9,5 à 0,1 % de zwittergent 3-14 ;
(vi) on récupère la fraction éluée en début de lavage en NaCl 1 M que l'on soumet à une chromatographie échangeuse d'anions sur colonne de DEAE Sépharose en gradient de NaCl 0 - 0,5 M, avantageusement en tampon Tris-HCl pH 7,5 à
0.1 % de zwittergent 3-14 (de manière avantageuse, la fraction en NaCl 1 M est d'abord dialysée contre du tampon Tris-HCl pH 7.5 à 0,1 % de zwittergent 3- 14) ; et
(vii) on récupère la fraction éluée en NaCl 0,3 - 0,4 M.
La protéine membranaire dont le poids moléculaire apparent est de l'ordre de 30 kD sceptible d'être obtenue par un procédé dans lequel :
(i) on procède à une extraction des bactéries H. pylori par du n-octyl β-D glucopyranoside 1%, suivie d'une centrifugation ;
(ii) on récupère un culot bactérien que l'on traite par du lysosyme et que l'on soumet à sonication, suivie d'une centrifugation ;
(iii) on récupère un culot de centrifugation que l'on soumet à un lavage en tampon Tris HCl 20mM pH 7,5, suivi d'une centrifugation ;
(iv) on récupère la fraction membranaire constituée du culot de centrifugation que l'on resuspend en milieu aqueux, avantageusement en tampon carbonate pH 9,5 contenant 5 % de zwittergent 3-14 ;
(v) on soumet la fraction membranaire à une chromatographie échangeuse d'anions sur colonne Q-Sépharose en gradient de NaCl 0 - 0,5M, avantageusement dans un tampon carbonate pH 9.5 à 0, 1 % de zwittergent 3-14 ;
(vi) on récupère la fraction éluée en NaCl 0,28 - 0,35M, que l'on soumet à une chromatographie échangeuse d'anions sur colonne de DEAE Sépharose en gradient de NaCl 0 - 0,5M, avantageusement en tampon Tris-HCl pH 7,5 à 0,1 % de zwittergent 3-14 (de manière avantageuse, la fraction en NaCl 1 M est d'abord dialysée contre du tampon Tris-HCl pH 7,5 à 0,1 % de zwittergent 3- 14) ; et
(vii) on récupère la fraction correspondant à l'éluat direct (absence de NaCl).
La protéine membranaire dont le poids moléculaire apparent est de l'ordre de 32-35 kDa est susceptible d'être obtenue par un procédé dans lequel :
(i) on procède à une extraction des bactéries H. pylori par du n-octyl β-D glucopyranoside 1%, suivie d'une centrifugation ;
(ii) on récupère un culot bactérien que l'on traite par du lysozyme et que l'on soumet à sonication, suivie d'une centrifugation ;
(iii) on récupère un culot de centrifugation que l'on soumet à un lavage en tampon
Tris HCl 20 mM pH 7,5, suivi d'une centrifugation ;
(iv) on récupère la fraction membranaire constituée du culot de centrifugation que l'on resuspend en milieu aqueux, avantageusement en tampon carbonate pH 9.5;
(v) on centrifuge la suspension obtenue en (iv) à environ 200 000 xg et on récupère le surnageant ;
(vi) on abaisse le pH du surnageant obtenu en (v) jusqu'à environ pH 7, avantageusement par dialyse contre du tampon phosphate pH 7 ;
(vii) on soumet la préparation obtenue en (vi) à une chromatographie échangeuse de cations sur colonne de SP-Sépharose en gradient de NaCl 0 - 0,5 M, avantageusement dans un tampon phosphate pH 7 ; et
(viii) on récupère la fraction éluée en NaCl 0,26 - 0,31 M.
Les protéines de 54, 50, 32 et 30 kDa selon l'invention sont vraisemblablement des protéines membranaires intrinsèques ou des protéines associées à la membrane. La protéine de 54 kDa ne réagit pas avec des anticorps anti-catalase, ni en western blot, ni en dot blot. La protéine de 30 kDa ne réagit pas avec des anticorps anti-sous unité A de l'uréase, ni en western blot, ni en dot blot. La protéine de 32 kDa s'avère être une protéine alcaline ; son poids moléculaire peut apparaître légèrement supérieur e.g. de l'ordre de 35 kDa dans certaines conditions expérimentales.
La séquence N-terminale de la protéine de 50 kDa d'une souche d'H. pylori (ATCC 43579) est comme suit (code une lettre) : MKEKFNRTKPΗVNIGTIGΗVDΗ. Cette information n'exclue pas le fait que des protéines équivalentes susceptibles d'être purifiées selon le procédé indiqué ci-avant puissent avoir une séquence N-terminale légèrement différente, dans la mesure où elles seraient dérivées d'une autre souche bactérienne. Une telle différence refléterait en effet le phénomène de variance allélique communément rencontré au sein d'une même espèce. Par exemple, une espèce bactérienne est usuellement représentée par un ensemble de souches qui diffèrent entre elles par des caractéristiques alléliques mineures. Un polypeptide qui remplit la même fonction biologique dans différentes souches peut avoir une séquence d'acides aminés qui n'est pas la même pour toutes les souches. Une telle variation allélique se retouve également au niveau de l'ADN.
Les différences alléliques au niveau de la séquence d'acides aminés peuvent être constituées par une ou plusieurs substitutions, délétions ou additions d'acides aminés, qui n'altèrent pas la fonction biologique.
Par "fonction biologique" on entend la fonction de la protéine qui participe à la survie des cellules dans lesquelles la protéine existe de manière naturelle (même si la fonction n'est pas absoluement indispensable). Par exemple, la fonction d'une porine est de permettre à des composés présents dans le milieu extérieur d'entrer à l'intérieur de la cellule. La fonction biologique est distincte de la fonction antigénique. Une protéine peut avoir plus d'une fonction biologique.
L'invention a aussi pour objet une protéine sous forme substantiellement purifiée et susceptible d'avoir été purifiée selon un des procédés décrits ci-avant à partir d'une bactérie du genre Helicobacter e.g., H. pylori, H heilmanii, H. felis et H. mustelae.
L'invention a également pour objet tout autre protéine ou polypeptide, sous forme substantiellement purifiée, dans la mesure où il est analogue en terme d'antigénicité à une protéine d'Helicobacter susceptible d'être purifiée selon l'un des procédés décrits ci-avant. Pour ce qui concerne les polypeptides, il s'agit notamment de polypeptides dérivés par fragmentation ou par mutation d'un ou plusieurs acides aminés, e.g. par délétion. addition ou substitution, d'une protéine qui existe dans la nature et dont la forme purifiée peut être obtenue selon l'un des procédés décrits ci-avant. De tels polypeptides peuvent être notamment obtenus par digestion enzymatique à l'aide de protéases telles que la pepsine ou la trypsine. Il n'est pas nécessaire que de tels polypeptides puissent être purifiés selon l'un des procédés décrits ci-avant.
La présente description fait usage des termes "protéine" et "polypeptide" indépendamment de la taille des molécules (longueur de la chaîne d'acides aminés) et des éventuelles modifications post-traductionnelles. Dans la suite de la description le terme
"polypeptide" est réservé pour désigner un produit dérivé d'une protéine par fragmentation ou mutation.
Une protéine ou un polypeptide selon l'invention doit être capable d'être reconnu par des anticorps monospécifiques établis à rencontre d'une protéine d'Helicobacter susceptible d'être purifiée selon l'un des procédés décrits ci-avant Cette antigénicité spécifique peut être révélée selon un certain nombre de méthodes ; par exemple par
Western blot (Towbin et al, PNAS (1979) 76 : 4350), dot blot et ELISA.
En Western blot. le produit destiné à être testé, e.g. soit sous forme de préparation purifiée, soit sous forme d'extrait bactérien, est soumis à une électrophorèse en gel de SDS-
Page (polyacrylamide 10%) tel que décrit par Laemmli U.K., Nature ( 1970) 227 : 680. Après transfert sur une membrane de nitrocellulose, cette dernière est incubée avec un sérum hyperimmun monospécifique dilué dans la gamme des dilutions de 1 : 50 à 1 : 5000, de préférence de 1 : 100 à 1 : 500. L'antigénicité spécifique est démontrée dès qu'une bande correspondant au produit testé présente une réactivité à une des dilutions comprises dans la gamme établie ci-dessus.
En ELISA. le produit destiné à être testé est de préférence utilisé pour recouvrir les puits. On préfère utiliser une préparation purifiée, bien qu'un extrait total puisse être aussi utilisé. En bref, 100 μl d'une préparation à 10 μg de protéine/ml sont distribués dans les puits d'une plaque de 96 puits. La plaque est incubée 2 hrs à 37°C puis une nuit à 4°C. La plaque est lavée avec du tampon PBS (phosphate buffer saline) contenant 0,05 % de Tween 20 (tampon PBS/Tween). Les puits sont saturés avec 250 μl de PBS contenant 1 % de sérum albumine bovine (BSA). On laisse incuber 1 hr à 37°C puis la plaque est lavée avec du tampon PBS/Tween. Un antisérum de lapin monospécifique est dilué en série dans du tampon PBS/Tween contenant 0,5 % de BSA. Cent μl d'une dilution sont ajoutés à chaque puit. La plaque est incubée 90 min à 37°C puis lavée. La plaque est révélée selon des méthodes standards. Par exemple, un conjugué peroxydase-immunoglobuline de chèvre anti-immunoglobulines de lapin est ajouté dans les puits. L'incubation est poursuivie 90 min à 37°C puis la plaque est lavée. On développe la réaction avec le substrat approprié. La réaction est mesurée par colorimétrie (absorbance mesurée par spectrophotométrie). Dans ces conditions, une réaction positive est observée lorsque une valeur de DO de 1 est associée à une dilution d'au moins 1 : 50, de préférence d'au moins 1 : 500. La longueur d'onde appropriée à laquelle on mesure la densité optique dépend du substrat.
