CN104611409A - Rapid identification of Capsella bursa-pastoris anti-powdery mildew gene by using comparative genomics - Google Patents

Rapid identification of Capsella bursa-pastoris anti-powdery mildew gene by using comparative genomics Download PDF

Info

Publication number
CN104611409A
CN104611409A CN201310541423.XA CN201310541423A CN104611409A CN 104611409 A CN104611409 A CN 104611409A CN 201310541423 A CN201310541423 A CN 201310541423A CN 104611409 A CN104611409 A CN 104611409A
Authority
CN
China
Prior art keywords
gene
powdery mildew
mlo
shepherd
purse
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
CN201310541423.XA
Other languages
Chinese (zh)
Inventor
钱孝英
袁伟
钱春桃
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Changshu City Beibang Town Beigang Vegetable Specialized Cooperative
Original Assignee
Changshu City Beibang Town Beigang Vegetable Specialized Cooperative
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Changshu City Beibang Town Beigang Vegetable Specialized Cooperative filed Critical Changshu City Beibang Town Beigang Vegetable Specialized Cooperative
Priority to CN201310541423.XA priority Critical patent/CN104611409A/en
Publication of CN104611409A publication Critical patent/CN104611409A/en
Pending legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6888—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms
    • C12Q1/6895—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms for plants, fungi or algae
    • G—PHYSICS
    • G16—INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR SPECIFIC APPLICATION FIELDS
    • G16B—BIOINFORMATICS, i.e. INFORMATION AND COMMUNICATION TECHNOLOGY [ICT] SPECIALLY ADAPTED FOR GENETIC OR PROTEIN-RELATED DATA PROCESSING IN COMPUTATIONAL MOLECULAR BIOLOGY
    • G16B40/00—ICT specially adapted for biostatistics; ICT specially adapted for bioinformatics-related machine learning or data mining, e.g. knowledge discovery or pattern finding
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00—Oligonucleotides characterized by their use
    • C12Q2600/13—Plant traits

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biotechnology (AREA)
  • General Health & Medical Sciences (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Botany (AREA)
  • Molecular Biology (AREA)
  • Medical Informatics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Artificial Intelligence (AREA)
  • Databases & Information Systems (AREA)
  • Mycology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Bioethics (AREA)
  • Computer Vision & Pattern Recognition (AREA)
  • Data Mining & Analysis (AREA)
  • General Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Evolutionary Computation (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Software Systems (AREA)
  • Bioinformatics & Computational Biology (AREA)
  • Evolutionary Biology (AREA)
  • Spectroscopy & Molecular Physics (AREA)
  • Theoretical Computer Science (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The present invention provides rapid identification of Capsella bursa-pastoris anti-powdery mildew gene, relates to knowledge of plant comparative genomics, genetics, bioinformatics and other disciplines, and belongs to the plant biotechnology science field. The main steps of the invention comprise: 1) downloading the complete genome sequence of the Capsella bursa-pastoris, and collecting MLO type gene; 2) identifying the MLO type gene; 3) achieving the MLO type gene phylogeny relationship; and 4) comparing the MLO type powdery mildew gene. According to the invention, the Capsella bursa-pastoris powdery mildew gene finding period is effectively shortened so as to easily achieve rapid powdery mildew gene identification; the corresponding co-segregation function marker (SNP, SCAR and the like) is developed through the identified candidate powdery mildew gene, the Capsella bursa-pastoris anti-powdery mildew gene can further be rapidly used for the molecule marker-assisted selection of the anti-powdery mildew gene, and the accuracy is high; the Capsella bursa-pastoris anti-powdery mildew gene can be combined with other disease resistance gene molecule markers so as to create multi-resistance breeding materials, shorten the breeding period, and improve the breeding efficiency; and the foundation is established for exposition of the Capsella bursa-pastoris anti-powdery mildew molecule mechanism.

