CN108012985A - The efficiently device of hatching tortoise - Google Patents
The efficiently device of hatching tortoise Download PDFInfo
- Publication number
- CN108012985A CN108012985A CN201711223286.XA CN201711223286A CN108012985A CN 108012985 A CN108012985 A CN 108012985A CN 201711223286 A CN201711223286 A CN 201711223286A CN 108012985 A CN108012985 A CN 108012985A
- Authority
- CN
- China
- Prior art keywords
- babinet
- hatching
- testudinate
- egg
- parts
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; CARE OF BIRDS, FISHES, INSECTS; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New breeds of animals
- A01K67/02—Breeding vertebrates
Abstract
The present invention discloses a kind of device of efficiently hatching tortoise, belong to the technical field of the device of hatching tortoise yield, the efficiently device of hatching tortoise, including babinet, the bottom of box is equipped with hydrophobic layer, young sand bed is equipped with above hydrophobic layer, soft coating is equipped with above young sand bed, air hole is provided with the outside of babinet, casing top is equipped with head cover, and the babinet lower right corner stretches out equipped with open slot, open slot is penetrated through with hydrophobic layer, open slot opening is equipped with warm water supply pipe, and open slot is equipped with rhone relative to the opposite of babinet, and rhone is also penetrated through with hydrophobic layer.The present apparatus avoids moisture by the pattern of naturally osmotic and blocks air, ensure that the gas permeability of hatchery, and the soft coating covered on the upside of testudinate egg further ensure that gas permeability so that testudinate egg is breathed, it is ensured that the incubation rate of testudinate egg.A kind of hatchery natural moistening is provided for the hatching of testudinate egg so as to the testudinate egg incubation device of the present invention, maintains constant temperature and naturally soft ventilative environment of hatching.
Description
Technical field
The invention belongs to a kind of technical field for hatching tortoise device, and in particular to the efficiently device of hatching tortoise.
Background technology
Testudinate belongs to oviparous animal, in nature, selects suitable sand ground to dig pit oviposition to mating period testudinate, sandy soil cover
Lid is hatched naturally, does not protect ovum, and incubation rate is very low.In artificial breeding, after testudinate lays eggs, ovum is manually taken out from sandy soil into pedestrian
Work is hatched, and for the cultivation of tortoise, incubation period and young tortoise stage are particularly important, it is that foster tortoise is successfully crucial, people
In work cultivation, incubation period needs special hatching apparatus to hatch young tortoise.But in recent years, support the hatching apparatus structure of tortoise
Too simpleization is made, function is less, it is impossible to scientific management, moreover, the requirement in the incubation period of tortoise for temperature and humidity
It is higher, and existing hatching apparatus does not have strict temperature control and the device of humidity so that incubation period egg incubation rate compared with
It is low, and the young tortoise resistance at hatching is poor；Secondly, existing hatching apparatus is checking the environment of hatching inside hatching apparatus
When, it is necessary to repeatedly will store tortoise egg box take out, can so cause hatching environment produce change, influence hatching efficiency.
The prior art, such as Chinese invention granted patent document, Authorization Notice No. CN 103636559 discloses a kind of testudinate
Egg incubation device, it includes babinet, is positioned over the hydrophobic layer of most bottom side in babinet, the young sand bed on the upside of hydrophobic layer, is located at
Soft coating on the upside of young sand bed, soft coating upside are ventilative chamber, and babinet corresponds to ventilative chamber and opens up air hole, casing top button
If head cover, bottom of box side, which stretches out, sets open slot, and hydrophobic layer continuously extends to open slot through bottom of box side wall
Bottom, open slot upside set warm water supply pipe, and open slot opposite side is equipped with the rhone being connected with babinet.The invention is
The hatching of testudinate egg provides hatchery naturally osmotic and moistens, maintains constant temperature and provide heat and naturally soft gas permeability is incubated
Change environment.
The content of the invention
It is an object of the invention to provide a kind of device of efficiently hatching tortoise, babinet, which is equipped with three layers of insulating layer, to promote tortoise to exist
Hatch under thermostatic effect, increase temperature to babinet using the current of hydrophobic layer, the bacterium that nonpolluting coating growth is scribbled in babinet is micro-
Biology will not be attached to box house.