En dot blot, on préfère utiliser une préparation purifiée du produit à tester, bien qu'un extrait total puisse être aussi utilisé. En bref, une préparation du produit à tester à 100 μg de protéine/ml est diluée en série deux fois dans du Tris-HCl 50 mM pH 7,5. Cent μl de chaque dilution sont appliqués sur une membrane de nitrocellulose 0.45 μm dans un appareil de dot blot à 96 puits (Biorad). Le tampon est éliminé par mise sous vide. Les puits sont lavés par ajout de Tris-HCl 50 mM pH 7,5 et la membrane est séchée à l'air. La membrane est saturée par du tampon bloquant (Tris-HCl 50 mM pH 7.5, NaCl 0.15 M, lait écrémé 10 g/1) puis incubée avec un antisérum monospécifique dilué dans la gamme de 1 : 50 à 1 : 5000. de préférence de 1 : 50 à 1 : 500. La réaction est révélée selon des méthodes standards. Par exemple, un conjugué peroxydase-immunoglobuline de chèvre anti- immunoglobulines de lapin est ajouté dans les puits. L'incubation est poursuivie 90 min à
37°C puis la plaque est lavée. On développe la réaction avec le substrat approprié. La réaction est mesurée par colorimétrie ou chimioluminescence. Dans ces conditions, une réaction est positive lorsque l'on observe une coloration au niveau du dépôt sur la feuille de nitrocellulose directement pour révélation par colorimétrie ou sur film photographique pour révélation par chimioluminescence, associée à une dilution d'au moins 1 : 50, de préférence d'au moins 1 : 500.
Selon un mode particulier, une protéine selon l'invention peuvent être notamment obtenue par purification à partir d'Helicobacter ou exprimée par voie recombinante dans un système hétérologue (ce qui peut être aussi le cas pour un polypeptide selon l'invention).
Dans ce dernier cas. la protéine peut présenter des modifications post-traductionnelles qui ne soient pas identiques à celles de la protéine correspondante issue de la souche d'origine.
L'efficacité thérapeutique ou prophylactique d'une protéine ou d'un polypeptide selon l'invention peut être évalué selon des méthodes standards ; par exemple en mesurant l'induction d'une réponse immunitaire mucosale ou l'induction d'une réponse immunitaire à effet thérapeutique ou protecteur en utilisant e.g. le modèle souris / H. felis et les procédures décrites dans Lee et al, Eur. J. Gastroenterology & Ηepatology, (1995) 7 : 303 ou Lee et al, J. Infect. Dis. (1995) 172 : 161, à condition de prendre la précaution suivante : Lorsque la protéine est originaire d'une espèce autre que H. felis, la souche d'H. felis doit remplacée par une souche d'Helicobacter appartenant à l'espèce dont la protéine est originaire et adaptée à cet effet (les autres conditions expérimentales restant identiques). Par exemple, on teste la capacité d'un polypeptide dérivé par fragmentation d'une protéine d'H. pylori. à induire un effet protecteur ou thérapeutique, en substituant une souche d'H. pylori. Une telle souche est proposée par e.g. Kleanthous et al. Abstr. presented at the VlIIth International Workshop on Gastroduodenal Pathology 7-9th July 1995, Edinburgh, Scotland. Un effet protecteur est constaté dès lors qu'une infection dans le tissu gastrique est moindre par rapport à un groupe contrôle. L'infection est évaluée en testant l'activité uréase, la charge bactérienne ou l'infiltration leucocytaire. Par exemple, lorsque l'on constate après épreuve, une réduction de l'activité uréase dans le tissu gastrique, même si elle n'est pas complètement abolie on est en droit d'affirmer qu'il y a protection partielle.
Par conséquent l'invention concerne également (i) une composition de matière comprenant une protéine ou un polypeptide selon l'invention et un diluant ou un support ; en particulier (ii) une composition pharmaceutique notamment destinée à la prévention ou au traitement d'une infection à Helicobacter. qui comprend à titre de principe actif une
protéine ou un polypeptide selon l'invention, en quantité efficace d'un point de vue prophylactique ou thérapeutique ; (iii) l'usage d'une protéine ou un polypeptide selon l'invention à titre d'agent thérapeutique ou prophylactique ; (iv) l'usage d'une protéine ou un polypeptide selon l'invention pour la fabrication d'un médicament destiné à la prévention ou au traitement d'une infection à Helicobacter ; ainsi qu'(v) une méthode d'induction d'une réponse immunitaire à rencontre d'Helicobacter e.g., H. pylori, H. heilmanii, H. felis et H. mustelae chez un mammifère, selon laquelle on administre audit mammifère une quantité efficace d'un point de vue immunologique d'une protéine ou d'un polypeptide selon l'invention afin de développer une réponse immunitaire ; en particulier (vi) une méthode de prévention ou de traitement d'une infection à Helicobacterlle on administre à un individu une quantité prophylactiquement ou thérapeutiquement efficace d'une protéine ou d'un polypeptide selon l'invention.
Les méthodes et les compositions pharmaceutiques selon l'invention peuvent traiter ou prévenir des infections à Helicobacter et par conséquent, les maladies gastro- intestinales associées à de telles infections. Il s'agit en particulier, des gastrites aiguëes chroniques et atrophiques ; des ulcères peptiques e.g. des ulcers gastriques et duodénaux ; des cancers gastriques ; des dypepsies chroniques ; des dyspepsies non-ulcéreuses réfractaires ; des métaplasies intestinales et certains lymphomes ( e.g. low grade MALT lymphoma).
Une composition selon l'invention peut être administrée par n'importe quelle voie conventionnelle en usage dans le domaine des vaccins, en particulier au travers d'une surface mucosale (e.g. oculaire, nasale, orale, gastrique, intestinal, rectale, vaginale, ou du tractus urinaire) ou par voie parentérale (e.g. sous-cutanée, intradermique, intramusculaire, intraveineuse, ou intrapéritonéale). Le choix de la voie d'administration dépend d'un certain nombre paramètres tel que l'adjuvant associé à la protéine ou au polypeptide selon l'invention. Par exemple, si un adjuvant mucosal est utilisé, on préférera la voie nasale ou orale. Si on utilise une formulation lipidique, on choisira la voie parentérale, de préférence la voie sous-cutanée ou intramusculaire.
Une composition selon l'invention peut comprendre outre une protéine ou un polypeptide selon l'invention, au moins un autre antigène d'Helicobacter tel que l'apoenzyme de l'uréase. ou une sous-unité, fragment, homologue, mutant ou dérivé de cette uréase.
Pour usage dans une composition selon l'invention, une protéine ou un polypeptide selon l'invention peut être formulé dans ou avec des liposomes, de préférence des liposomes neutres ou anioniques, des microspères. des ISCOMs ou des pseudo-particules virales (VLPs), afin de favoriser le ciblage de la protéine ou du polypeptide ou d'augmenter la réponse immunitaire. L'homme du métier dispose de ces composés sans difficulté ; par exemple voir Liposomes : A Practical Approach, RRC New ED, IRL press (1990).
Des adjuvants autres que les liposomes peuvent être aussi utilisés. Un grand nombre sont connus de l'homme du métier. De tels adjuvants sont référencés ci -après :
Pour administration parentérale, on cite notamment des composés d'aluminium tels que l'hydroxyde d'aluminium, le phosphate d'aluminium et l'hydroxyphosphate d'aluminium. L'antigène peut être adsorbé ou précipité sur un composé d'aluminium selon des méthodes standards. D'autres adjuvants tels que le RIBI d'ImmunoChem (Hamilton, MT) peuvent être utilisés pour administration parentérale.
Pour administration mucosale, on cite notamment les toxines bactériennes e.g. la toxine cholérique (CT), la toxine d'E. coli labile à la chaleur (LT) la toxine de Clostridium difficile et la toxine pertussis (PT) ainsi que les formes détoxifiées (sous-unité, toxoid ou mutant) de ces toxines. Par exemple, une préparation contenant la sous-unité B de la CT (CTB) et en quantité moindre de la CT peut être utilisée. Des fragments, des homologues et des dérivés des ces toxines sont de même appropriés dans la mesure où ils conservent une activité d'adjuvant. De préférence, on utilise un mutant ayant une toxicité réduite. De tels mutants sont décrits e.g. dans WO 95/17211 (Arg-7-Lys CT mutant), WO 95/34323 (Arg- 9-Lys Glu-129-Gly PT mutant) et WO 96/6627 (Arg-192-Gly LT mutant). D'autres adjuvants tels que le lipopolysaccharide bactérien majeur (MPLA) de e.g. E. coli, Salmonella minnesota, Salmonella typhimurium ou Shigella flexneri, peuvent être utilisés pour administration mucosale.
Des adjuvants utiles à la fois pour administration mucosale et parentérale. incluent notamment le polyphosphazène (WO 95/2415). le DC-chol (3 bétâ-[N-(N'.N'-dimethyl aminométhane)-carbamoyl] cholestérol) (USP 5 283 185 et WO 96/14831) et le QS-21 (WO 88/9336).
L'administration peut avoir lieu en dose unique ou répétée une ou plusieurs fois après un certain délai. Le dosage approprié varie en fonction de divers paramètres, par exemple.
de l'individu traité (adulte ou enfant) de l'antigène vaccinal lui-même du mode et de la fréquence d'administration, de la présence ou absence d'adjuvant et si présent, du type d'adjuvant et de l'effet désiré (e.g. protection ou traitement), comme cela peut être déterminé par l'homme de l'art. En général, un antigène selon l'invention peut être administré en quantité allant de 10 μg à 500 mg, de préférence de 1 mg à 200 mg. En particulier, on indique qu'une dose parentérale ne doit pas excéder 1 mg, de préférence 100 μg. Des doses plus fortes peuvent être prescrites pour e.g. usage oral. Indépendamment de la formulation, la quantité de protéine administrée à l'homme par voie orale est par exemple, de l'ordre de 1 à 10 mg par prise, et l'on préconise au moins 3 prises à intervalle de 4 semaines.