Description

Use comparative genomics Rapid identification shepherd's purse mildew-resistance gene
Technical field
The present invention is by means of shepherd's purse order-checking whole genome sequence, utilize the method Rapid identification shepherd's purse powdery mildew genes such as plant comparative genomics, genetics, information biology and candidate gene strategy, be mainly concerned with the download of shepherd's purse whole genome sequence, the qualification of candidate gene, the comparison of gene, the means such as cluster, and then identify powdery mildew gene, belong to Plant Biotechnology scientific domain.
Background technology
Shepherd's purse be Cruciferae shepherd's purse belong in one, biennial herb plant.Originate in China, current throughout world.The disease of shepherd's purse comprises the multiple diseases caused by fungi, bacterium and virus.Powdery Mildew is caused by obligate live body parasitical fungi, extensively occurs in land for growing field crops and greenhouse protecting field shepherd's purse cultivation and production, and spraying fungicide and plantation disease-resistant variety are the main method of this disease of defence.But life-time service sterilant can endanger environmental safety, and germ Race variation is easily caused to produce antagonistic action.Popularizing planting disease-resistant variety is safety, environmental protection and efficient control strategy.In conventional breeding practice, the selection for mildew-resistance material is very difficult: the seed selection cycle is long on the one hand, needs experience hybridization and the complicated select procedure that backcrosses; The combined influence being subject to several factors of Powdery Mildew on the other hand, such as: temperature, humidity and germ microspecies etc., the process of qualification resistant material is not easy to control.Therefore, the process that powdery mildew gene can accelerate seed selection resistant variety is excavated.According to literature search, find that China's shepherd's purse Powdery Mildew bacterial classification differentiation research data is less, work delayed, this hinders the work paces of clone's shepherd's purse disease-resistant gene virtually.
At present.The genetics of resistance result of study of researcher to shepherd's purse Powdery Mildew is less, and MLO type disease-resistant gene is the special class disease-resistant gene of plant.The mankind find that MLO resistance starts from 1937-1938 the earliest, fritz acquires the barley of a lot of kind in Ethiopia, two strains wherein all have efficient resistance to Powdery Mildew (Biumeriograminisfs P.hordei, Bgh) all known physiological strains.Further research shows, the recessive mutation mlo of barley MLO gene can make barley produce resistance that is lasting, wide spectrum to the physiological strain of nearly all known barley powdery mildew bacteria.Recently, investigator finds that the powdery mildew gene of a lot of plant is all that MLO type disease-resistant gene controls, as tomato, and pea, Arabidopis thaliana, rose, capsicum, Root or stem of Littleleaf Indianmulberry etc.Therefore the MLO type disease-resistant gene excavated in plant has important effect to Biology of Plant-Powdery Mildew Interaction breeding.
At present, the conventional method excavating disease-resistant gene conventional has map based cloning, the methods such as transposon tagging.But because the fundamental research of shepherd's purse is not deep enough, not only the time is grown but also is difficult to clone these genes exactly therefore to utilize these methods.Therefore, the MLO type disease-resistant gene how in Rapid identification shepherd's purse will become the important prerequisite of shepherd's purse mildew-resistance breeding.
Plant comparative genomics (Comparative Genomics) is based on Genome Atlas and order-checking basis, compares, understand the subject of the function of gene, expression mechanisms and spore to known gene and genome structure.Between Land use models Plant Genome and other Plant Genome on coded sequence and structural homology, clone's other plant gene, discloses gene function and molecular mechanism, illustrates spore relation and genomic immanent structure.The method that this patent adopts and thinking: the research of model plant arabidopsis gene group has disclosed the function of MLO type gene, utilize the homology clone shepherd's purse MLO type disease-resistant gene in its order of gene, according to the feature of the superiority in model plant Arabidopis thaliana experimental system and known MLO type disease-resistant gene, " seizure " shepherd's purse mildew-resistance gene fast.This patent describes premised on shepherd's purse whole genome sequence, in conjunction with knowledge such as comparative genomics, genetics, genomics, information biology and candidate gene strategy, excavates powdery mildew gene fast.
Summary of the invention
Technical problem
The object of this invention is to provide a kind of by conjunction with knowledge such as plant comparative genomics, plant genetics, genomics and information biology, excavate shepherd's purse mildew-resistance gene fast.Its result can be used for the exploitation of shepherd's purse powdery mildew gene compact linkage molecule mark on the one hand, carries out molecular marker assisted selection breeding, on the other hand also for other crop powdery mildew gene identification provide reference frame.