The scheme taken to achieve the above object of the present invention is：The efficiently device of hatching tortoise, including babinet, the bottom of box
Equipped with hydrophobic layer, young sand bed is equipped with above hydrophobic layer, soft coating is equipped with above young sand bed, air hole, case are provided with the outside of babinet
Head cover is equipped with the top of body, the babinet lower right corner stretches out to be penetrated through equipped with open slot, open slot with hydrophobic layer, and open slot opening is set
There is warm water supply pipe, open slot is equipped with rhone relative to the opposite of babinet, and rhone is also penetrated through with hydrophobic layer.The present apparatus passes through
The pattern of naturally osmotic avoids moisture block air, ensure that the gas permeability of hatchery, and what is covered on the upside of testudinate egg soft covers
Cap rock further ensure that gas permeability so that testudinate egg is breathed, it is ensured that the incubation rate of testudinate egg.So as to the testudinate of the present invention
Egg incubation device provides a kind of hatchery natural moistening for the hatching of testudinate egg, maintains constant temperature and naturally soft ventilative incubates
Change environment.
Preferably, hydrophobic layer bottom is covered with one layer of hydrophobic bar, the material of hydrophobic bar is one in waddy, branch, bamboo pole
Kind is a variety of, and there is rubble at stand above hydrophobic bar.This arrangement mode can also form hydrophobic environment, build be more nearly it is big from
The environment of hatching of right suitable testudinate egg, while heat and moisture are provided so that environment of hatching maintains suitable constant temperature ring naturally
Border, accelerates to hatch and ensure incubation rate.
Preferably, water supply tube end is equipped with flow control valve, warm water supply pipe water inlet end connection solar water heater or
Plug-in accumulator.Flow control valve can control the speed of current, further control the supply of moisture and heat, so control humidity and
Temperature, avoids the frequent change dramatically of temperature and humidity, can also save water source, avoid the need for supplying in the case of heat abundance
Hot water, in rainy day or the weather without the sun, solar energy temperature does not provide thermal energy not enough, and water receiver can provide heat
Water, will be maintained at a temperature for a long time in such babinet.
Preferably, babinet is divided into three layers, babinet is followed successively by inorfil vacuum heat-insulation plate, polyurethane, silicon from outside to inside
Sour aluminium, is 0.6 ~ 0.8 by each layer thickness ratio outside interior:1.2~1.5:1.There are three layers of guarantor in this babinet compared with common foster tortoise babinet
Warm layer is formed by stacking, better heat preservation, can promote the hatching of testudinate egg, lifts incubation rate, layer of polyurethane in three layers of insulating layer
The ratio occupied is most, its insulation effect is also most obvious.
Preferably, cabinet wall scribbles nonpolluting coating, nonpolluting coating is made of following component and parts by weight：Fluorinated acrylamide
30-45 parts of acid esters, 20-35 parts of silicon rubber, 0.1-0.2 parts of antiseptic, 2-10 parts of bioantifouling agent, 15-25 parts of filler, organic bentonite
Moisten 0.5-1 parts of soil, 0.5-1 parts of Tissuemat E, 2-7 parts of propane diols.Box house, which has silt to store for a long time, can grow bacterium, attachment
Babinet health is influenced to cabinet wall, this coating improves the soil resistance of cabinet wall by drying and processing, by the coating
The growth that can preferably inhibit bacteria of addition antiseptic or make the growth of certain micro-organisms or breeding be maintained at it is necessary it is horizontal with
Under.
Preferably, antiseptic is functional activity polypeptide in nonpolluting coating formula, the amino acid sequence of the functional activity polypeptide
It is classified as：The QSGFKLYCCPSKTYCSYYGCTPGKICYCLHCSS functional activity polypeptides and coating into can apply after subassembly
Layer surface forms one layer of antibiotic layer, which may act on the cell membrane of bacterium, destroys its integrality and produces and wears
Hole phenomenon, causes cellular content to overflow extracellular and dead, can effectively prevent bacterium from surviving and multiplying in coating surface, also be lifted
The sanitation degree of holding pond.
Preferably, testudinate egg is placed between young sand bed and soft coating.Testudinate egg is in young sand bed in soft coating
Between position, the brooding time for playing the role of insulation, promoting testudinate egg that can well more.
