EP0626013A1 - $g(b)-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENES - Google Patents

$g(b)-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENES

Info

Publication number
EP0626013A1
EP0626013A1 EP93905393A EP93905393A EP0626013A1 EP 0626013 A1 EP0626013 A1 EP 0626013A1 EP 93905393 A EP93905393 A EP 93905393A EP 93905393 A EP93905393 A EP 93905393A EP 0626013 A1 EP0626013 A1 EP 0626013A1
Authority
EP
European Patent Office
Prior art keywords
lactamase
recombinant
sequence
nucleotide sequence
protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Withdrawn
Application number
EP93905393A
Other languages
German (de)
English (en)
French (fr)
Inventor
Brigitte Gicquel
Juliano Timm
Joaquim Trias
Colette Duez
Mariagrazia Perilli
Jean Dusart
Jean-Marie Frere
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Institut Pasteur
Original Assignee
Institut Pasteur
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Institut Pasteur filed Critical Institut Pasteur
Publication of EP0626013A1 publication Critical patent/EP0626013A1/fr
Withdrawn legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/02Bacterial antigens
    • A61K39/04Mycobacterium, e.g. Mycobacterium tuberculosis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/44Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from protozoa
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/74Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/78Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • C12N9/86Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5) acting on amide bonds in cyclic amides, e.g. penicillinase (3.5.2)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/61Fusion polypeptide containing an enzyme fusion for detection (lacZ, luciferase)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16111Human Immunodeficiency Virus, HIV concerning HIV env
    • C12N2740/16122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16211Human Immunodeficiency Virus, HIV concerning HIV gagpol
    • C12N2740/16222New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes

Definitions

  • Î-lactamase recom-binante usable as a carrier molecule for the preparation of immunogenic compositions.
  • the present application relates to new means for the preparation of immunogenic compositions and preferably protective vaccinating compositions, capable of being in the form of "live vaccines", of particles or molecules which can be administered to humans or animals. .
  • One of the aims of the present invention is to propose means for developing immunogenic compositions capable of triggering in humans or in animals a cellular and / or humoral immune response (by means of antibodies), against antigenic determinants and in particular epitopes characteristic of different pathogens. More generally, the invention proposes new means for triggering or promoting an immune response against any determined epitope for producing antibodies or a cellular immune response, and in particular when the antigenic determinants are of the hapten type and therefore incapable of triggering by themselves. same this immune response. The invention is also of interest in order to promote an immune response capable of being imparted by an antigen, and in particular to increase the level or the protective character thereof.
  • the invention describes in this regard new molecules capable of being used as a vector for the antigenicity of different epitopes, both in immunogenic compositions containing the hybrid (recombinant) molecules thus formed or in live vaccines.
  • Different factors can be decisive in the choice of a molecule, in particular a protein capable of behaving as a carrier protein (also called a vector) in order to confer or improve the immunogenicity of a heterologous epitope compared to to this molecule.
  • account must be taken of the size parameters of the vector protein as such and of its size relative to that of the epitope which it must contain as well as of the size of the epitope as such.
  • the inventors are interested in proteins of the / 3-lactamase family, some of the properties of which have been studied until now in a context different from that of the present invention.
  • 3-lactamases are enzymes divided into different classes, depending on their enzymatic activity on different substrates. They are produced by different organisms and in particular by bacteria, for example bacteria of the type E. coli, Staphylococcus aureus, or by mycobacteria. These enzymes are studied for their capacity to protect bacteria against the lethal effects of antibiotics of the / 3-lactams type, and therefore their capacity to confer on certain bacteria resistance to different antibiotics. It is in this context of studying the resistance of bacteria to antibiotics that several authors have published articles describing the purification of certain ⁇ -lactamases.
  • heterologous epitope is meant here an amino acid sequence characteristic of a protein and in particular of an antigen different from a / 3-lactamase, at the very least different from the / 3-lactamase chosen as carrier molecule.
  • the known properties of different / 3-lactamases such as the fact that they are exported and monomeric, as well as their structural properties are capable of conferring on them numerous advantages for being used as vector carriers of the antigenicity of different epitopes. They have also proved to be interesting in the context of the development of live vaccines.
  • the inventors determined the sequence and the structural organization of the gene and predicted by modeling the three-dimensional structure of the protein / 3- lactamase from a mycobacterium, Mycobacterium fortuitum (hereinafter referred to as M. fortuitum). Knowledge of this gene has made it possible to locate regions capable of containing between nucleotides 395 and 1274 of this sequence.
  • sequences corresponding to the preceding definitions are constituted by the nucleotide sequences cloned in the plasmids contained in the E. coli strains deposited at the C.N.C.M. under the numbers 1-1170 and 1-1171, as well as any nucleotide sequence hybridizing under stringent conditions with these cloned sequences.
  • the sequence shown in FIG. 4 contains the gene coding for M. fortuitum / 3-lactamase, as well as the non-coding parts.
  • the nucleotide sequence of the M. fortuitum / 3-lactamase gene is not the only sequence of interest in the context of the invention; indeed fragments or part of the sequence shown in Figure 4 can be interesting.
  • an advantageous nucleotide sequence in the context of the invention is the nucleotide sequence corresponding to the non-coding 5 'end of the ⁇ -lactamase gene, this sequence containing the expression signals for the gene for this enzyme.
  • This 5 ′ part of the gene sequence can be used for the expression of various nucleotide sequences in cellular hosts of the mycobacteria type. It is suitable for example for the expression in mycobacteria, of / 3-lactamases originating from organisms other than mycobacteria, since it contains expression signals recognized by mycobacteria.
  • fragments of the nucleotide sequence represented in FIG. 4 which can be used in the context of the invention, are the sequences coding for a 8 truncated protein whose overall structure is preserved, compared to the native protein, in particular under conditions such that the expression product of this nucleotide sequence is stable and in particular insensitive to the cellular proteases of the host which produces it and / or possibly the subject to which it is administered.
  • protein stability is meant in particular the possibility of purifying it or the possibility for this protein to be recognized by an antibody.
  • An advantageous nucleotide sequence is a sequence having similarities with the sequence shown in FIG. 4. By similarity is meant in particular the capacity to hybridize under stringent conditions with the sequence of FIG. 4.
  • a probe determined from the coding sequence represented in FIG. 5 with which one wishes to test the hybridization of a determined sequence; this probe is labeled with 32 p (10 6 cpm / ml) and it is brought into contact with the sequence tested for 16 hours at 65 ° C. in a hybridization solution (50% formamide, 5 ⁇ SSPE, sperm DNA salmon 200 ⁇ g / ml and 10 x Denhart).
  • a hybridization solution 50% formamide, 5 ⁇ SSPE, sperm DNA salmon 200 ⁇ g / ml and 10 x Denhart).
  • the membranes on which the hybridization is carried out are then washed twice for 30 minutes with a 1SSC solution, 0.1% SDS at room temperature (20 ° C.) and then washed twice with 0.1SSC, 0.1% SDS. for 30 minutes at
  • a nucleotide sequence of the invention is characterized in that it codes for a protein of the type / 3-lactamase comprising the amino acid chain shown in FIG. 4.
