DE3781456T2 - Pharmazeutische zusammensetzung, die eine 8-chlor-benzothiazepin-verbindung enthaelt und ihre verwendung. - Google Patents
Pharmazeutische zusammensetzung, die eine 8-chlor-benzothiazepin-verbindung enthaelt und ihre verwendung.Info
- Publication number
- DE3781456T2 DE3781456T2 DE8787107082T DE3781456T DE3781456T2 DE 3781456 T2 DE3781456 T2 DE 3781456T2 DE 8787107082 T DE8787107082 T DE 8787107082T DE 3781456 T DE3781456 T DE 3781456T DE 3781456 T2 DE3781456 T2 DE 3781456T2
- Authority
- DE
- Germany
- Prior art keywords
- cholesterol
- pharmaceutical composition
- compound
- blood
- amount
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
Landscapes
- Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Epidemiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Hematology (AREA)
- Obesity (AREA)
- General Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Diabetes (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Nitrogen- Or Sulfur-Containing Heterocyclic Ring Compounds With Rings Of Six Or More Members (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP11318286 | 1986-05-16 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| DE3781456D1 DE3781456D1 (de) | 1992-10-08 |
| DE3781456T2 true DE3781456T2 (de) | 1993-03-18 |
Family
ID=14605628
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DE8787107082T Expired - Fee Related DE3781456T2 (de) | 1986-05-16 | 1987-05-15 | Pharmazeutische zusammensetzung, die eine 8-chlor-benzothiazepin-verbindung enthaelt und ihre verwendung. |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US4778791A (enExample) |
| EP (1) | EP0246573B1 (enExample) |
| JP (1) | JPS63107926A (enExample) |
| AT (1) | ATE80036T1 (enExample) |
| DE (1) | DE3781456T2 (enExample) |
| DK (1) | DK248987A (enExample) |
| FR (1) | FR2598618B1 (enExample) |
| GB (1) | GB2190290B (enExample) |
| HK (1) | HK7993A (enExample) |
| SG (1) | SG60192G (enExample) |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPS63107925A (ja) * | 1986-05-23 | 1988-05-12 | Tanabe Seiyaku Co Ltd | 動脈硬化症予防・治療剤 |
| IL108634A0 (en) * | 1993-02-15 | 1994-05-30 | Wellcome Found | Hypolipidaemic heterocyclic compounds, their prepatation and pharmaceutical compositions containing them |
| US5674488A (en) * | 1994-10-07 | 1997-10-07 | Reich; John J. | Method for prevention and treatment of hyperchlolesterolemia by in vivo hydrogenation of cholesterol |
| US6354765B2 (en) | 2000-02-15 | 2002-03-12 | Exxonmobile Upstream Research Company | Method of transporting and disposing of an offshore platform jacket |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPS59157021A (ja) * | 1983-02-25 | 1984-09-06 | Tanabe Seiyaku Co Ltd | 動脈硬化症予防治療剤 |
| US4567175A (en) * | 1983-06-03 | 1986-01-28 | Tanabe Seiyaku Co., Ltd. | 8-Chloro-1,5-benzothiazepine derivatives |
| GB8315364D0 (en) * | 1983-06-03 | 1983-07-06 | Tanabe Seiyaku Co | 8-chloro-1 5-benzothiazepine derivatives |
| JPS59231018A (ja) * | 1983-06-10 | 1984-12-25 | Tanabe Seiyaku Co Ltd | 抗脂血剤 |
-
1987
- 1987-05-05 US US07/046,889 patent/US4778791A/en not_active Expired - Fee Related
- 1987-05-12 JP JP62116631A patent/JPS63107926A/ja active Granted
- 1987-05-14 DK DK248987A patent/DK248987A/da not_active Application Discontinuation
- 1987-05-14 GB GB8711407A patent/GB2190290B/en not_active Expired - Lifetime
- 1987-05-15 AT AT87107082T patent/ATE80036T1/de not_active IP Right Cessation
- 1987-05-15 EP EP87107082A patent/EP0246573B1/en not_active Expired - Lifetime
- 1987-05-15 DE DE8787107082T patent/DE3781456T2/de not_active Expired - Fee Related