Compared with prior art, beneficial effects of the present invention are：The present invention is divided into hydrophobic layer, young sand bed, soft from top to bottom
Coating, the open slot and rhone of hydrophobic layer docking, the thermostatted water of certain temperature is constantly provided in hatching process to open slot,
Thermostatted water from hydrophobic layer flow through after from rhone flow out, during to young sand bed provide heat and moisture, through capillary action by water
Divide and also rise therewith to infiltration above young sand bed, heat, the testudinate egg being embedded between young sand bed and soft coating obtains moisture
Nourish and heat care, accelerate testudinate egg hatching, lifted incubation rate, babinet be set to three layers can preferably be lifted insulation effect
Fruit, the excessive hot gas of temperature can be excluded from air hole, and cabinet wall, which is equipped with nonpolluting coating, to prevent microbial bacterial to be attached to case
On internal wall.
Present invention employs above-mentioned technical proposal to provide a kind of device for improving hatching tortoise yield, compensate for the prior art
Deficiency, design is reasonable, easy to operate.
Brief description of the drawings
Fig. 1 is the structure diagram for the device that the present invention efficiently hatches tortoise；
Fig. 2 is the structural representation of wall box of the present invention.
Description of reference numerals：1 rhone, 2 young sand beds, 3 testudinate eggs, 4 air holes, 5 babinets, 6 head covers, 7 open slots, 8 is soft
Coating, 9 throttle valves, 10 warm water supply pipes, 11 hydrophobic layers.
Embodiment
It is described in further detail below in conjunction with drawings and examples：
Embodiment 1：
The efficiently device of hatching tortoise, including babinet 5,5 bottom of babinet are equipped with hydrophobic layer 11, and the top of hydrophobic layer 11 is equipped with young sand bed 2,
The young top of sand bed 2 is equipped with soft coating 8, and the outside of babinet 5 is provided with air hole 4, and the top of babinet 5 is equipped with head cover 6,5 lower right corner of babinet
Stretch out and open slot 12 is housed, open slot 12 is penetrated through with hydrophobic layer 11, and 7 opening of open slot is equipped with warm water supply pipe 10, opens
Mouth groove 7 is equipped with rhone 1 relative to the opposite of babinet 5, and rhone 1 is also penetrated through with hydrophobic layer 11.The present apparatus passes through naturally osmotic
Pattern avoid moisture block air, ensure that the gas permeability of hatchery, the soft coating covered on the upside of testudinate egg is into one
Step ensure that gas permeability so that testudinate egg is breathed, it is ensured that the incubation rate of testudinate egg.So as to the testudinate egg incubation dress of the present invention
The hatching for being set to testudinate egg provides a kind of hatchery natural moistening, maintains constant temperature and naturally soft ventilative environment of hatching.
11 bottom of hydrophobic layer is covered with one layer of hydrophobic bar, and the material of hydrophobic bar is waddy, branch, one kind in bamboo pole or more
Kind, there is rubble at stand above hydrophobic bar.This arrangement mode can also form hydrophobic environment, build and be more nearly the suitable of the Nature
The environment of hatching of testudinate egg is closed, while heat and moisture are provided so that environment of hatching maintains suitable isoperibol naturally, accelerates
Hatch and ensure incubation rate.
10 end of water supply pipe is equipped with flow control valve 9,10 water inlet end of warm water supply pipe connection solar water heater or plug-in
Accumulator.Flow control valve can control the speed of current, further control the supply of moisture and heat, and then control humidity and temperature
Degree, avoids the frequent change dramatically of temperature and humidity, can also save water source, and supply heat is avoided the need in the case of heat abundance
Water, in rainy day or the weather without the sun, solar energy temperature does not provide thermal energy not enough, and water receiver can provide heat
Water, will be maintained at a temperature for a long time in such babinet.
Babinet 5 divides for three layers, and babinet 5 is followed successively by inorfil vacuum heat-insulation plate 501, polyurethane 502, silicic acid from outside to inside
Aluminium 503, is 0.6 ~ 0.8 by each layer thickness ratio outside interior:1.2~1.5:1.There are three layers in this babinet compared with common foster tortoise babinet
Insulating layer is formed by stacking, better heat preservation, can promote the hatching of testudinate egg, lifts incubation rate, polyurethane in three layers of insulating layer
The ratio that layer occupies is most, its insulation effect is also most obvious.