  • the invention further relates to a recombinant nucleotide sequence characterized in that it comprises: a nucleotide sequence corresponding to one of the preceding definitions, coding for a ⁇ -lactamase, modified by at least one heterologous nucleotide sequence coding for a peptide sequence heterologous comprising at least one epitope, the modification being carried out at at least one site allowing, when the recombinant sequence is expressed, the exposure of the epitope to the surface of / 3-lactamase or its accessibility to the solvent, a nucleotide sequence meeting the previous definitions, coding for a truncated ⁇ -lactamase, modified by at least one 10 heterologous nucleotide sequence encoding a heterologous peptide sequence comprising at least one epitope, the modification being carried out at at least one site allowing, when the recombinant sequence is expressed, the exposure of the epitope to the surface of the / 3-lactamase or
  • the exposure at the level of the recombinant protein, of the heterologous epitope corresponds to the accessibility of this epitope to the solvent, in particular to water molecules, or to the availability of this epitope to be presented to antibodies.
  • the nucleotide sequence coding for ⁇ -lactamase or for a truncated / 3-lactamase can be modified by at least one heterologous nucleotide sequence.
  • the size of the heterologous nucleotide sequence does not constitute an a priori limiting parameter, it is possible to envisage inserting several heterologous sequences within the sequence coding for / 3-lactamase or for a truncated ⁇ -lactamase .
  • heterologous sequences comprising at least one epitope and having a size of a few nucleotides may appear advantageous insofar as the problems which may result from a deformation of the modified / 3-lactamase encoded by the 11 recombinant nucleotide sequence of the invention are limited.
  • the hybrid thus formed retains the most important characteristics of its structure, in particular its capacity to be recognized by anti-/ 3-lactamase antibodies and anti-heterologous sequence antibodies, as well as its capacity to be purified.
  • a protein known as stable according to the invention exhibits at least one of the following properties: the enzymatic activity of / 3-lacta ⁇ tase, if necessary modified in intensity, the ability to be recognized by an antibody, in particular an anti-/ 3- antibody lacta ⁇ nase, or an antibody directed against a heterologous epitope which it contains, when it is a question of the recombinant protein or, an insensitivity to degradation by cellular proteases, the possibility of being purified.
  • a first group of heterologous sequences is characterized in that it comprises sequences coding for a peptide or a polypeptide, involved in the virulence of a pathogenic agent or in general for an antigen with protective potential against a 12 factor produced as a result of infection.
  • a sequence characteristic of a pathogenic organism is, for example, a sequence of virus, parasite, bacteria or fungus (for example of the genus Aspergillus).
  • the sequences of bacteria such as M. leprae, M. tuberculosis, M. intracellulare, M.
  • treponemes pertussis toxin, sequences of other microorganisms such as sporozoites and merozoites of plasmodium, sequences of Leishmania or Schistosoma, Shigella, Neisseria, Borrelia, sequences of viruses including the mumps virus, rubella, measles, herpes, influenza, rabies virus, polio, hepatitis, AIDS HIV, HTLV-I, HTLV-II and SIV as well as oncogenic viruses.
  • the nucleic acid sequence to be expressed can also code for an immunogenic sequence such as that of snake or insect venom.
  • an interesting heterologous nucleotide sequence is, for example, a sequence coding for a peptide sequence of a human retrovirus antigen of HIV type, in particular an envelope, gag, nave or pol antigen of an HIV- retrovirus. 1 or HIV-2.
  • an antigen is said to have "protective potential” when it is capable of triggering or promoting a response 13 protective immune system, in particular by production of antibodies or by induction of a cell-mediated immune response, in particular of the CTL type.
  • Such an antigen with protective potential can consist of an epitope or even a hapten insufficient in itself to trigger the immune response.
  • the invention thus allows the preparation of recombinant proteins of interest in particular for the constitution of immunogenic compositions, in which the epitope exposed on the surface of the recombinant protein is characteristic for example of a hormone, or of any substance which it is sought to attenuate or even neutralize the biological effects.
  • a recombinant nucleotide sequence may consist of a nucleotide sequence coding for / 3-lactamase or a truncated ⁇ -lactamase, as described above in which a heterologous sequence coding for the peptide sequence V3 of the envelope antigen would be inserted.
  • a heterologous sequence coding for the peptide sequence V3 of the envelope antigen would be inserted.
  • different HIV-1 variants or a larger sequence of the envelope of an HIV virus This sequence has been described in the publication by K. Javaherian et al. (Proc. Natl. Acad. Sci. USA 8_6: 6768-6772, 1989).
  • the heterologous sequence coding for the V3 peptide sequence is inserted at the BglII site of the sequence coding for ⁇ -lactamase.
  • the invention also relates to a recombinant • cloning and / or expression, replicative or integrative vector characterized in that it is modified, in one of its non-essential sites for its replication or its integration, by a nucleotide sequence recombinant described above. 14
  • the recombinant nucleotide sequence contained in the vector is under the control of the expression promoter of / 3-lactamase corresponding to the sequence.
  • this vector When this vector is modified by the coding sequence alone or by a partial coding sequence for / 3-lactamase, it may also include expression, translation and even secretion signals, of origin different from that of ⁇ - lactamase, chosen according to the host in which one seeks to clone or express this recombinant vector.
  • a plasmid of the invention is the plasmid pACYC184BlaM containing the SphI fragment of the sequence of the / 3-lactamase of M. fortuitum presented in FIG. 4, and which is deposited at the C.N.C.M. (National Collection of Microorganisms, Paris, France) in an E.coli HB101 strain (pACYC184BlaM), under the number 1-1171 deposited on February 11, 1992.
  • the plasmid pACYC184BlaM contains the Sphl / SphI fragment, of about 4.7 kb, of the genomic DNA of M. fortuitum D316 hybridizing with the BlaOl probe. This fragment carries the first 834 bases of the gene coding for a class A / 3-lactamase, as well as its regulatory regions.
  • the culture medium recommended for this strain is an L-Broth medium plus chloramphenicol (30 ⁇ g / ml) and the seeding is carried out on L-Broth medium, the incubation temperature being approximately 37 ° C. with stirring.