Une composition selon l'invention peut être fabriquée de manière conventionnelle. En particulier on associe une protéine ou un polypeptide selon l'invention avec un diluant ou un support acceptable d'un point de vue pharmaceutique e.g. de l'eau ou une solution saline tel qu'un tampon de sel de phosphate (PBS), complémentée de manière optionnelle avec un sel de bicarbonate tel que du bicarbonate de sodium e.g. 0,1 à 0,5 M lorsque la composition est destinée à l'administration orale ou intragastrique. En général, le diluant ou le support est sélectionné sur la base du mode et de la voie d'administration et de pratiques pharmaceutiques standards. Des diluants et des supports acceptables d'un point de vue pharmaceutique ainsi que tout ce qui est nécessaire à leur usage dans des formulations pharmaceutiques sont décrits dans Remington's Pharmaceutical Sciences, un texte de référence standard dans ce domaine et dans le USP/NP.
De manière plus détaillée, on propose à titre d'exemple, d'administrer une protéine ou un polypeptide selon l'invention par voie orale. A cet effet, une protéine ou un polypeptide selon l'invention peut être encapsulée seule ou en présence d'autres protéines de H. pylori dans des capsules de gélatine afin de protéger l'antigène contre la dégradation par le suc gastrique ou bien administrée en présence de bicarbonate de sodium. De telles formulations ont déjà été utilisées pour des compositions pharmaceutiques (Black et al. Dev. Biol. Stand. (1983) 5_3 : 9). La protéine peut également être encapsulée dans des microsphères de
PLGA (copolymères d'acide glycolique et acide lactique) selon le protocole décrit ailleurs
(Eldridge et al, Curr. Top. Microbiol. Immuno. (1989) 146 : 59) la protéine peut également être incluse dans des liposomes préparés selon les méthodes conventionnelles largement décrites ("Liposomes : a practical approach. Ed. RRC New, D. Rickwood & B.D. Ηames. 1990, Oxford University Press. ISBN 0-19-963077-1).
De manière alternative, une protéine ou un polypeptide selon l'invention peut être administré par voie parentérale. Pour ce faire, une protéine ou un polypeptide selon l'invention est adsorbé sur gel d'alumine de façon tout à fait conventionnelle. La protéine en solution à 1 mg/ml dans un tampon dont le pH est voisin de 6,5 est mise en contact pendant 1 heure avec de l'hydroxyde d'aluminium à 10 mg/ml mesuré à AL"1-1"1". La composition finale de la préparation est la suivante : protéine 50 μg/ml, AL+++ 250 μg/ml, merthiolate 1/10 000, le tout en PBS.Comme dans le cas de l'administration orale, 3 injections sont préconisées chacune espacée de 4 semaines de la précédente.
Un polypeptide selon l'invention peut être aussi utile en tant que réactif de diagnostic, par exemple pour détecter la présence d'anticorps anti-Helicobacter dans un échantillon biologique e.g. un échantillon de sang. A cette fin, un tel polypeptide comprend de manière avantageuse 5 à 80 acides aminés, de préférence 10 à 50 acides aminés. Un réactif polypeptidique selon l'invention peut être marqué ou pas. selon la méthode de diagnostic mise en oeuvre. Des méthodes de diagnostic sont décrites plus avant dans le texte.
Selon un autre aspect, l'invention fournit un anticorps monospécifique capable de reconnaître une protéine ou un polypeptide selon l'invention.
Par "anticorps monospécifique" on entend un anticorps capable de réagir majoritairement avec une seule protéine d'Helicobacter. Un tel anticorps ne peut être obtenu qu'en utilisant une protéine substantiellement purifiée, comme immunogène. Un anticorps selon l'invention peut être polyclonal ou monoclonal ; les monoclonaux peuvent être chimériques (par exemple, constitués par une région variable d'origine murine associée à une région constante humaine) ou humanisée (seules les régions hypervariables sont d'origine animale, par exemple d'origine murine) et/ou par une chaîne simple. Les polyclonaux comme les monoclonaux peuvent aussi être sous forme de fragments d'immunoglobulines par exemple un fragment F(ab)'2 ou Fab. Un anticorps selon l'invention peut aussi être de n'importe quel isotype par exemple IgG ou IgA ; un polyclonal peut être d'un isotype unique ou un mélange de tous ou partie d'entre eux.
Dans la suite du texte, les termes "anticorps monospécifique" et "antisérum monospécifique" seront employés de manière indifférente.
Un anticorps qui est dirigé à rencontre d'une protéine selon l'invention, peut être produit et par la suite identifié en utilisant un dosage immunologique standard par exemple
analyse par Western blot, dot blot ou ELISA (voir par exemple Coligan et al, Current Protocols in Immunology (1994) John Wiley & sons Inc., New York, NY) ; Antibodies : A laboratory Manual, D. Lane, (1988) Harlow Ed.).
Un anticorps selon l'invention peut être utile en diagnostic, ainsi qu'en chromatographie d'affinité pour purifier à grande échelle, une protéine ou un polypeptide selon l'invention ; un tel anticorps est aussi potentiellement utile en tant qu'agent thérapeutique dans une procédure d'immunisation passive.
En conséquence, l'invention fournit également (i) un réactif pour détecter la présence d'Helicobacter dans un échantillon biologique, qui comprend un anticorps ou un polypeptide selon l'invention ; et (ii) une méthode de diagnostic pour détecter la présence d'Helicobacter dans un échantillon biologique, selon laquelle on met en contact l'échantillon biologique avec un anticorps ou un polypeptide selon l'invention, afin que se forme un complexe immun ; de façon optionnelle, on élimine le matériel non lié. et on détecte le complexe immun formé entre l'échantillon et l'anticorps ou le polypeptide selon l'invention, en tant qu'indicateur de la présence d'Helicobacter dans l'échantillon ou dans l'organe dans lequel l'échantillon a été prélevé.
Comme on peut aisément le comprendre, un anticorps selon l'invention permet de tester la présence d'Helicobacter dans un extrait gastrique.
Pour l'utilisation dans un test diagnostic, le réactif pour être présenté sous forme libre ou immobilisé sur support solide ; ce dernier peut être n'importe quel support utilisé couramment dans ce domaine par exemple, un tube, une bille ou un puits. L'immobilisation peut être obtenue par des moyens directs ou indirects. Les moyens directs comprennent l'adsorption passive (liaison non covalente) ou des liens covalents entre le support et le réactif. Par "moyen indirect" on signifie qu'un composé anti-réactif capable d'interagir un réactif, est tout d'abord attaché à un support solide. Par exemple, si on utilise un réactif polvpeptidique. un anticorps capable de le lier peut être utilisé comme anti-réactif, à condition qu'il puisse se lier à un épitope du polypeptide qui n'est pas impliqué dans la reconnaissance des anticorps présents dans les échantillons biologiques. Les moyens indirects peuvent aussi être mis en oeuvre par l'intermédiaire d'un système ligand- récepteur. par exemple en greffant une molécule, telle qu'une vitamine, sur un réactif polypeptidique et en immobilisant alors sous forme solide le récepteur correspondant. Ceci est illustré e.g. par le système biotine-streptavidine. De manière alternative, on utilise des
moyens indirects par exemple en ajoutant une queue peptidique au réactif e.g. par des moyens chimiques, et en immobilisant le produit greffé par adsorption passive ou par liaison covalente de la queue peptidique.
L'invention concerne également un procédé de purification d'une protéine ou d'un polypeptide selon l'invention à partir d'un échantillon biologique, selon lequel on soumet l'échantillon biologique à une chromatographie d'affinité mettant en oeuvre un anticorps monospécifique selon l'invention.
A cette fin, l'anticorps peut être polyclonal ou monoclonal, de préférence de type
IgG. Des IgGs purifiées peuvent être préparées à partir d'un antisérum selon les méthodes couramment pratiquées (voir par exemple Coligan et al).
Les supports de chromatographie conventionnels de même que des méthodes standard de greffe des anticorps sont décrites par exemple dans : Antibodies : A Laboratory Manual, D. Lane, Harlow Ed. (1988),
En bref, un échantillon biologique, de préférence dans une solution tampon, est appliqué à un matériel de chromatographie, de préférence équilibré avec le tampon utilisé pour la dilution de l'échantillon biologique afin que la protéine ou le polypeptide selon l'invention (antigène) puisse être adsorbé sur le matériel. Le matériel de chromatographie. tel qu'un gel ou une résine associé à un anticorps selon l'invention, peut se présenter sous la forme d'un bain ou d'une colonne. Les composants qui restent non-liés sont éliminés par lavage et l'antigène est alors élue dans un tampon d'élution approprié, comme par exemple, un tampon de glycine ou un tampon contenant un agent chaotropique e.g. la guanidine HCl, ou une concentration riche en sel (par exemple, MgCl2 3M). Les fractions éluées sont récupérées et la présence de l'antigène est alors mise en évidence par exemple en mesurant l'absorbance à 280 nm.
Un tel procédé de purification peut être par exemple mis en oeuvre pour purifier une protéine à partir d'un extrait total. Néanmoins, si l'anticorps n'est pas parfaitement monospécifique, il convient au préalable d'enrichir le matériel destiné à être soumis à la chromatographie d'immunoaffinité. en quantité de protéine à purifier. Par exemple, un tel procédé peut être mis en oeuvre pour parfaire la purification de la protéine de 32 kDa telle que obtenue selon le procédé décrit ci-avant comportant une étape de purification sur SP- Sépharose.