Technical scheme
Cardinal principle: first Biology of Plant-Powdery Mildew Interaction gene (MLO) is cloned from barley, research finds that this gene is the special disease-resistant gene of a class, is different from most of NBS (nucleotide-binding site) the type disease-resistant gene of previously clone; Subsequently, investigator has cloned powdery mildew gene in succession from the plants such as tomato, Arabidopis thaliana, pea, capsicum, Root or stem of Littleleaf Indianmulberry, and what research found these genes encodings is all MLO type disease-resistant gene.Subsequently, by test of many times, numerous investigator confirms that MLO type disease-resistant gene has become the distinctive class mildew-resistance gene of plant.Further discovery, plant MLO type gene is a gene family; And Phylogenetic Relationships analysis discovery is carried out to the MLO gene family deriving from different plant species, in different plant species mildew-resistance gene always cluster together, become a class, this class MLO gene all has the characteristic feature of mildew-resistance gene sequence.Completing of shepherd's purse gene order-checking provides a convenient approach for excavating powdery mildew gene.Therefore, can by means of the Phylogenetic Relationships of MLO gene family in the shepherd's purse full-length genome checked order and the MLO powdery mildew gene of having cloned and for maintaining the conservation of amino acids of powdery mildew gene MLO critical function to identify shepherd's purse powdery mildew gene.
Key step is as follows:
1) download of shepherd's purse whole genome sequence and the collection of MLO type gene thereof
First shepherd's purse whole genome sequence is downloaded from shepherd's purse sequenced genes group database (http://www.phytozome.net/search.php); Use " DNATOOLS " software to the shepherd's purse full-length genome amino acid sequence data building database obtained, then pfam database (protein family database is used, http://pfam.janelia.org/search/sequence) in hidden Markov model (HMM) Blastp (E-value=0.001) sequence alignment is carried out to the aminoacid sequence of MLO structural domain and the shepherd's purse full-length genome amino acid sequence database to have set up, preliminary screening goes out candidate gene sequence.Secondly, utilize the MLO type gene order announced, BLAST comparison is carried out to shepherd's purse genome database, obtain candidate gene sequence.
2) qualification of shepherd's purse MLO type gene family
By the candidate gene of homologous nucleotide sequence obtained in the above results, analyzed by Pfam (E-value=1.0), remove the gene order (Fig. 1) without ' MLO ' structural domain.The ClustalW instrument (Multiple Sequence Alignment program) Candidate Disease Resistant Genes sequence provided by MEGA3.1 software again carries out Multiple Sequence Alignment, removes tumor-necrosis factor glycoproteins.
3) by the shepherd's purse MLO type powdery mildew gene of the Phylogenetic Relationships qualification candidate of plant MLO type gene
Because previous research is verified, dicotyledons MLO type powdery mildew gene is positioned at plant MLO Phylogenetic Tree same district group, therefore in Phylogenetic Relationships research, we are MLO type mildew-resistance gene with shepherd's purse MLO type gene together with the cluster analysis of the MLO type gene family of Arabidopis thaliana with some other crops, to obtain the shepherd's purse mildew-resistance gene (Fig. 2) of candidate.
4) comparison of shepherd's purse powdery mildew gene and known plant MLO powdery mildew gene
BioXM2.6 software is utilized to convert the aminoacid sequence of the MLO powdery mildew gene of the MLO type powdery mildew gene of shepherd's purse candidate and Arabidopis thaliana, tomato, pea, barley the file of Fasta form to, these files are imported BioEdit7.0 software, use Clustal software in this software to carry out Multiple Sequence Alignment, disclose the conservative property in candidate's powdery mildew gene important amino acid residue and region.Thus identify the powdery mildew gene (Fig. 3) of shepherd's purse candidate further.