  • Another preferred plasmid according to 1 st invention contains the gene of the / 3-lactamase M. fortuitum; he 15 This is the plasmid pIPJ39 contained in a strain of E.coli MC1061 (pIPJ39), deposited at the CNCM on February 11, 1992 under the number 1-1170.
  • Plasmid pIPJ39 contains the approximately 6 kb BamHI / BamIII fragment of the genomic DNA of M. fortuitum FC1 hybridizing with the BlaOl probe. This fragment carries the gene coding for a class A / 3-lactamase, as well as flanking regions.
  • the culture medium recommended for this strain is an L-Broth medium plus ampicillin (100 ⁇ g / ml) and the seeding is carried out with an L-Broth medium and the incubation temperature is approximately 37 ° C. with stirring.
  • the subject of the invention is also a recombinant cellular host, characterized in that it is transformed by a recombinant nucleotide sequence described above or by a recombinant vector above, under conditions allowing the expression of the recombinant nucleotide sequence under the form of a stable fusion protein and its exposure or export to the surface of the host or its secretion into the extracellular medium.
  • Many cellular hosts can be modified by a recombinant nucleotide sequence or a recombinant vector according to the invention.
  • a suitable method for the preparation of recombinant cellular hosts according to the invention is for example 1 electroporation, in accordance with the description of Snapper S. et al (1988, PNAS USA 85: 6985-6991) or the conjugation according for example the technique of Lazraq R. et al (1990, FEMS Microbiol. Lett. 69_: 135-138), or according to the technique of Gormley EP and Davies J. (J. Bacteriol, 173: 6705-6708).
  • mycobacteria will be used when the sequence coding for ⁇ -lactamase is a sequence originating in mycobacterium.
  • the transfer into a strain of mycobacteria of the gene coding for a / 3-lactamase of mycobacterium makes it possible to facilitate the expression of this sequence, insofar as the recognition and expression, and even secretion, signals contained in the ⁇ -lactamase gene are recognized by the host mycobacteria.
  • a strain of Actinomycetes and in particular an avirulent or made avirulent strain can be used, ensuring that the recognition signals are suitable for the expression of the recombinant sequence or of the recombinant vector introduced into the strain. .
  • the invention therefore relates to a strain of BCG, transformed by a recombinant nucleotide sequence or a recombinant vector of the invention allowing exposure to the surface of the cell of a recombinant protein (hybrid protein), under conditions ensuring the exposure of the epitope or epitopes against which one seeks to induce an immune response.
  • a recombinant protein hybrid protein
  • a hybrid protein is said to be exposed when it is extracellular but remains anchored at a point on the surface of the cell that produces it.
  • the nucleotide sequences of the invention will be expressed in such a way that the expression products are secreted outside the cell which produces them and consequently released into the medium. 17
  • cellular hosts are bacteria, a non-virulent E. coli strain, or a non-virulent strain of enterobacterium such as avirulent salmonella, since the recombinant nucleotide sequence or the above recombinant vector , transforming the bacteria, is placed under the control of expression signals recognized by this bacteria.
  • fungi such as Aspergillus.
  • Other systems for the expression of the recombinant ⁇ -lactamase according to the invention can for example be constituted by animal cells, for example insect cells or mammalian cells such as CHO cells.
  • the vectors specific to the insertion of DNA or 1 ⁇ DNC or even RNA into these cells can be viruses, or plasmids.
  • Other systems such as yeast systems such as Saccharomyces Cerevisiae may also be suitable.
  • exposed site is meant a site which allows access or recognition of the heterologous peptide sequence and in particular access to the epitope or epitopes or their recognition, in order to obtain an immune response.
  • An exposed site is 18 either a site on the surface of the protein / 3-lactamase or a site contained in this protein whose epitope remains recognized by the antibodies, for example even when the protein is denatured.
  • the heterologous peptide sequence is inserted upstream of a site normally not exposed on the surface of the ⁇ -lactamase protein, this site being exposed due to the insertion of the heterologous sequence, for example following a folding resulting from interactions between the protein / 3-lactamase and the heterologous sequence.
  • a heterologous peptide sequence is inserted into the M. fortuitum ⁇ -lactamase in the region forming the junction between the ⁇ 2 helix and the ⁇ 3 helix of the ⁇ -lactamase.
  • Other preferred insertion sites are formed by the regions between the ⁇ 2 sheet and the ⁇ 2 helix, between the o: 3 helix and the ⁇ 4 helix or even between the ⁇ 4 sheet and the ⁇ 5 sheet.
  • the heterologous sequence can also be inserted into the C-terminal part of the sequence of ⁇ -lactamase.
  • the location of the ⁇ helices and ⁇ sheets giving them their structure will advantageously be determined, relative to the data obtained for the ⁇ -lactamase from S. aureus.
  • the insertion is carried out in such a way that the heterologous peptide sequence is accessible to the water molecules of the environment.
  • heterologous sequences capable of being inserted into the ⁇ -lactamase or into a truncated ⁇ -lactamase are the sequences which have been described above in the part which relates to the nucleotide sequences. These are, for example, sequences of the HIV retrovirus, in particular sequences of the envelope glycoprotein, the gag, nef or pol proteins, of an HIV-1 or HIV-2 retrovirus. By way of example, mention may be made of the V3 peptide of the HIV-1 envelope.
  • the invention allows the production of recombinant ⁇ -lactamase proteins in which the insertion of the heterologous sequence comprising the epitope is accompanied by a deletion of part of the ⁇ - 20 lactamase.
  • the invention also allows, according to an advantageous embodiment, the insertion of the heterologous sequence without deletion at the level of ⁇ -lactamase.
  • this insertion can be carried out at the C-terminal end of the ⁇ -lactamase, without deletion at the level of the sequence of the latter.
  • the invention also relates to an immunogenic composition characterized in that it comprises a recombinant BCG strain described above, in combination with a pharmaceutical vehicle ent suitable for its administration to humans or animals.
  • Such a composition is capable of constituting a live vaccine. It can be administered by injection or by any other suitable route.
  • Such an immunogenic composition can be used to trigger the immune response, for example to trigger the cellular response and optionally to trigger the production of protective antibodies, or even to contribute to the production of these antibodies in a host to which it is administered.