L'utilité thérapeutique ou prophylactique d'un anticorps selon l'invention peut mise en évidence selon le test de protection de Lee et al. proposé ci-avant pour les protéines ou polypeptides selon l'invention. Ainsi, l'invention a également pour objet (i) une composition de matière comprenant un anticorps monospécifique selon l'invention, et un diluant ou un support ; en particulier, (ii) une composition pharmaceutique comprenant un anticorps monospécifique selon l'invention en quantité efficace d'un point de vue thérapeutique ou prophylactique ; (iii) l'utilisation d'un anticorps monospécifique selon l'invention dans la préparation d'un médicament pour traiter ou prévenir une infection à Helicobacter ; ainsi que (iv) une méthode pour traiter ou prévenir une infection à Helicobacter (par exemple. H. pylori. H. felis, H. mustelae ou H. heilmanii), selon laquelle on administre une quantité thérapeutiquement ou prophylactiquement efficace d'un anticorps selon l'invention, à un individu ayant besoin d'un tel traitement.
A cette fin, l'anticorps monospécifique peut être polyclonal ou monoclonal, de préférence d'isotype IgA (d'une manière prédominante). Dans le cadre d'une méthode d'immunisation passive, l'anticorps est administré par voie mucosale à un mammifère, par exemple au niveau de la muqueuse gastrique, soit par voie orale ou intragastrique, avantageusement en présence d'un tampon bicarbonate. Un anticorps monospécifique selon l'invention peut être administré en tant que seul composant actif ou en mélange comprenant au moins un anticorps monospécifique particulier à chaque polypeptide d'Helicobacter. La dose d'anticorps qui doit être utilisée dans cette méthode peut être aisément déterminée par l'homme du métier. Par exemple, on indique qu'une posologie peut être caractérisée par une administration journalière comprise entre 100 et 1 000 mg d'anticorps pendant une semaine ; ou une dose comprenant 100 à 1 000 mg d'anticorps administrée trois fois par jour pendant deux à trois jours.
Une composition pharmaceutique comprenant un anticorps selon l'invention peut être fabriquée selon les règles énoncées ci-avant pour une composition comprenant une protéine ou un polypeptide selon l'invention. De même, s'appliquent des indications médicales identiques.
L'invention est illustrée ci-après par référence aux figures suivantes :
La Figure 1 est un schéma récapitulatif du protocole de préparation des fractions membranaires I. II et III d'H. pylori.
La Figure 2 présente l'analyse des fractions membranaires I. II et III par électrophorèse sur gel de polyacrylamide 10% et coloration au bleu de Coomassie. Les échantillons déposées sont : la fraction membranaire I (colonne 2), la fraction membranaire II (colonne 3), la fraction membranaire III (colonne 4) et les marqueurs de poids moléculaire (colonne 1).
La Figure 3 présente l'analyse par électrophorèse sur gel de polyacrylamide 10% et coloration au bleu de Coomassie, des protéines purifiées à partir d'un gel préparatif (colonnes 3 à 7). Les échantillons déposés sont : la fraction HpPl (colonne 3), la fraction HpP2 (colonne 4), la fraction HpP4 (colonne 5), la fraction HpP5 (colonne 6), la fraction HpP6 (colonne 7), les marqueurs de poids moléculaire (colonnes 1 et 8) et la fraction membranaire I (colonne 2).
La Figure 4 présente l'analyse des fractions issues du passage sur DEAE Sépharose, des fractions 7 et 9 (obtenues après elution sur Q Sépharose). Les fractions ont été séparées par électrophorèse sur gel de polyacrylamide 10% ou 12,5% et colorées au bleu de Coomassie. Les échantillons déposés sont : la fraction 7 (colonne 2A). la fraction 7.1 (colonne 3 A), la fraction 7.2 (colonne 4A), la fraction 9 (colonne 2B). la fraction 9.1 (colonne 3B), la fraction 9.2 (colonne 4B). la fraction 9.3 (colonne 5B) et les marqueurs de poids moléculaire (kDa) (colonne 1 A et IB).
La Figure 5 présente, après électrophorèse sur gel de polyacrylamide 10% et coloration au bleu de Coomassie, le profil électrophorétique de la fraction D issue de la chromatographie sur colonne de Q-Sépharose de la fraction membranaire III (colonne 3) et de la fraction D' issue de la chromatographie sur colonne de S-Sépharose de la fraction D (colonne 4). La colonne 1 correspond aux marqueurs de poids moléculaire et la colonne 2, à la fraction membranaire III.
EXEMPLE 1 : Préparation des fractions membranaires
IA - Culture
La souche H. pylori ATCC 43579 est cultivée en milieu liquide dans un fermenteur de 10 1.
Un congelât de germes en glycerol est utilisé pour ensemenser un flacon de 75 cm^ contenant du milieu dit "biphasique" (une phase solide en gélose Colombia contenant 6 % de sang de mouton frais et une phase liquide en trypticase de soja contenant 20 % de sérum de veau foetal). Après 24 heures de culture dans des conditions microaérophiles, la phase liquide de cette culture est utilisée pour ensemenser plusieurs flacons de 75 cm^ en milieu biphasique en l'absence de sang de mouton. Après 24 heures de culture, la phase liqude permet d'ensemenser un biofermenteur de 2 1 en milieu liquide trypticase soja contenant de la bêta cyclodextrine à 10 g/1. Cette culture à DO 1,5-1,8 est inoculée dans un fermenteur de 10 1 en milieu liquide. Après 24 heures de culture, les bactéries sont récoltées par centrifugation à 4000 x g pendant 30 minutes à 4°C. Une culture de 10 litres de H. pylori ATCC 43579 en fermenteur permet d'obtenir environ 20 à 30 g (poids humide) de bactéries.
IB - Extraction par le n octyl β-D glucopyranoside (OG)
Le culot de germes obtenu précédemment est lavé avec 500 ml de PBS (Phosphate buffer saline ; NaCl 7,650 g, phosphate disodique 0.724 g phosphate monopotassique 0,210 g pour un litre ; pΗ 7,2) par litre de culture. Puis les germes sont à nouveau centrifugés dans les mêmes conditions.
Le culot bactérien obtenu (Cj) est remis en suspension dans une solution d'OG (Sigma) à 1 % (30 ml/litre de culture). La suspension bactérienne est incubée pendant
1 heure à température ambiante sous agitation magnétique, puis centrifugée à 17 600 x g pendant 30 minutes à 4°C.
Le culot (C2) est conservé pour être traité par la suite.
Le surnageant (S2) obtenu est dialyse (MWCO=10 000 Da. Spectra/por) pendant une nuit à 4°C sous agitation magnétique contre 2 fois 1 litre de PBS dilué au 1/2. Le précipité formé au cours de la dialyse est récupéré par centrifugation à 2
600 x g pendant 30 minutes à 4°C. Le surnageant (S2d) est éliminé et le culot (Cs2d) 1u' contient des protéines de membrane est conservé à -20°C.
1C - Cassage des germes
Le culot (C2) obtenu après centrifugation des germes traités par l'OG est remis en suspension dans du tampon Tris-HCl 20 mM pH 7,5 et Pefabloc 100 μM (tampon
A) puis homogénéisé à l'aide de l'ultra-turrax (3821. Janke & Kungel). L'homogénat obtenu est mis en présence de lysozyme (0.1 mg/ml final) et d'EDTA (1 mM final).
L'homogénat est soniqué 3 fois 2 minutes à 4°C (φ sonde=0.5 cm, puissance=20%, Sonifier 450 Branson), puis ultracentrifugé à 210 000 x g pendant
30 minutes à 4°C. Le surnageant (S3) qui contient des protéines cytoplasmiques et périplasmiques, est éliminé, alors que le culot (C3) est récupéré, lavé en tampon A, puis ultracentrifugé à 210 000 x g pendant 30 minutes à 4°C. Après élimination du surnageant (S4), le culot (C4) est conservé à -20°C. Ce culot contient des protéines membranaires intrinsèques et périphériques.
La procédure peut être poursuivie par un double lavage du culot C4 pour éliminer les protéines membranaires périphériques. Le culot C4 est remis en suspension dans du tampon NaC03 50 mM pH 9,5, Pefabloc et 100 μM (tampon B). La suspension est ultracentrifugée à 210 000 x g pendant 30 minutes à 4°C. Le sumageant (S5) est éliminé puis le culot (C5) est lavé et ultracentrifugé dans les mêmes conditions que précédemment. Après élimination du surnageant (Sg), le culot (Cβ) qui contient essentiellement des protéines membranaires intrinsèques, est conservé à -20°C.
Les fractions C4, C6 et C§2d sont appelées par la suite respectivement fractions membranaires I, II et III.
ID - Analvse des fractions membranaires
Les différentes fractions membranaires sont analysées par électrophorèse sur gel de polyacrylamide en présence de SDS selon la méthode de Laemmli (1970). Les protéines sont visualisées après coloration au bleu de Coomassie.
Si on considère les protéines majeures de chaque fraction, les profils SDS-
PAGE (Figure 2) montrent que la fraction membranaire I est très proche de la fraction membranaire II. Par contre ces deux dernières diffèrent sensiblement de la fraction membranaire III.
Le profil de la fraction membranaire I présente 7 bandes protéiques majeures de poids moléculaires respectifs 87. 76, 67, 54, 50, 47 et 32-35 kDa (colonne 2). Par western blot en présence d'anticorps anti-ureB ou d'anticorps anti-catalase, on a montré que la bande à 67 kDa correspondait à la sous-unité B de l'uréase et la bande à 54 kD correspondait à la catalase. Ces deux protéines ne se retrouvent pas dans le profil de la fraction II (colonne 3) puisque le lavage en tampon carbonate élimine les protéines faiblement associées à la membrane. Quant au profil protéique de la fraction membranaire III. il montre la présence de 4 bandes majeures à 76, 67, 50 et 30 kDa (colonne 4).