5 inner wall of babinet scribbles nonpolluting coating, and nonpolluting coating is made of following component and parts by weight：Fluorinated acrylic ester 30-
45 parts, 20-35 parts of silicon rubber, 0.1-0.2 parts of antiseptic, 2-10 parts of bioantifouling agent, 15-25 parts of filler, organobentonite
0.5-1 parts, 0.5-1 parts of Tissuemat E, 2-7 parts of propane diols.Box house, which has silt to store for a long time, can grow bacterium, be attached to case
Internal wall influences babinet health, this coating improves the soil resistance of cabinet wall by drying and processing, by adding in the coating
The growth or the growth of certain micro-organisms or breeding is maintained at necessary below horizontal that antiseptic can be inhibited bacteria preferably.
Antiseptic is functional activity polypeptide in nonpolluting coating formula, and the amino acid sequence of the functional activity polypeptide is：
The QSGFKLYCCPSKTYCSYYGCTPGKICYCLHCSS functional activity polypeptides and coating into can be in coating surface after subassembly
One layer of antibiotic layer is formed, which may act on the cell membrane of bacterium, destroys its integrality and produce perforated phenomenon,
Cause cellular content to overflow extracellular and dead, can effectively prevent bacterium from surviving and multiplying in coating surface, also improve and store up
The sanitation degree in pond.
Testudinate egg 3 is placed between young sand bed 13 and soft coating 8.Testudinate egg is in young sand bed in soft coating interposition
Put, the brooding time for playing the role of insulation, promoting testudinate egg that can well more.
Embodiment 2：
As shown in Figs. 1-2, the efficient device of hatching tortoise, the hydrophobic layer 11 of bottom side, the children positioned at the upside of hydrophobic layer 11 are husky in babinet 5
Layer 2, the soft coating 8 positioned at the upside of young sand bed 2, the soft upside of coating 8 are ventilative chamber, babinet 5 correspond to ventilative chamber open up it is ventilative
Hole 4, the top of babinet 5 button set head cover 6, and 5 bottom side of babinet, which stretches out, sets open slot 12, and hydrophobic layer 13 passes through the bottom of box
Side wall continuously extends to 12 bottom of open slot, and the upside of open slot 12 sets warm water supply pipe 10,7 opposite side of open slot be equipped with
The rhone 1 that babinet is connected.Hydrophobic layer is set in the bottommost of the babinet of hatching apparatus, while sets and is docked with hydrophobic layer
Open slot 12 and rhone 1, constantly provide the thermostatted water of certain temperature in hatching process to open slot 12, thermostatted water is from dredging
Water layer 13 flows out after flowing through from rhone 1, during persistently to young sand bed provide heat and moisture, through capillary action by moisture to
Infiltration, heat also rise therewith above young sand bed, and the testudinate egg 3 being embedded between young sand bed 2 and soft coating 8 obtains the taste of moisture
The care with heat is supported, accelerates the hatching of testudinate egg, lifts incubation rate.It is empty that the pattern of this naturally osmotic avoids moisture block
Gas, ensure that the gas permeability of hatchery, the soft coating 8 that the upside of testudinate egg 3 is covered further ensure that gas permeability, with reference to saturating
Air cavity and air hole 4 provide fresh air so that testudinate egg 3 is breathed, it is ensured that the incubation rate of testudinate egg.So as to the present invention's
Efficiently the device of hatching tortoise provides one kind for the hatching of testudinate egg makes hatchery natural moistening, maintenance constant temperature and naturally soft
Ventilative environment of hatching.
The prior art of routine techniques dawn known to those skilled in the art in the present embodiment, is not chatted in detail herein
State.
Embodiment of above is merely to illustrate the present invention, and not limitation of the present invention, the ordinary skill people of this area
Member, without departing from the spirit and scope of the present invention, can also make a variety of changes and modification.Therefore, it is all equivalent
Technical solution fall within scope of the invention, scope of patent protection of the invention should be defined by the claims.