  • the invention relates not only to the manufacture of vaccinating compositions which can be administered to humans but also to the preparation of compositions for the purposes of vaccination in veterinary medicine.
  • the immunogenic composition of the invention can also be used as a booster composition to stimulate the production of antibodies initiated by the administration of a protein or of another constituent of the pathogenic agent or more generally of The agent against which an immune response is sought.
  • the invention relates to an immunogenic composition characterized in that the strain 21 recombinant it contains as active ingredient is a strain M. bovis type BCG meeting the definitions given above.
  • a particular BCG strain is the avirulent strain of INSTITUT PASTEUR No. 1137P2, used for the commercialized vaccine against tuberculosis.
  • immunogenic compositions of the invention As a pharmaceutical vehicle suitable for the production of the immunogenic compositions of the invention, mention may be made of the physiological excipients that are usually acceptable, in particular neutral or acid excipients and for example magnesium stearate, polyvinyl pyrrolidone or alcohols.
  • This immunogenic composition can also comprise adjuvants of the immune response such as Freund's complete or incomplete adjuvant, aluminum hydroxide, muramyl dipeptide derivatives, a metabolizing oil such as squalene.
  • Another immunogenic composition of the invention is characterized in that it comprises a recombinant protein corresponding to the above definitions, in combination with a pharmaceutical vehicle suitable for its administration.
  • This composition like the immunogenic composition forming the live vaccine, can be used to trigger the immune response or in the form of a booster composition.
  • Plasmid pACYC184 recombined with an insert of approximately 4.7 kb from the ⁇ lactamase gene
  • Plasmid pIPJ39 recombined with the ⁇ lactamase gene
  • nucleotide sequence is indicated in capital letters and is numbered in the right column.
  • the peptide sequence of ⁇ -lactamase is indicated with the three-letter code under the corresponding nucleotide sequence. The numbering is indicated below the sequence.
  • the nucleotide sequence from ntl to ntl061 was determined from the plasmid pIPJ319.
  • MF Mycobacterium fortuitum SA: Streptomyces albus AU: Staphylococcus aureus
  • the different ⁇ helices and ⁇ sheets are indicated by rectangles. This figure also shows the nucleotide sequence and the position of several restriction sites.
  • the plasmid pAL817 is a derivative of pAL5000 and is described in the publication Ranes et al, J. Bacteriol. 172: 2793-2797 (1990).
  • the cassette containing the kanamycin resistance gene of the transposon Tn903 and the plasmid pSL1180 come from the company Pharmacia.
  • the amplification of the V3 fragment is made from the plasmid pTG5167 supplied by Transgene.
  • the plasmid pIPJ42 is a derivative of pIPJ39 where the BglII / BamHI fragment, corresponding to the promoter and the aminoterminal fragment of the gene coding for the beta-lactamase of Mycobacterium fortui tum FC1, has been replaced by the BglII / BglII fragment of pACYC184 promoter and to the aminoterminal fragment of the gene coding for the beta-lactamase of Mycobacterium fortuitum D316.
  • the plasmid pTG5167 is a derivative of pTG186poly (Guy et al, 1987) where a BglII-EcoRI fragment carrying the gene coding for the GP160 protein of HIV1 / MN has been cloned in the polylinker.
  • Figure 9 Construction of the plasmids pRJ27 and pRJ28
  • the amplification of the gag11 fragment is made from the plasmid pTG2103 supplied by Transgene.
  • the plasmid pTG2103 is a derivative of pTG959 (Guy et al, 1987) where a BglII / EcoRI fragment carrying the gene coding for the P24 protein of HIV1 / LAI has been cloned in the polylinker.
  • the amplification of the Gag fragment p24 is made from the plasmid pTG2103 supplied by Transgene.
  • the amplification of the gene coding for the GP63 protein of Leishmania major is made directly from the chromosome of this parasite.
  • Figure 12 Western type analysis of the expression of the beta-lactamase-V3 polypeptide. The molecular weight markers are indicated to the left of line 1.
  • Lane 1 gpl20 protein
  • lane 2 standard BCG supernatant
  • lane 3 extract of standard BCG
  • lane 4 supernatant of recombinant BCG carrying the plasmid pIPJ64
  • lane 5 extract of recombinant BCG carrying the plasmid pIPJ64.
  • Lane 1 molecular weight markers
  • lane 2 Gag P24 protein
  • lane 3 extract of standard BCG
  • lanes 4 and 5 extracts of recombinant BCG carrying the plasmid pRJ28
  • lanes 6 and 7 extracts of recombinant BCG carrying the plasmid pRJ27.
  • Line 1 extract of standard BCG
  • lane 2 Gag P24 protein
  • lane 3 molecular weight markers
  • lanes 4 and 5 extracts of recombinant BCG carrying the plasmid pRJ33 and pRJ34, respectively.
  • Line 15 Western type analysis of the expression of the beta-lactamase-GP63 polypeptide.
  • Line 1 extract of standard BCG
  • lane 2 molecular weight markers
  • lane 3 extract of recombinant BCG carrying pSAIl.5
  • Figure 16 Proliferative responses of cells extracted from the lymph nodes of mice inoculated with BCG carrying the plasmid pRJ28.
  • mice receive an intradermal injection of 10 7 cfu of BCG-pRJ28, 4 others receive standard BCG 1173P2. After 14 days, the peripheral lymph nodes are removed for the proliferation test.
  • the HIV1-LAI Gag P24 protein is used to induce the proliferation of ganglion cells which have been in contact with the BlaM-V3 fusion protein produced by recombinant BCG. 26 EXPERIMENTAL PART
  • a mycobacterial ⁇ -lactamase was used, for its expression in M. bovis BCG, the expression signals being adapted to the mycobacterial context.
  • a M. fortuitum ⁇ -lactamase was previously purified by Amicosante et al and Fattorili et al from a mutant strain producing this enzyme in large quantities.
  • the N-terminal sequence of ⁇ -lactamase was determined by Amicosante et al:
  • APIDDQLAELERRDNVLIGLYAANLQSGRRITHRPDEMFAMXSTFKGYV X corresponds to an indeterminacy.
  • nucleotides are indicated in capital letters; each oligonucleotide belonging to the family is determined by choosing one of the nucleotides indicated in parentheses.
  • the mixture of these oligonucleotides, called Moligol has been chemically synthesized by incorporating one or other of the nucleotides indicated in parentheses.
  • This research also made it possible to define which sequences coded for a ⁇ -lactamase and the signals necessary for the expression of fusion products with ⁇ -lactamase, in which the ⁇ -lactamase is in stable form, and also the signals necessary for the export, even for the secretion, of the recombinant protein produced in a cellular host.
  • BCG Bacillus Calmette et Guérin
  • BCG Bacillus Calmette et Guérin