- 1987-05-15 FR FR878706867A patent/FR2598618B1/fr not_active Expired - Lifetime
-
1992
- 1992-06-05 SG SG60192A patent/SG60192G/en unknown
-
1993
- 1993-02-04 HK HK79/93A patent/HK7993A/xx unknown
Also Published As
| Publication number | Publication date |
|---|---|
| JPS63107926A (ja) | 1988-05-12 |
| GB8711407D0 (en) | 1987-06-17 |
| GB2190290B (en) | 1990-01-04 |
| SG60192G (en) | 1993-04-16 |
| DK248987D0 (da) | 1987-05-14 |
| DE3781456D1 (de) | 1992-10-08 |
| US4778791A (en) | 1988-10-18 |
| FR2598618B1 (fr) | 1991-10-25 |
| HK7993A (en) | 1993-02-12 |
| EP0246573A2 (en) | 1987-11-25 |
| ATE80036T1 (de) | 1992-09-15 |
| DK248987A (da) | 1987-11-17 |
| EP0246573A3 (en) | 1990-01-31 |
| FR2598618A1 (fr) | 1987-11-20 |
| JPH0573729B2 (enExample) | 1993-10-15 |
| GB2190290A (en) | 1987-11-18 |
| EP0246573B1 (en) | 1992-09-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE69829763T2 (de) | Verwendung von tetrahydolipstatin in der behandlung von diabetes typ ii | |
| DE69227571T2 (de) | Zusammensetzung, verfahren und instrument zur potenzierung der antitumoraktivität und zur behandlung von tumoren | |
| EP1425018B1 (de) | Kombinationspräparate von 1,4- benzothiepin-1,1-dioxidderivaten mit weiteren wirkstoffen und deren verwendung | |
| DE3639378C2 (enExample) | ||
| DE3781456T2 (de) | Pharmazeutische zusammensetzung, die eine 8-chlor-benzothiazepin-verbindung enthaelt und ihre verwendung. | |
| DE3643119A1 (de) | Therapeutische zusammensetzung fuer diabetes-komplikationen | |
| DE68911273T2 (de) | Benzothiazepine zur Herstellung von Medikamenten zur Milderung von epileptischen Anfällen. | |
| DE69626118T2 (de) | Verwendung von sulfaminsäuren derivaten, acrylsulfonamiden oder sulfonylcarbonaten zur herstellung eines arzneimittels zur senkung des spiegels von lipoproteinen | |
| DE69115528T2 (de) | Neue pharmazeutische Verwendungen von Forskolin-Derivaten | |
| DE69907387T2 (de) | Verwendung von Hydantoin-Derivaten zur Herstellung eines Medikaments zur Behandlung von refraktärer Vasculitis. | |
| DE3875324T2 (de) | Dl-5-((2-benzyl-3,4-dihydro-2h-benzopyran-6-yl)methyl)thiazolidin-2,4-dion als antiatherosklerosemittel. | |
| DE60220799T2 (de) | Hypoglykämisches mittel | |
| DE69525348T2 (de) | Medikament gegen myotonische dystrophie | |
| DE3736691C2 (enExample) | ||
| DE602004010172T2 (de) | Pharmazeutische zusammensetzungen zur behandlung von nierenfunktionsstörungen | |
| EP0331871B1 (de) | Antipsychotisch wirksames Imidazobenzodiazepin | |
| EP0207193A2 (de) | Synergistische Kombination von Flupirtin und 4-Acetamido-phenol | |
| DE69004529T2 (de) | Verwendung von Sertralin zur Behandlung von Abhängigkeiten von chemischen Stoffen. | |
| CH654316A5 (de) | 4-amino-1beta-d-ribofuranosyl-1h-imidazo(4,5-c)pyridin als mittel fuer die behandlung von entzuendungen. | |
| CH661866A5 (de) | Synergistisches arzneimittelpraeparat zur behandlung von leberkrankheiten. | |
| DE1900772C3 (de) | Salz aus N,N-Dimethylbiguanid und p-Chlorphenoxyessigsäure sowie dieses enthaltende Arzneimittel | |
| EP0013252B1 (de) | Mittel zur Senkung der Herzfrequenz | |
| DE3419425C2 (enExample) | ||
| DE3500756A1 (de) | Verwendung von chinolonen zur behandlung der herzinsuffizienz | |
| DE60109799T2 (de) | Verwendung von quetiapin für aufmerksamkeitsmangel-hyperaktivitätsstörungen oder verhaltensstörungen |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 8364 | No opposition during term of opposition | ||
| 8339 | Ceased/non-payment of the annual fee |