EXEMPLE 2 : Purification des protéines de la fraction membranaire I par SDS-
PAGE préparative
Une électrophorèse est réalisée sur gel de polyacrylamide selon la méthode de Laemmli (1970) avec un gel de concentration de 5% et un gel de séparation de 10%. La fraction membranaire est remise en suspension dans du tampon A, puis diluée au demi dans le tampon échantillon 2X. Le mélange est chauffé 5 minutes à 95°C. Environ 19 mg de protéines sont déposés sur un gel de dimension 16 x 12 cm et d'épaisseur 5 mm. Une prémigration est effectuée à 50 V pendant 2 heures, suivie d'une migration à 65 V pendant la nuit. La coloration du gel au bleu de Coomassie R250 (0,05% dans de l'eau ultrafiltrée) permet une bonne visualisation des bandes.
Les bandes majeures HpPl, HpP2. HpP4. HpP5 et HpP6 sont découpées au scalpel et broyées à l'ultra-turrax en présence de 10 ou 20 ml de tampon d'extraction Tris-HCl 25 mM pH 8,8, urée 8 M, SDS 10%. phenyl methyl sulfonyl fluorique (PMSF) 100 μM et Pefabloc 100 μM (tampon C). Chaque broyât est filtré sur un préfiltre Millipore AP20 (φfiitre = 4-7 cm, φpore = 20 μm) à l'aide d'un extrudeur à une pression de 7 bars, à température
ambiante. Chaque broyât est lavé avec 5 à 10 ml de tampon C et filtré comme précédemment. Les deux filtrats obtenus à partir de chaque broyât correspondant sont rassemblés.
Chaque filtrat est précipité avec 3 volumes d'un mélange 50 : 50 méthanol 75% et isopropanol 75%, puis ultracentrifugé à 240 000 x g pendant 16 heures à 10°C sur rotor 70 TFT (J8-55, Beckman).
Chaque culot est repris par 2 ml de tampon de solubihsation NaPÛ4 10 mM pH 7,0, NaCl 1 M. Sarkosyl 0.1%, PMSF 100 μM, Pefabloc 100 μM et urée 6 M (tampon D). L'échantillon solubilisé est dialyse successivement contre 100 ml de tampon D à 4 M d'urée et 0,1% de Sarkosyl, contre 100 ml de tampon D à 2 M d'urée et 0.5% de Sarkosyl et contre 2 fois 100 ml de tampon D sans urée et à 0,5% de Sarkosyl. La dialyse est effectuée pendant 1 heure sous agitation magnétique à température ambiante. Le dialysat final est incubé pendant 30 minutes dans un bain de glace, puis centrifugé à faible vitesse pendant 10 minutes à 4°C (Biofuge A, Heraeus Sepatech). Le surnageant est récupéré, filtré sur filtre Millipore à 0,45 μm et conservé à -20°C.
Une analyse SDS-PAGE a été réalisée pour chaque fraction (Figure 3).
L'analyse du profil électrophorétique de chaque fraction montre que les fractions HpPl, HpP2 et HpP4 sont pures avec une seule bande sur gel pour chacune de ces fractions (respectivement à 87, 76 et 54 kDa). La fraction HpP5 présente une bande de forte intensité à 50 kDa légèrement contaminée par une bande à 47 kDa ; de même la fraction HpP6 présente une bande de forte intensité à 32 kDa légèrement contaminée par une bande à 35 kDa.
EXEMPLE 3 : Purification des protéines membranaires de 30, 50 et 54 kD à partir de la fraction membranaire I
3A - Chromatographie échangeuse d'anions sur Q-Sépharose
Une colonne de Q Sépharose de 40 ml (φ=2.5 cm. h=8 cm) est préparée selon les indications du fabricant (Pharmacia). La colonne est lavée, puis équilibrée avec le tampon NaCOβ 50 mM pH 9,5, Pefabloc 100 μM et Zwittergent 3-14 à 0.1%. La chromatographie a été suivie par une détection UV à 280 nm à la sortie de la colonne.
Cent quarante mg de protéines de la fraction membranaire I préalablement solubilisée sont déposées sur la colonne qui est ensuite lavée avec le tampon d'équilibrage (NaCOβ 50 mM pH 9,5, Pefabloc lOOμM et Zwittergent 3-14 0,1%) jusqu'à ce que l'absorbance à 280 nm soit stabilisée. Les protéines sont éluées par un gradient de 0,1 à 0,5 M de NaCl dans le tampon d'équilibre (10 fois Vj), suivi d'un lavage en tampon d'équilibrage contenant 0,5 et 1 M de NaCl (2 fois Vj). Les fractions collectées sont analysées par SDS-PAGE et rassemblées en différents pools selon leur profil électrophorétique, puis conservées à -20°C. Les fractions sont comme suit :
Le bilan protéique montre que 53% des protéines sont éluées au cours du gradient de NaCl 0-0,5 M. 14% des protéines ne se sont pas fixées sur la colonne et 33% des protéines sont éluées au cours du lavage en NaCl 1 M (tableau 5). Les protéines non fixées sur la colonne, correspondent à des protéines alcalines chargées positivement à pH 7,5, alors que les protéines éluées en 1 M NaCl correspondent à des protéines acides fortement chargées à ce pH.
La purification des fractions 7 et 9 est poursuivie comme suit.
3B - Séparation des protéines des fractions 7 et 9 par chromatographie échangeuse d'anions sur DEAE Sépharose
Une colonne de DEAE Sépharose est préparée selon les indications du fabricant (Pharmacia) pour un volume de gel d'environ 10 ml (φ=l,5 cm. h=5 cm) (maximal 10 mg protéine/ml de gel). La colonne est lavée, puis équilibrée avec le tampon Tris-HCl 50 mM pH 7,5, Pefabloc 100 μM et Zwittergent 3-14 à 0,1%. La chromatographie est suivie comme précédemment par une détection UV à 280nm à la sortie de la colonne.
La fraction 7 dialysée au préalable contre le tampon d'équilibrage (Tris-HCl 50 mM pH 7.5. Pefabloc 100 μM et Zwittergent 3-14 0,1%) contenant 10 mg de protéines, est déposée sur la colonne de DEAE Sépharose. La colonne est lavée en tampon d'équilibrage jusqu'à ce que l'absorbance à 280 nm soit stabilisée. Les protéines sont éluées par un gradient de 0 à 0,5 M de NaCl dans le tampon d'équilibrage (10 fois Vj), suivi d'un lavage en tampon d'équilibrage contenant 1 M de NaCl (2 fois x V-r). Les fractions collectées sont analysées par SDS-PAGE, puis rassemblées en différents pools selon leur profil protéique et conservées à -20°C. Par SDS-PAGE, on montre que la fraction 7.1 (éluat direct) est d'intérêt.
Une purification identique est reconduite avec la fraction 9 contenant 31 mg de protéines. Par SDS-PAGE on montre que les fractions 9.1, 9.2 et 9.3 respectivement éluées à 0,1 -0,25 M NaCl, 0,3 -0,4 M NaCl et 1 M NaCl sont d'intérêt.
Pour la fraction 7 (Figure 4A), les résultats obtenus montrent que seulement une protéine de 30 kDa (colonne 3 ; fraction 7.1) a été enrichie et partiellement séparée après passage sur la colonne de DEAE Sépharose, les autres protéines n'ont pas été séparées. Pour la fraction 9 (Figure 4B), les profils électrophorétiques montrent que deux protéines de 54 et 15 kDa (colonnes 3 et 5 ; fractions 9.1 et 9.3) ont été séparées et une protéine de 50 kDa a été enrichie (colonne 4 ; fraction 9.2). La protéine de 54 kDa de la fraction 9.1 ne réagit pas avec des anticorps anti-catalase.
EXEMPLE 4 : Purification de la protéine membranaire de 32 kDa à partir de la fraction membranaire I
La fraction membranaire I est solubilisée en tampon NaCθ3 50 mM pH 9,5 à température ambiante pendant 30 min sous agitation. La suspension est ensuite centrifugé à 200 000 xg pendant 30 min à +4°C. Le surnageant est dialyse contre du tampon NaPÛ4 50 mM pH 7.0 puis déposé sur une colonne de SP-Sépharose préalablement équilibré avec ce même tampon. Après lavage de la colonne avec ce même tampon, la colonne est soumise à un gradient de NaCl 0-0,5 M. La fraction éluée entre 0,26 et 0. 31 M contient la protéine de 32 kDa.
EXEMPLE 5 : Préparation de sérums hyperimmuns à rencontre des fractions HpP5 et HpP6.
Des sérums polyclonaux spécifiques des protéines membranaires majeures H. pylori sont obtenus par hyperimmunisation des lapins respectivement avec les antigènes purifiés par SDS-PAGE préparative HpP5 et HpP6. La première injection JO (sous-cutanée multisites et intramusculaire) est effectuée avec une préparation contenant 50 μg de protéine membranaire émulsionnée en adjuvant complet de Freund, puis les rappels J21 et J42 se font par injection de 25 μg de protéine membranaire en adjuvant incomplet de Freund. Les animaux sont sacrifiés à J60. Les sérums obtenus sont décomplémentés pendant 30 minutes à 56°C et stérilisés par filtration sur membrane de porosité 0,22 μm (Millipore).
L'antisérum anti-HpP5 réagit avec la protéine de 50 kDa isolée dans la fraction 9.2 obtenue dans l'Exemple 3. L'antisérum anti-HpP6 réagit avec la protéine de 32 kDa isolée dans la fraction éluée entre 0,26 - 0,31 M NaCl sur SP-Sépharose, telle qu'obtenue dans l'Exemple 4.
Bien évidemment, le protocole d'immunisation décrit ci-avant peut être utilisé de manière similaire pour produire des antisérums à l'encontre de chacune des protéines purifiées à l'Exemple 3. Les préparations obtenues dans ces exemples pourront être avantageusement soumises à une électrophorèse préparative sur gel de SDS-PAGE. Les bandes protéiques seront traitées comme précédemment afin d'obtenir une préparation destinée à l'immunisation.