  • the present invention has made it possible to demonstrate that the use of a vector protein such as ⁇ -lactamase can promote the cloning and expression in mycobacteria, in particular in BCG, of heterologous antigenic determinants.
  • a vector protein such as ⁇ -lactamase
  • BCG as a cellular host for the expression of ⁇ -lactamase
  • use will be made of an exogenous ⁇ -lactamase compared to those which naturally preexist in BCG, in order to avoid or to minimize the phenomena of recombination.
  • nucleotide sequence represented in FIG. 4 participating in the structure of ⁇ -lactamase, or necessary for its expression in an appropriate cellular host, in particular the sequence between nucleotides 1 and 394 of the sequence of FIG. 4 containing the gene expression signals, the coding sequence contained in the sequence represented in FIG. 4, and comprising the nucleotides 395 to 1274,
  • the second mixture of oligonucleotides consists of oligonucleotides corresponding to the complementary strands of the DNA sequences coding for the C-terminal part of the N-terminal fragment indicated above, that is to say: STFKGYV.
  • One of the mixtures contains oligonucleotides of identical or very similar sequence to the 5 'part of BlaM1
  • the second mixture contains oligonucleotides complementary to the 3' part of BlaMl.
  • These two mixtures are used to synthesize the BlaM1 probe by PCR from the DNA that we have extracted from M. fortuitum FC1 (C. Martin et al, Nature Vol. 345: 739-743, 1990).
  • the BlaMl probe was sequenced ( Figure 1). From this sequence, the oligonucleotide, BlaOl: 5 'CTTGAAGGTCGAGCACATCGCGAACAT3' was synthesized and radioactively labeled in order to use it as a probe to locate in a gene bank of M.
  • fortuitum D316 (Amicosante et al) a clone having a fragment carrying the gene coding for ⁇ -lactamase.
  • This library was constructed by cutting the chromosomal DNA of M. fortuitum D316 by the restriction enzyme SphI and by cloning the fragments at random in the vector pACYC184. The SphI fragments were inserted at the SphI site of pACYC184 and the HB101 strain of E. coli was transformed by this ligation mixture in the presence of calcium chloride. The transforming strains were selected on a LB medium containing 30 ⁇ g / ml of chloramphenicol.
  • the resistant strains obtained were subcultured on solid LB medium containing 25 ⁇ g / ml of tetracycline and only those sensitive to this antibiotic were retained.
  • a transforming clone containing a fragment hybridizing with BlaOl was isolated.
  • This clone contains a plasmid pACYC184 recombinant with an insert of approximately 4.7 kb hybridizing with BlaOl.
  • the restriction map of this plasmid was carried out (FIG. 2) and the region hybridizing with BlaOl was sequenced.
  • the nucleotide sequence is indicated in FIG. 4. The analysis of this sequence shows a reading phase having similarities with other class ⁇ -lactamases. We therefore concluded that it must have been the gene for structure of M.
  • the SphI sequence fragment contains only part of the gene.
  • a BglII-SphI restriction fragment (shown in thick lines in FIG. 2) internal to the gene, called Bla02, was used as probe;
  • the whole gene was cloned from a library of M. fortuitum FC1. This library was constructed by cloning 4 to 10 kb BamHI chromosomal fragments isolated by electrophoresis on an agarose gel and cloned into the BamHI site of the plasmid pUC18 linearized by cleavage at this site and dephosphorylated.
  • the transforming clones were selected on a box of LB medium containing 100 ⁇ g / ml of ampicillin.
  • a transforming clone hybridizing with the Bla02 probe was isolated. It contains a recombinant plasmid carrying an insert of approximately 6 kb hybridizing with the Bla02 probe.
  • the restriction map of this insert was performed (FIG. 3) and the region hybridizing with the probe was sequenced. It contains the C-terminus of the gene ( Figure 4).
  • the two gene fragments obtained from the SphI and BamHI have a common part which allows to reconstitute the whole gene; it is represented in FIG. 4 with the amino acid sequence of the protein deduced from the nucleotide sequence.
  • the amino acid sequence has similarities to the sequences of other known class A ⁇ -lactamases.
  • An alignment of the sequences of the ⁇ -lactamases of M. fortuitum, of S. albus, of S. aureus is proposed in FIG. 5.
  • the position of the different structural patterns, helices and ⁇ sheet determined for the ⁇ -lactamase of S. aureus is indicated on the primary structure of this enzyme in the same figure.
  • the position of the structural motifs is proposed to the FIG. 5.
  • nt648 to nt719 contains a unique BglII site which will be used for the insertion of foreign DNA fragments coding for various epitopes.
  • the insertion of epitopes at the C-terminal position of the protein, ie close to nucleotide 1043, could also be of interest.
  • BlaM gene To analyze the expression of the BlaM gene, it was fused with ⁇ -galactosidase, an enzyme that is easy to measure and whose expression in bacteria is easily spotted on a Petri dish. To do this, a BglII-Pstl fragment of 1598 bp, containing a part of the blaM gene and of the upstream region, was isolated and inserted between the BamHI and Pst1 sites of the plasmid pNM482. The resulting blaM-lacZ fusion was then transferred to an E. coli mycobacterium shuttle vector and this construct was used to electroporate E.coli and M. smegmatis.
  • lacZ gene has been observed only in M. smegmatis. These results show that the cloned region located upstream of the blaM gene is sufficient to induce expression of the gene and that it must therefore contain most of the signals for initiating transcription and translation. These signals are specific for mycobacteria. They can therefore therefore advantageously be used for the expression of any cloned gene under their control, in the form of an operon fusion or a protein fusion.
  • the blaM-lacZ fusion is functional shows that the blaM system can be used for the expression of various heterologous genes or fragments of genes in mycobacteria. Depending on the gene fusions carried out, the resulting fusion proteins may have a cytoplasmic localization, be exported outside the bacteria into the culture medium, or remain anchored to the external membrane. Examples of the use of the Pbla promoter associated with all or part of the gene coding for the beta-lactamase which it controls: expression of antigens or fragments of viral or parasitic antigens and induction of specific immune responses by the BCG expressing the one of these antigens.
  • the Pbla promoter ( ⁇ -lactamase promoter) associated with the gene coding for beta-lactamase has been used to express several viral antigenic motifs of HIV1.
  • the sequences are given in relation to the publication "Hu an retrovirus and AIDS 1991" a compilation and analysis of nucleic acid and aminoacid sequences, edited by Myers G. et al., Published by Theoretical Biology and Physics, Group T-10, Mail Stop K710, Los Alamos National Laboratory, Los Alamos, New Mexico 877545 USA) or Leishmania GP63 antigen.