Claims (6)
1. the efficiently device of hatching tortoise, including babinet（5）, it is characterised in that：The babinet（5）Bottom is equipped with hydrophobic layer（11）,
The hydrophobic layer（11）Top is equipped with young sand bed（2）, children's sand bed（2）Top is equipped with soft coating（8）, the babinet（5）
Outside is provided with air hole（4）, the babinet（5）Top is equipped with head cover（6）, the babinet（5）The lower right corner, which stretches out to be equipped with, opens
Mouth groove（12）, the open slot（12）With hydrophobic layer（11）Perforation, the open slot（7）Opening is equipped with warm water supply pipe
（10）, the open slot（7）Relative to babinet（5）Opposite be equipped with rhone（1）, the rhone（1）Also with hydrophobic layer
（11）Perforation.
2. the device of efficiently hatching tortoise according to claim 1, it is characterised in that：The hydrophobic layer（11）Bottom is covered with one
The hydrophobic bar of layer, the material of the hydrophobic bar are the one or more in waddy, branch, bamboo pole, there is broken stand above the hydrophobic bar
Stone.
3. the device of efficiently hatching tortoise according to claim 1, it is characterised in that：The water supply pipe（10）End is equipped with
Flow control valve（9）, the warm water supply pipe（10）Water inlet end connects solar water heater or plug-in accumulator.
4. the device of efficiently hatching tortoise according to claim 1, it is characterised in that：The babinet（5）It is divided into 3 layers, it is described
Babinet（5）Inorfil vacuum heat-insulation plate is followed successively by from outside to inside（501）, polyurethane（502）, alumina silicate（503）, outside interior
Each layer thickness ratio is 0.6 ~ 0.8:1.2~1.5:1.
5. the device of efficiently hatching tortoise according to claim 1, it is characterised in that：The babinet（5）Inner wall scribbles antifouling
Coating, the nonpolluting coating are made of following component and parts by weight：30-45 parts of fluorinated acrylic ester, 20-35 parts of silicon rubber, life
2-10 parts of thing anti-fouling agent, 15-25 parts of filler, 0.5-1 parts of organobentonite, 0.5-1 parts of Tissuemat E, 2-7 parts of propane diols.
6. the device of efficiently hatching tortoise according to claim 1, it is characterised in that：The testudinate egg（3）It is placed on young sand
Layer（13）With soft coating（8）Between.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711223286.XA CN108012985A (en) | 2017-11-29 | 2017-11-29 | The efficiently device of hatching tortoise |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711223286.XA CN108012985A (en) | 2017-11-29 | 2017-11-29 | The efficiently device of hatching tortoise |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN108012985A true CN108012985A (en) | 2018-05-11 |
Family
ID=62077303
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201711223286.XA Withdrawn CN108012985A (en) | 2017-11-29 | 2017-11-29 | The efficiently device of hatching tortoise |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN108012985A (en) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110692593A (en) * | 2019-09-27 | 2020-01-17 | 浙江海洋大学 | Tortoise egg hatching device capable of achieving automatic sterilization |
| CN110720427A (en) * | 2019-09-27 | 2020-01-24 | 浙江海洋大学 | Tortoise egg hatching device |
| CN112088838A (en) * | 2020-09-29 | 2020-12-18 | 朱大强 | Turtle hatching system |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4334500A (en) * | 1979-09-06 | 1982-06-15 | Ziller Henry H | Shipping container for live animals |
| CN1279011A (en) * | 1999-06-24 | 2001-01-10 | 吴文龙 | Method and equipment for incubating eggs of tortoise or turtle |
| CN103636559A (en) * | 2013-12-13 | 2014-03-19 | 电白县星火水生野生动物繁育场 | Terrapin hatching device |
| CN203709067U (en) * | 2013-11-21 | 2014-07-16 | 鲁银柱 | Simple turtle egg hatching device |
| CN203912996U (en) * | 2014-06-30 | 2014-11-05 | 合肥万合科技信息服务有限公司 | A kind of family simple and easy tortoise ovum hatching apparatus |