EXEMPLE 6 : Purification d'une catalase à partir d'H. pylori
Une culture est réalisée comme décrit dans l'Exemple IA. Le culot bactérien lavé est remis en suspension dans du tampon phosphate de sodium 50 mM pΗ 7,5 contenant du PMSF (phenvlmethylsulfonyl fluoride Sigma) 100 μM (tampon A) à concentration finale de 0,1 g (poids humide) par millilitre. La suspension est homogénéisée à l'aide d'un mixeur de type Ultraturrax. Les cellules bactériennes sont ensuite cassées par sonication avec un appareil de type Sonifier (Branson) équipé d'une sonde de diamètre 1 ,8 cm. La sonication s'effectue par intermittence. 1 min de sonication et 1 min de repos sur glace. Une sonication de 10 min est suffisante pour casser complètement 5 g de germes en suspension. Le lysat ainsi obtenu est centrifugé pendant 15 min à 4°C à 4 000 g. Le surnageant est
récupéré puis, centrifugé à nouveau à 100 000 g pendant 30 min à 4°C. Le surnageant de cette deuxième centrifugation (S2) est récupéré pour une purification chromatographie. La fraction S2 préparée de cette façon conserve environ 90% de l'activité enzymatique "catalase" totale, telle que mesurée selon la technique de Hazell et al (supra) ou Beers & Sizer. J. Biol. Chem. (1952) 195 : 133.
La fraction S2 est chargée sur une colonne S-Sépharose (Pharmacia) préalablement équilibrée avec du tampon A. La colonne est lavée avec le même tampon. La chromatographie est suivie avec un détecteur UV à 280 nm pour les protéines et par l'activité enzymatique pour la catalase. Après élimination des protéines non-fixées (l'absorption à 280 nm revient à la ligne de base), la colonne est ensuite lavée avec un gradient de NaCl, 0 à IM dans du tampon A. Les fractions correspondant au pic de l'activité catalase sont recueillies, concentrées dans une cellule de concentration de type Amicon équipée de membrane dont le seuil de coupure est de 100 000 Daltons. La fraction concentrée ainsi obtenue est chargé sur une colonne Sephacryl S-300 HR préalablement équilibrée avec du tampon PBS. Les fractions contenant de l'activité catalase sont recueillies, concentrées à 1 mg/ml et dialysées contre le tampon PBS. La solution finale est filtrée sur une membrane de porosité 0,22 μm et conservée à -70°C.
La protéine ainsi purifiée présente les caractéristiques suivantes:
(i) Une activité enzymatique de catalase typique, en l'absence d'activité peroxydase.
(ii) Un spectre visible typique d'une hémoprotéine, un pic de Soret à 406 nm et les pics d'alpha et de bêta entre 520 nm et 550 nm.
(iii) Une forme monomerique à 54 kDa en SDS-PAGE avec la séquence N- terminale suivante: MVNKDVKQTTAFGAPVWDDNNVITAGPRG.
EXEMPLE 7 Purification de la protéine membranaire de 50 kDa par immunoaffinité
7.A - Purification des IgGs
Un sérum hyperimmun anti-fraction HpP5 tel que préparé dans l'Exemple 5, est déposé sur une colonne Protéine A Sépharose 4 Flast Flow (Pharmacia) préalablement équilibrée en Tris-HCl 100 mM pH 8.0. La résine est lavée par 10 volumes de colonne de Tris-HCl 100 mM pH 8.0 puis par 10 volumes de colonne de
Tris-HCl 10 mM pH 8.0. Les IgGs sont éluées en tampon glycine 0.1 M pH 3.0. Les IgGs sont collectées en tant que fractions de 5 ml auxquelles est ajouté 0.25 ml de Tris-HCl 1 M pH 8.0. La densité optique de l'éluat est mesurée à 280 nm et les fractions contenant les IgGs sont rassemblées et si nécessaire, congelées à -70°C.
7.B - Préparation de la colonne
Une quantité appropriée de gel CNBr - activated Sépharose 4B (sachant que 1 g de gel sec donne environ 3,5 ml de gel hydraté et que la capacité du gel est 5 à 10 mg d'IgG par ml de gel) fabriqué par Pharmacia (ref : 17-0430-01) est mis en suspension dans du tampon NaCl 1 mM. Le gel est ensuite lavé à l'aide d'un buchner en ajoutant de petites quantités d'HCl 1 mM. Le volume total d'HCl 1 mM utilisé est de 200 ml par gramme de gel.
Les IgGs purifiées sont dialysées pendant 4 hrs à 20 + 5°C contre 50 vol. de tampon phosphate de sodium 500 mM pH 7.5. Elles sont ensuite diluées en tampon phosphate de sodium 500 mM pH 7.5 à une concentration finale de 3 mg/ml.
Les IgGs sont incubées avec le gel pendant une nuit à 5 + 3 °C sous agitation rotative. Le gel est mis dans une colonne de chromatographie et lavé avec 2 vol. de colonne de tampon phosphate 500 mM pH 7.5. Le gel est alors transferré dans un tube et incubé en éthanolamine 100 mM pH 7.5 à la température ambiante sous agitation. Il est ensuite lavé par 2 vol. de colonne de PBS. Le gel peut être conservé en PBS merthiolate 1/10 000. La quantité d'IgGs couplées au gel peut être déterminé en mesurant la différence de densité optique à 280 nm de la solution initiale d'IgGs et de l'éluat direct plus les lavages.
7.C - Adsorption et élution de l'antigène
Une préparation protéique d'antigène en Tris-HCl 50 mM pH 8.0 EDTA 2 mM, par exemple la fraction membranaire I ou II (fraction C4 ou C6 telles qu'obtenue dans l'Exemple 1 C et solubilisée en zwittergent) est filtrée au travers d'une membrane de 0,45 μm puis est déposée sur la colonne équilibrée au préalable avec du Tris-HCl 50 mM pH 8.0 EDTA 2 mM, à un débit d'environ 10 ml/hr. Ensuite, la colonne est lavée par 20 vol. de Tris-HCl 50 mM pH 8.0 EDTA 2 mM. de manière alternative, l'adsorption peut être mise en oeuvre en bain ; l'incubation est poursuivie à 5 + 3°C pendant la nuit et sous agitation.
Le gel est lavé par 2 à 6 vol. de tampon phosphate de sodium 10 mM, pH 6,8. L'antigène est élue avec du tampon glycine 100 mM pH 2.5. L'éluat est récolté dans des fractions de 3 ml auxquelles sont ajoutés 150 μl de tampon phosphate de sodium
1 M, pH 8.0. La densité optique de chaque fraction est mesurée à 280 nm; les fractions contenant l'antigène sont rassemblées et conservées à -70°C. L'analyse par électrophorèse sur gel de SDS-Page 10 % révèle une seule bande à 50 kDa.
EXEMPLE 8 Purification de la protéine membranaire de 32 kDa par immunoaffinité
L'Exemple 7 est répété en utilisant l'antisérum anti-fraction HpP6, afin de poursuivre la purification de la fraction éluée entre 0,26 et 0, 31 M NaCl comme décrit dans l'Exemple 4. Les fractions collectées après élution et contenant la protéine sont rassemblées en une seule préparation ; celle-ci est analysée par électrophorèse sur gel de SDS Page 10 %. Une seule bande apparaît à 32 kDa.
EXEMPLE 9 Test d'agglutination
9.A - Culture
A partir d'une souche d'H. pylori n° ATCC 43579 (disponible auprès de l'ATCC. 12301 Parklawn Drive. Rockville MD - USA) conservée en glycerol à - 70 °C. on ensemence un flacon de 25 cm2 contenant un milieu biphasique. Le milieu biphasique comprend une phase solide constituée de 10 ml de gélose Colombia
(BioMérieux) additionnée de 6 % de sang de mouton frais et une phase liquide constituée de 3 ml de bouillon Trypticase soja (Difco) contenant 20 % de sérum de veau foetal. Les flacons sont placés dans un sac étanche dit "generbag" (BBL) et incubés sous agitation rotative douce à 37°C pendant 48 heures en condition de microaérophilie (8-10 % C02, 5-7 % 02 et 85-87 % N2) obtenu par le System
Microaer (BBL).
Cette culture de 48 heures est utilisée pour ensemencer de nouveau des flacons contenant du milieu biphasique. L'absorbance initiale de cette culture à 600 nm doit être comprise entre 0.15 et 0.2. Les flacons sont incubés dans des conditions identiques à celles décrites précédemment.
Après 48 heures, la suspension bactérienne est transvasée dans un tube à essai. L'absorbance de cette culture est mesurée et elle doit se situer entre 3,0 et 3,5 à 600nm. L'aspect des germes est contrôlé sous microscope après une coloration au
Gram.
9.B - Antisérums
Un antisérum tel qu'obtenu dans l'Exemple 5 est filtré sur une membrane 0,45 μm pour éliminer les petits agrégats s'il en existe avant utilisation.
9.C - Test d'agglutination
Sur une lame pour immunoprécipitation à fond noir (Prolabo réf. 10050), on dépose 20 μl d'eau physiologique dans le premier puit, 20 μl de sérum prélevé avant immunisation dans le puit central et 20 μl d'antisérum dans le troisième puits. Vingt μl de suspension bactérienne d'H. pylori sont ajoutés dans chacun des trois puits et on mélange ensuite les gouttes à l'aide d'une pipette Pasteur à bout rond fermé.
On observe sous une loupe miroir, l'apparition d'une agglutination 5 minutes maximum après avoir réalisé le mélange. L'agglutination est complète lorsque le mélange se présente sous la forme d'une solution limpide comprenant de gros agrégats. Les témoins négatifs, soit avec de l'eau physiologique, soit avec le sérum de pré-immunisation, doivent rester troubles, révélant que la suspension bactérienne est intacte.