  • the sequences are given in relation to the publication: Button, LL and Me Master, WR (1988) Molecular cloning of the major surface antigen of Leishmania. J. Exp. 167. 724-729) in M. smegmatis and / or the BCG.
  • V3 antigenic motif of HIV1 strain MN and an env fragment of this same strain were expressed in M. smegmatis and / or BCG.
  • Gag P24 antigen of HIV1 strain LAI as well as a fragment of the latter (Gag11) were expressed in BCG.
  • the major surface protein of Leishmania major and Leishmania infantum GP63 were also expressed by BCG.
  • TTTGGATCCCTCTAGACCCGTCGCCACAATGTGCTTGTCTTATAGTTCCT were synthesized by the company GENSET. They served to amplify the env fragment from the plasmid pTG5167 carrying it and originating from TRANSGENE. ( Figure 8).
  • the amplified fragment carries the BamHI restriction site at its ends. It is cut by the corresponding restriction enzyme and cloned into the plasmid pIPJ42.
  • the recombinant plasmid carrying the fragment coding for the determinant V3 is called pIPJ52.
  • plasmid a cassette containing the origin of replication in mycobacteria (ori myco of pAL5000) and the kanamycin resistance gene of Tn903 was inserted between the SplI and BamHI sites.
  • This cassette is the EcoRV / Hpal fragment isolated from the plasmid pIPJ46 (FIG. 8).
  • the plasmids resulting from the insertion of the EcoRV / Hpal fragment in pIPJ52 in either of the orientations are pIPJ64 and pIPJ65.
  • Plasmids pIPJ64 and pIPJ65 were transferred to M. smegmatis and BCG by electroporation.
  • the fusion polypeptide expressed by the plasmids pIPJ64 and pIPJ65 consists of the insertion of the V3 motif between the propellers 2 and 3 of beta-lactamase. This polypeptide is identified in the culture medium of the strains of M. smegmatis and BCG transformed by the plasmids pIPJ64 and pIPJ65, by Western blot using the monoclonal antibody F5-5 of 1, 'Hybridolab of the Pasteur Institute.
  • AAACTGCAGGGATCCATGGGAAGTGACATAGCA AAACTGCAGGGATCCATGGGAAGTGACATAGCA
  • NG2 CCCTGAAGCTTACTCGGCTCTTAGAGTTTT
  • the amplified fragment carries the PstI and HindIII sites. It is cut by the corresponding enzymes and cloned in the plasmid pIPJ42 between the PstI and HindIII sites. The resulting plasmid is called pRJ20.
  • the Kpnl / Hin dm fragment coding for the beta-lactamase-GaglI fusion was inserted at the Seal site of pRR3 (Ranes, MG, Rauzier, J., Lagranderie, M., Georghiu, M. and Gicquel , B. (1990) Functional analysis of pAL5000, a plasmid from Mycobacterium fortui tum: construction of a "mini" Mycobacterium- escherichia coli shuttle vector. J. Bacteriol. 172. 2793-2797) in both directions. The resulting plasmids were called pRJ27 and pRJ28. Plasmids pRJ27 and pRJ28 were transferred to M. smegmatis and BCG by electroporation.
  • the fusion polypeptide expressed by the plasmids pR 27 and pRJ28 consists of the fusion between an amino-terminal fragment of 24 amino acids of beta-lactamase with the fragment gagll since a stop codon is located at the end of gagll.
  • the beta-lactamase-GagII fusion polypeptide is not found in the culture medium of M. smegmatis or of BCG transformed by pRJ27 and pRJ28, but in the cytoplasm of these bacteria.
  • the fragment coding for the protein GagP24 was inserted at the BglII site of the gene coding for beta-lactamase on the plasmid pIPJ42. To do this, a fragment coding for Gag P24 was synthesized in vitro by PCR from the plasmid pTG2103, originating from TRANSGENE, using the oligonucleotides JGAG1.
  • the amplified fragment carries the BglII and BamHI sites. It is cut by the corresponding enzymes and cloned into the plasmid pIPJ42 between the BglII and BamHI sites. The resulting plasmid is called pRJ22.
  • the cassette containing the origin of replication in mycobacteria (ori yco of pAL5000) and the kanamycin resistance gene of Tn903 was inserted between the SplI and BamHI sites. It is the EcoRV / Hpal fragment isolated from the plasmid pIPJ46 ( Figure 10). These plasmids resulting from the insertion of the EcoRV / Hpal fragment are called pRJ33 and pRJ34.
  • Plasmids pRJ33 and pRJ34 were transferred to M. smegmatis and BCG by electroporation.
  • the fusion polypeptide expressed by the plasmids pRJ33 and pRJ34 consists of an amino-terminal fragment of 60 amino acids of beta-lactamase with the protein GagP24 since a stop codon is located at the end of the Gag P24 gene cloned here.
  • the beta-lacatamase-GagII fusion polypeptide is not found in the culture medium but in the cytoplasm. It is identified by Western blot using the 1113 monoclonal antibody from the Hybridolab of the Institut Pasteur.
  • the GP63 surface antigen of Leishmania infantum and Leishmania major The fragment coding for the GP63 protein lacking the C-terminal transmembrane part was inserted at the BglII site of the gene coding for beta-lactamase on the plasmid pIPJ42. To do this, a fragment coding for the GP63 antigen was synthesized in vitro by PCR. Two GP631 oligonucleotides
  • GCGGGATCCTTATGCATGTGCGCGACGTGAACTGGGGC GCGGGATCCTTATGCATGTGCGCGACGTGAACTGGGGC
  • GP632 CCGAATTCAAGCTTCTACGCCGTGTTGCCGCCGTCCTT
  • the cassette containing the origin of replication in mycobacteria (oriMyco of pAL5000) and the kanamycin resistance gene of Tn903 was inserted between the SplI and BamHI sites.
  • pSA1.5 and pSAI1.5 The plasmids resulting from the insertion of the EcoRV / Hpal fragment in one or the other of the orientations are called pSA1.5 and pSAI1.5.
  • Plasmids pSA1.5 and pSAIl.5 were transferred to M. smegmatis and BCG by electroporation.
  • the fusion polypeptides expressed by these plasmids consist of the fusion between an amino ⁇ terminal fragment of 60 amino acids of beta-lactamase with the protein GP63 deleted from the C-terminal transmembrane part.
  • the beta-lactamase-Protein GP63 fusion polypeptides are as in the case of Gag fusions found in the cytoplasm of M. smegmatis and BCG transformed by the plasmids pSA1.5 and pSAI1.5.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Mycology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pulmonology (AREA)
  • Immunology (AREA)
  • Toxicology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Communicable Diseases (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Virology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
EP93905393A 1992-02-14 1993-02-12 $g(b)-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENES Withdrawn EP0626013A1 (fr)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
FR9201713A FR2687410A1 (fr) 1992-02-14 1992-02-14 Beta-lactamase recombinante, utilisable en tant que molecule porteuse pour la preparation de compositions immunogenes.
FR9201713 1992-02-14
PCT/FR1993/000151 WO1993017113A1 (fr) 1992-02-14 1993-02-12 β-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENES

Publications (1)

Publication Number Publication Date
EP0626013A1 true EP0626013A1 (fr) 1994-11-30

Family

ID=9426670

Family Applications (1)

Application Number Title Priority Date Filing Date
EP93905393A Withdrawn EP0626013A1 (fr) 1992-02-14 1993-02-12 $g(b)-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENES

Country Status (4)

Country Link
US (1) US5830457A (enExample)
EP (1) EP0626013A1 (enExample)
FR (1) FR2687410A1 (enExample)
WO (1) WO1993017113A1 (enExample)

Families Citing this family (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2313719T3 (es) 1993-11-23 2009-03-01 The Regents Of The University Of California Productos extracelulares abundantes y procedimiento de produccion y uso de los mismos.
US6752993B1 (en) 1993-11-23 2004-06-22 The Regents Of The University Of California Abundant extracellular product vaccines and methods for their production and use
EP0703295A1 (en) * 1994-09-26 1996-03-27 Institut Pasteur Vaccine composition comprising recombinant BCG expressing gp 63 fusion protein
US6494654B2 (en) * 1996-11-04 2002-12-17 Thomas M. Espinosa Tie down building, system tie down, and method
US6153381A (en) 1997-08-28 2000-11-28 Millennium Pharmaceuticals, Inc. Screening for antibiotics
CN1191363C (zh) * 2002-02-11 2005-03-02 陈秀枢 β-内酰胺酶/氨基糖苷钝化酶融合基因其表达产物其组合物及其应用
EP1564286A1 (en) * 2004-02-11 2005-08-17 Université de Liège Hybrid proteins of beta-lactamase class A
WO2009032664A2 (en) * 2007-08-31 2009-03-12 The Regents Of The University Of Michigan Methods and compositions for increasing biological molecule stability
WO2011119920A2 (en) 2010-03-25 2011-09-29 Oregon Health & Science University Cmv glycoproteins and recombinant vectors
SMT201800284T1 (it) 2011-06-10 2018-07-17 Univ Oregon Health & Science Glicoproteine cmv e vettori ricombinanti
EP2568289A3 (en) 2011-09-12 2013-04-03 International AIDS Vaccine Initiative Immunoselection of recombinant vesicular stomatitis virus expressing hiv-1 proteins by broadly neutralizing antibodies
ES2631608T3 (es) 2012-06-27 2017-09-01 International Aids Vaccine Initiative Variante de la glicoproteína Env del VIH-1
EP2848937A1 (en) 2013-09-05 2015-03-18 International Aids Vaccine Initiative Methods of identifying novel HIV-1 immunogens
EP2873423B1 (en) 2013-10-07 2017-05-31 International Aids Vaccine Initiative Soluble hiv-1 envelope glycoprotein trimers
US10174292B2 (en) 2015-03-20 2019-01-08 International Aids Vaccine Initiative Soluble HIV-1 envelope glycoprotein trimers
US9931394B2 (en) 2015-03-23 2018-04-03 International Aids Vaccine Initiative Soluble HIV-1 envelope glycoprotein trimers

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IE48385B1 (en) * 1978-08-11 1984-12-26 Univ California Synthesis of a eucaryotic protein by a microorganism
US4820642A (en) * 1983-04-04 1989-04-11 The Regents Of The University Of California Amplified expression vector
EP0400973B1 (en) * 1989-05-31 1996-07-31 Ajinomoto Co., Inc. Mycobacterial secretory expression vectors and transformants

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See references of WO9317113A1 *

Also Published As

Publication number Publication date
WO1993017113A1 (fr) 1993-09-02
FR2687410A1 (fr) 1993-08-20
FR2687410B1 (enExample) 1994-12-16
US5830457A (en) 1998-11-03

Similar Documents

Publication Publication Date Title
ES2274580T3 (es) Vacuna de la tuberculosis.
WO1993017113A1 (fr) β-LACTAMASE RECOMBINANTE, UTILISABLE EN TANT QUE MOLECULE PORTEUSE POUR LA PREPARATION DE COMPOSITIONS IMMUNOGENES
US20040203039A1 (en) Attenuated salmonella SP12 mutants as antigen carriers
WO1995004079A1 (fr) Vecteur recombinant contenant une sequence d'un gene de lipoproteine pour l'expression de sequences de nucleotides
Cirillo et al. Bacterial vaccine vectors and bacillus Calmette-Guerin
WO1988006626A1 (en) Recombinant mycobacterial vaccine
CA2121598A1 (fr) Promoteur de m. paratuberculosis et son utilisation pour l'expression de sequences immunogenes
US5866403A (en) Homologously recombinant slow growing mycobacteria and uses therefor
Berggren et al. HIV gp120-specific cell-mediated immune responses in mice after oral immunization with recombinant Salmonella
US6776993B2 (en) Tuberculosis vaccine
EP0666917A1 (fr) Promoteur de m. paratuberculosis et son utilisation pour l'expression de sequences immunogenes
US6235518B1 (en) Recombinant immunogenic actinomycetale
CA2344173C (en) Immunogenic liposome compositions
EP0991663B1 (fr) Souches de mycobacterium dont le gene erp est modifie et composition vaccinale la contenant
JP2001518781A (ja) マイコバクテリウム組換えワクチン
RU2429292C1 (ru) РЕКОМБИНАНТНАЯ ПЛАЗМИДА pAg85A-CBD, ШТАММ Escherichia coli [pREP4, pAg85A-CBD], ХИМЕРНЫЙ БЕЛОК Ag85A-CBD И ИХ ПРИМЕНЕНИЕ
CN116829693A (zh) 口服冠状病毒感染症疫苗
Green The development and use of antigen-antibody-LTB (Ag-MAb-LTB) complexes as immunogens
HK1039064B (en) Immunogenic liposome compositions
MX2008007399A (es) Compusto inmunogénico basad0 en virus condicionalmente vivo y metodo para producirlo.
HK1091217B (en) Tuberculosis vaccine with improved efficacy
HK1091217A1 (zh) 效能提高的结核病疫苗

Legal Events

Date Code Title Description
PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

17P Request for examination filed

Effective date: 19940823

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AT BE CH DE DK ES FR GB GR IE IT LI LU MC NL PT SE

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN

18D Application deemed to be withdrawn

Effective date: 20020829