| CN204157493U (en) * | 2013-12-13 | 2015-02-18 | 电白县星火水生野生动物繁育场 | A kind of tortoise and turtle hatching device |
| CN104839055A (en) * | 2015-04-24 | 2015-08-19 | 韩庆 | Artificial hatching method for hybrid turtle |
-
2017
- 2017-11-29 CN CN201711223286.XA patent/CN108012985A/en not_active Withdrawn
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4334500A (en) * | 1979-09-06 | 1982-06-15 | Ziller Henry H | Shipping container for live animals |
| CN1279011A (en) * | 1999-06-24 | 2001-01-10 | 吴文龙 | Method and equipment for incubating eggs of tortoise or turtle |
| CN203709067U (en) * | 2013-11-21 | 2014-07-16 | 鲁银柱 | Simple turtle egg hatching device |
| CN103636559A (en) * | 2013-12-13 | 2014-03-19 | 电白县星火水生野生动物繁育场 | Terrapin hatching device |
| CN204157493U (en) * | 2013-12-13 | 2015-02-18 | 电白县星火水生野生动物繁育场 | A kind of tortoise and turtle hatching device |
| CN203912996U (en) * | 2014-06-30 | 2014-11-05 | 合肥万合科技信息服务有限公司 | A kind of family simple and easy tortoise ovum hatching apparatus |
| CN104839055A (en) * | 2015-04-24 | 2015-08-19 | 韩庆 | Artificial hatching method for hybrid turtle |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110692593A (en) * | 2019-09-27 | 2020-01-17 | 浙江海洋大学 | Tortoise egg hatching device capable of achieving automatic sterilization |
| CN110720427A (en) * | 2019-09-27 | 2020-01-24 | 浙江海洋大学 | Tortoise egg hatching device |
| CN110720427B (en) * | 2019-09-27 | 2021-07-13 | 浙江海洋大学 | Tortoise egg hatching device |
| CN110692593B (en) * | 2019-09-27 | 2021-07-13 | 浙江海洋大学 | Tortoise egg hatching device capable of achieving automatic sterilization |
| CN112088838A (en) * | 2020-09-29 | 2020-12-18 | 朱大强 | Turtle hatching system |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN101103676B (en) | Hypsizigus marmoreus industrial planting method and mushroom house system using thereof | |
| CN104186368B (en) | A kind of environmental protection, health and economizing type meat duck fermentation bed breeding house | |
| CN108012985A (en) | The efficiently device of hatching tortoise | |
| CN205727286U (en) | The seedling bed of suitable Herba Dendrobii | |
| CN103563840B (en) | Soft-shelled turtle hatching system | |
| CN203136815U (en) | Daylighting greenhouse | |
| CN104396870A (en) | Integrated incubation system for pelodiscus sinensis eggs | |
| CN104839055A (en) | Artificial hatching method for hybrid turtle | |
| CN204811413U (en) | Ecological pig farm | |
| CN201467829U (en) | Novel artificial temperature control incubation device for turtle egg | |
| CN103891623A (en) | Solar greenhouse housing for breeding domestic animals for table purpose | |
| CN101564020B (en) | Boar artificial insemination three-in-one feeding method and device thereof | |
| CN107410118A (en) | A kind of leech incubator and its application method | |
| CN101422140B (en) | Eaglemouth tortoise water-bath type hatching device | |
| CN203482768U (en) | Incubation device for soft-shelled turtles | |
| CN208874994U (en) | A kind of cultivation agaricus bisporus greenhouse automatic adjustment psychrometric means | |
| CN206602993U (en) | The sheep hurdle cultivated for sheep high bed | |
| CN202999085U (en) | Frogling breed pond | |
| CN103081865B (en) | Lighting greenhouse for turtle egg intensive cultivation | |
| CN202456136U (en) | Soil-free water bed batrachia cultivation colony house | |
| CN105918252A (en) | Snake breeding bed | |
| KR101407638B1 (en) | Hothouse equipment using fermentation heat | |
| CN2682809Y (en) | Regulate and control greenhouse | |
| CN109673320A (en) | A kind of houseplant cultivation unattended intelligent flowerpot | |
| CN104365537A (en) | Raised quasipaa spinosa hibernation treatment method |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WW01 | Invention patent application withdrawn after publication |
Application publication date: 20180511 |
|
| WW01 | Invention patent application withdrawn after publication |