Les antisérums anti-fraction HpP5 et anti-fraction HpP6 donnent une réaction d'agglutination très forte. Dans les conditions testées, les bactéries d'H pylori s'agglutinent rapidement et la réaction est complète après une minute. Les résultats indiquent que les protéines de 50 et 32 kDa sont vraisemblablement exposées à la surface d'H. pylori.
EXEMPLE 10 Mise en évidence de l'effet protecteur des protéines membranaires de de 54, 50, 30 et 32 kDa
Des groupes d'une dizaine de souris Swiss Webster âgées de 6 à 8 semaines (Taconic Labs. Germantown, NY), sont immunisés par voie intragastrique avec 1, 5, 25. 50 ou 100 μg de l'antigène de 54. 50 ou 30 kDa purifié par chromatographie tel que décrit à l'Exemple 3 ; ou de l'antigène de 32 kDa purifié par chromatographie tel que décrit à l'Exemple 4 ou par immunoaffinité tel que décrit dans l'Exemple 8 ; ou de l'antigène de 50 kDa purifié par par immunoaffinité tel que décrit dans l'Exemple 7 (préféré). L'antigène est dilué en PBS ou en PBS contenant 0,24 M de bicarbonate de sodium. L'antigène est supplémenté par 5 ou 10 μg de toxine cholérique (CT) (Calbiochem, San Diego) ou de heat-labile toxine (LT) (Berna Products, Coral Gables FL) . Les souris sont tout d'abord anesthésiées avec de l'isoflurane ; puis la dose est administrée sous un volume d'environ 0,5 ml à l'aide d'une canule. Quatre doses sont administrées à chaque souris à 7-10 jours d'intervalle. Deux semaines après la dernière administration d'antigène, les souris sont éprouvées par une dose unique de la souche H. pylori ORV2002 (1 x 107 de bactéries vivantes dans 200 μl de PBS ; DO550 de 0.5 environ) administrée par voie intragastrique. Un groupe n'ayant reçu aucune dose d'antigène et servant de contrôle est éprouvé de même. Deux semaines après l'épreuve, les souris sont sacrifiées. Le pourcentage de protection est déterminé soit en mesurant l'activité uréase ou en évaluant la charge bactérienne par histologie ainsi que cela est décrit dans Lee et al (supra) ou directement par culture quantitative d'H.pylori. Dans ces conditions, on est en mesure d'observer pour chacune des protéines de 54, 50 30 et 32 kDa. une réduction sensible de la charge infectieuse chez la plupart des souris immunisées avec 25 μg par rapport au groupe contrôle ; ceci permet de conclure que les antigènes de 54. 50. 30 et 32 kDa d'H. pylori sont au moins partiellement protecteurs : les meilleurs résultats étant obtenus avec la protéine de 32 kDa (100 % de protection)
LISTE DE SEQUENCES
(1) INFORMATIONS GENERALES:
(i) DEPOSANT:
(A) NOM: Pasteur Merieux sérums et vaccins
(B) RUE: 58 avenue Leclerc
(C) VILLE: Lyon (E) PAYS: France
(F) CODE POSTAL: 69007
(G) TELEPHONE: 72 73 79 31 (H) TELECOPIE: 72 73 78 50 (ii) TITRE DE L' INVENTION: Nouvelles protéines membranaires d'Helicobacter pylori
(iii) NOMBRE DE SEQUENCES: 2 (iv) FORME DECHIFFRABLE PAR ORDINATEUR:
(A) TYPE DE SUPPORT: Tape
(B) ORDINATEUR: IBM PC compatible
(C) SYSTEME D' EXPLOITATION: PC-DOS/MS-DOS
(D) LOGICIEL: PatentIn Release #1.0, Version #1.30 (OEB)
(2) INFORMATIONS POUR LA SEQ ID NO: 1 :
(i) CARACTERISTIQUES DE LA SEQUENCE: (A) LONGUEUR: 22 acides aminés
(B) TYPE: acide aminé
(C) NOMBRE DE BRINS: simple
(D) CONFIGURATION: linéaire (ii) TYPE DE MOLECULE: protéine
(iii) HYPOTHETIQUE: NON (iv) ANTI-SENS: NON (v) TYPE DE FRAGMENT: N-terminal (xi) DESCRIPTION DE LA SEQUENCE: SEQ ID NO: 1 :
Met Lys Glu Lys Phe Asn Arg Thr Lys Pro His Val Asn Ile Gly Thr 1 5 10 15 Ile Gly His Val Asp His 20
(2) INFORMATIONS POUR LA SEQ ID NO: 2:
(i) CARACTERISTIQUES DE LA SEQUENCE: (A) LONGUEUR: 29 acides aminés
(B) TYPE: acide aminé
(C) NOMBRE DE BRINS: simple
(D) CONFIGURATION: linéaire (ii) TYPE DE MOLECULE: protéine
(iii) HYPOTHETIQUE: NON (iv) ANTI-SENS: NON (v) TYPE DE FRAGMENT: N-terminal (xi) DESCRIPTION DE LA SEQUENCE: SEQ ID NO: 2:
Met Val Asn Lys Asp Val Lys Gin Thr Thr Ala Phe Gly Ala Pro Val 1 5 10 15 Trp Asp Asp Asn Asn Val Ile Thr Ala Gly Pro Arg Gly 20 25
Claims
1. Une protéine d'Helicobacter pylori sous forme substantiellement purifiée, susceptible d'être obtenue à partir d'une fraction membranaire d'H. pylori et dont le poids moléculaire après électrophorèse sur gel de polyacrylamide 10 % en présence de SDS, apparaît de l'ordre de 54, 50, 32-35 ou 30 kDa ; à condition que lorsque le poids moléculaire est de 54 kDa, la protéine ne réagisse pas avec un antisérum anti-catalase.
2. Une protéine selon la revendication 1 , dont le poids moléculaire apparent est de l'ordre de 54 kDa et qui est susceptible d'être obtenue par un procédé dans lequel :
(i) on procède à une extraction des bactéries H. pylori par du n-octyl β-D glucopyranoside 1%, suivie d'une centrifugation ;
(ii) on récupère un culot bactérien que l'on traite par du lysozyme et que l'on soumet à sonication, suivie d'une centrifugation :
(iii) on récupère un culot de centrifugation que l'on soumet à un lavage en tampon Tris ΗC1 20 mM pΗ 7,5, suivi d'une centrifugation :
(iv) on récupère la fraction membranaire constituée du culot de centrifugation que l'on resuspend en milieu aqueux ;
(v) on soumet la fraction membranaire à une chromatographie échangeuse d'anions sur colonne Q-Sépharose en gradient de NaCl 0 - 0.5 M, suivi d'un lavage en NaCl 1 M ;
(vi) on récupère la fraction éluée en début de lavage en NaCl 1 M que l'on soumet à une chromatographie échangeuse d'anions sur colonne de DEAE Sépharose en gradient de NaCl 0 - 0.5 M ; et
(vii) on récupère la fraction éluée en NaCl 0.1 - 0.25 M. 3. Une protéine selon la revendication 1, dont le poids moléculaire apparent est de l'ordre de 50 kDa et qui est susceptible d'être obtenue par un procédé dans lequel :
(i) on procède à une extraction des bactéries H. pylori par du n-octyl β-D glucopyranoside 1%. suivie d'une centrifugation ;
(ii) on récupère un culot bactérien que l'on traite par du lysozyme et que l'on soumet à sonication, suivie d'une centrifugation ;
(iii) on récupère un culot de centrifugation que l'on soumet à un lavage en tampon Tris ΗC1 20 mM pΗ 7,5, suivi d'une centrifugation ;
(iv) on récupère la fraction membranaire constituée du culot de centrifugation que l'on resuspend en milieu aqueux ;
(v) on soumet la fraction membranaire à une chromatographie échangeuse d'anions sur colonne Q-Sépharose en gradient de NaCl 0 - 0,5 M, suivi d'un lavage en NaCl 1 M ;
(vi) on récupère la fraction éluée en début de lavage en NaCl 1 M que l'on soumet à une chromatographie échangeuse d'anions sur colonne de DEAE Sépharose en gradient de NaCl 0 - 0,5 M ; et
(vii) on récupère la fraction éluée en NaCl 0,
3 - 0,4 M.
4. Une protéine selon la revendication 3, qui a pour séquence N-terminale la séquence d'acide aminés telle que montrée dans l'ID SEQ NO 1.
5. Une protéine selon la revendication 1, dont le poids moléculaire apparent est de l'ordre de 30 kDa et qui est susceptible d'être obtenue par un procédé dans lequel :
(i) on procède à une extraction des bactéries H. pylori par du n-octyl β-D glucopyranoside 1%, suivie d'une centrifugation ; (ii) on récupère un culot bactérien que l'on traite par du lysozyme et que l'on soumet à sonication, suivie d'une centrifugation ;
(iii) on récupère un culot de centrifugation que l'on soumet à un lavage en tampon Tris HCl 20 mM pH 7,5, suivi d'une centrifugation ;
(iv) on récupère la fraction membranaire constituée du culot de centrifugation que l'on resuspend en milieu aqueux ;
(v) on soumet la fraction membranaire à une chromatographie échangeuse d'anions sur colonne de Q-Sépharose en gradient de NaCl 0 - 0,5 M ;
(vi) on récupère la fraction éluée en NaCl 0,28 - 0.35 M, que l'on soumet à une chromatographie échangeuse d'anions sur colonne de DEAE Sépharose en gradient de NaCl 0 - 0,5 M ; et
(vii) on récupère la fraction correspondant à l'éluat direct (absence de NaCl).
6. Une protéine selon la revendication 1, dont le poids moléculaire apparent est de l'ordre de 32-35 kDa et qui est susceptible d'être obtenue par un procédé dans lequel :
(i) on procède à une extraction des bactéries H. pylori par du n-octyl β-D glucopyranoside 1%, suivie d'une centrifugation ;
(ii) on récupère un culot bactérien que l'on traite par du lysozyme et que l'on soumet à sonication, suivie d'une centrifugation ;
(iii) on récupère un culot de centrifugation que l'on soumet à un lavage en tampon Tris HCl 20 mM pH 7,5, suivi d'une centrifugation ;
(iv) on récupère la fraction membranaire constituée du culot de centrifugation que l'on resuspend en milieu aqueux, avantageusement en tampon carbonate pH 9,5;
(v) on centrifuge la suspension obtenue en (iv) à environ 200 000 xg et on récupère le surnageant ; (vi) on abaisse le pH du surnageant obtenu en (v) jusqu'à environ pH 7, avantageusement par dialyse contre du tampon phosphate pH 7 ;
(vii) on soumet la préparation obtenue en (vi) à une chromatographie échangeuse de cations sur colonne de SP-Sépharose en gradient de NaCl 0 - 0,5 M, avantageusement dans un tampon phosphate pH 7 ; et
(viii) on récupère la fraction éluée en NaCl 0.26 - 0,31 M.
7. Une protéine d'Helicobacter ou un polypeptide dérivé de la protéine par framentation et/ou mutation, sous forme substantiellement purifiée, qui est capable d'être reconnu par un antisérum établi à l'encontre d'une protéine selon l'une des revendications 1 à 6.
8. Une composition pharmaceutique destinée à la prévention ou au traitement d'une infection à H. pylori, qui comprend à titre de principe actif une protéine ou un polypeptide selon l'une des revendications 1 à 7.
9. Un anticorps monospécifique capable de reconnaître une protéine ou un polypeptide selon l'une des revendications 1 à 7.
10. Une composition pharmaceutique destinée à la prévention ou au traitement d'une infection à H. pylori, qui comprend à titre de principe actif un anticorps monospécifique selon la revendication 9.
1 1. Une méthode de diagnostic permettant de détecter la présence d'Helicobacter dans un échantillon biologique, selon laquelle on met en contact l'échantillon biologique avec un anticorps selon la revendication 9 ou un polypeptide selon la revendication 7, afin que se forme un complexe immun, on élimine de façon optionnelle, le matériel non lié, et on détecte le complexe immun formé entre l'échantillon et l'anticorps ou le polypeptide.
12. Un procédé de purification d'une protéine ou d'un polypeptide selon l'une des revendications 1 à 7, à partir d'un échantillon biologique, selon lequel on soumet l'échantillon biologique à une chromatographie d'affinité mettant en oeuvre un anticorps monospécifique selon la revendication 9.
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR9511890A FR2739622B1 (fr) | 1995-10-04 | 1995-10-04 | Nouvelles proteines membranaires d'helicobacter pylori |
| FR9511890 | 1995-10-04 | ||
| PCT/FR1996/001552 WO1997012909A1 (fr) | 1995-10-04 | 1996-10-04 | Nouvelles proteines membranaires d'helicobacter pylori |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP0793676A1 true EP0793676A1 (fr) | 1997-09-10 |
Family
ID=9483402
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP96933489A Withdrawn EP0793676A1 (fr) | 1995-10-04 | 1996-10-04 | Nouvelles proteines membranaires d'helicobacter pylori |
Country Status (10)
| Country | Link |
|---|---|
| EP (1) | EP0793676A1 (fr) |
| JP (1) | JPH10511116A (fr) |
| CN (1) | CN1173877A (fr) |
| AU (1) | AU724013B2 (fr) |
| CA (1) | CA2206797A1 (fr) |
| FR (1) | FR2739622B1 (fr) |
| HU (1) | HUP9900498A3 (fr) |
| NO (1) | NO972532L (fr) |
| NZ (1) | NZ319640A (fr) |
| WO (1) | WO1997012909A1 (fr) |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE19630390A1 (de) * | 1996-07-26 | 1998-01-29 | Chiron Behring Gmbh & Co | Proteine, insbesondere Membranproteine von Helicobacter pylori, ihre Herstellung und Verwendung |
| AU7166098A (en) * | 1997-04-25 | 1998-11-24 | Genelabs Technologies, Inc. | Antigenic composition and method of detection for (helicobacter pylor i) |
| JP3869556B2 (ja) * | 1998-06-15 | 2007-01-17 | 勇 近藤 | ヘリコバクター・ピロリ由来抗原及びそれを用いたヘリコバクター・ピロリ感染の診断方法 |
| JP5250812B2 (ja) * | 2006-04-27 | 2013-07-31 | 国立大学法人富山大学 | ヘリコバクター・ピロリ菌由来の新規抗原、抗原組成物およびピロリ菌抗体の検出方法。 |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE4139840B4 (de) * | 1990-12-04 | 2005-06-02 | Quidel Corp., San Diego | Antigen-Zubereitung zum Nachweis von H. pylori |
-
1995
- 1995-10-04 FR FR9511890A patent/FR2739622B1/fr not_active Expired - Fee Related
-
1996
- 1996-10-04 EP EP96933489A patent/EP0793676A1/fr not_active Withdrawn
- 1996-10-04 AU AU72203/96A patent/AU724013B2/en not_active Ceased
- 1996-10-04 JP JP9514037A patent/JPH10511116A/ja not_active Withdrawn
- 1996-10-04 CN CN96191777A patent/CN1173877A/zh active Pending
- 1996-10-04 NZ NZ319640A patent/NZ319640A/en unknown
- 1996-10-04 WO PCT/FR1996/001552 patent/WO1997012909A1/fr not_active Ceased
- 1996-10-04 HU HU9900498A patent/HUP9900498A3/hu unknown
- 1996-10-04 CA CA002206797A patent/CA2206797A1/fr not_active Abandoned
-
1997
- 1997-06-03 NO NO972532A patent/NO972532L/no not_active Application Discontinuation
Non-Patent Citations (1)
| Title |
|---|
| See references of WO9712909A1 * |
Also Published As
| Publication number | Publication date |
|---|---|
| FR2739622A1 (fr) | 1997-04-11 |
| AU7220396A (en) | 1997-04-28 |
| HUP9900498A3 (en) | 2001-03-28 |
| FR2739622B1 (fr) | 1997-12-05 |
| NO972532L (no) | 1997-07-30 |
| WO1997012909A1 (fr) | 1997-04-10 |
| HUP9900498A2 (hu) | 1999-06-28 |
| NO972532D0 (no) | 1997-06-03 |
| CN1173877A (zh) | 1998-02-18 |
| JPH10511116A (ja) | 1998-10-27 |
| AU724013B2 (en) | 2000-09-07 |
| NZ319640A (en) | 2000-02-28 |
| CA2206797A1 (fr) | 1997-04-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Cover et al. | Characterization of and human serologic response to proteins in Helicobacter pylori broth culture supernatants with vacuolizing cytotoxin activity | |
| US6054132A (en) | Purified vacuolating toxin from Helicobacter pylori and methods to use same | |
| EP0771214B1 (fr) | Traitement et prevention d'infections causees par les bacteries du genre helicobacter | |
| CA2111189A1 (fr) | Traitement par voie orale de l'infection a helicobacter | |
| CZ357397A3 (cs) | Antigeny Helicobacter pylori a vakcinační kompozice | |
| JPH11504633A (ja) | 多量体の組換えウレアーゼワクチン | |
| JP4368944B2 (ja) | 防御用ヘリコバクター抗原 | |
| CA2249746C (fr) | Antigenes de porphyromonas gingivalis pour le diagnostic et le traitement de periodontites | |
| US20020151462A1 (en) | Helicobacter pylori membrane proteins | |
| EP0797586A1 (fr) | NOUVELLE PROTEINE MEMBRANAIRE p76 D'HELICOBACTER PYLORI | |
| WO1997012909A1 (fr) | Nouvelles proteines membranaires d'helicobacter pylori | |
| RU2186582C2 (ru) | Способ выделения и очистки белка внешней мембраны moraxella catarrhalis, штамм м.catarrhalis для получения белка cd, изолированный и очищенный неденатурированный белок cd внешней мембраны м.catarrhalis и иммуногенная композиция, содержащая белок cd внешней мембраны м.сatarrhalis | |
| EP1475441B1 (fr) | Acides nucléiques et polypeptides spécifiques des souches pathogènes du genre Neisseria | |
| WO1983003354A1 (fr) | Vaccin anti-neisseria gonorrhoeae | |
| FR2633309A1 (fr) | Sequence d'adn codant pour la proteine p30 de toxoplasma gondii, produits d'expression de cette sequence, leurs procedes d'obtention et leurs applications | |
| FR2748478A1 (fr) | Nouvelle proteine membranaire d'helicobacter pylori | |
| MXPA97004109A (es) | Nuevas proteinas de membrana helicobacter pylori | |
| WO2011101790A1 (fr) | Antigenes polypeptidiques de trichinella, et leurs applications | |
| MXPA97004110A (es) | Nueva proteina de membrana helicobacter pylori p76 | |
| AU702878B2 (en) | Treatment and prevention of helicobacter infection | |
| FR2748477A1 (fr) | Nouvelle proteine membranaire d'helicobacter pylori | |
| RU2336900C2 (ru) | Белок nmb1125 и его применение в фармацевтических композициях | |
| Pal et al. | Electrophoretic mobility and immune response of outer membrane proteins of Vibrio cholerae O139 | |
| Borrow et al. | The immune response to a meningococcal 200 kDa surface exposed protein following carriage and disease | |
| CA2135800A1 (fr) | Compositions utiles pour le diagnostic et la prophylaxie de la maladie de lyme |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AT BE CH DE DK ES FI FR GB GR IE IT LI LU MC NL PT SE |
|
| 17P | Request for examination filed |
Effective date: 19971010 |
|
| 17Q | First examination report despatched |
Effective date: 20020319 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION HAS BEEN WITHDRAWN |
|
| 18W | Application withdrawn |
Effective date: 20040329 |