Positively effect of the present invention:
1) shorten shepherd's purse powdery mildew gene and excavate the cycle, be conducive to the Rapid identification of powdery mildew gene.Mildew-resistance gene not only takes time and effort, efficiency is low to adopt ordinary method (map based cloning, transposon tagging etc.) to excavate, and is difficult to successfully.The present invention is based on plant comparative genomics, genetics, bioinformatics method and excavate shepherd's purse powdery mildew gene fast, not only can shorten the time, powdery mildew gene determination rates can also be improved.
2) shepherd's purse (Capsella rubella) is one of important wild vegetable.Because shepherd's purse hereditary basis is narrow, Germplasm Resources Diversity is low, therefore more difficult by conventional molecule marker (RAPD, ISSR, SSR, AFLP etc.) qualification shepherd's purse powdery mildew gene.The candidate's powdery mildew gene exploitation be tested and appraised is divided into from functional indicia (SNP, SCAR etc.) accordingly, can fast for the molecular marker assisted selection of disease-resistant gene, carry out the initiative of multiresistance breeding material, can shortening the breeding cycle, improve breeding efficiency.
3) lay a good foundation for setting forth shepherd's purse mildew-resistance molecular mechanism.The qualification of shepherd's purse mildew-resistance gene, by transgenic technology, RNAi, virus induced gene silencing (virus induced gene silencing, VIGS) molecular mechanism of the Effect of Anti Powdery Mildew such as technology provides genetic resources, is conducive to the mechanism of action setting forth shepherd's purse mildew-resistance fast.
Accompanying drawing explanation
The qualification of Fig. 1 shepherd's purse MLO gene;
What this figure showed is 16 MLO type gene identification results, and each gene is containing ' MLO ' conserved domain.
The Phylogenetic Relationships analysis of Fig. 2 plant MLO gene family and the qualification of shepherd's purse MLO type powdery mildew gene thereof;
Arabidopis thaliana is the model plant of plant science research, in phylogenetic tree construction, the powdery mildew gene (PsMLO) of 15 MLO type genes (wherein 3 genes are powdery mildew genes: AtMLO02, AtMLO06 and AtMLO12) of Arabidopis thaliana, Gene against Powdery Mildew in Tomato (SlMLO), barley powdery mildew gene (HvMLO and HvMLO02) and pea is selected to and the analysis of shepherd's purse MLO type gene clusters.Identify the MLO type powdery mildew gene of 4 shepherd's purse candidates altogether.In figure, the gene of italic mark is exactly candidate's shepherd's purse powdery mildew gene.
The compare of analysis of Fig. 3 shepherd's purse MLO type powdery mildew gene;
4 shepherd's purse powdery mildew genes and barley (HvMLO), tomato (SlMLO), pea (PsMLO), Arabidopis thaliana powdery mildew gene (AtMLO02, AtMLO06 and AtMLO12) to compare, qualification powdery mildew infects the conservative type in amino-acid residue and the region played an important role.In figure, TM1-TM7 represents 7 revolving die regions of shepherd's purse MLO type powdery mildew gene; Black round dot represents that powdery mildew infects important amino-acid residue; CaMBD represents calmodulin CaM binding region; I and II represents and infects important amino acid region to powdery mildew.
Embodiment
The qualification of disease-resistant gene has important effect in the research of crop disease-resistant theory of heredity and disease-resistant variety seed selection.Present method Rapid identification can go out shepherd's purse powdery mildew gene.Specific implementation process is as follows:
1) collection of shepherd's purse MLO type gene
In order to obtain the whole MLO type gene family member of shepherd's purse, we are first with the MLO type gene of Arabidopis thaliana, the mildew-resistance MLO gene order of tomato, pea, capsicum, rose, capsicum, Root or stem of Littleleaf Indianmulberry builds HMM model, receives rope MLO type gene from shepherd's purse genome sequence, secondly the MLO gene order delivered in Different Crop as target sequence (from DFCI database: TC171015, TC267529, DFCI:TC327983, TC289653, TC312087, TC132500, TC133436, TC317623, TC317025, TC315947, TC325903, TC315944, TC315912, TC322759, TC322059, TC330654, TC282713, TC293173, TC281861, TC283253, TC283383, TC285032, TC290021, TC302716, TC283487, TC282866, TC283441, TC281428, TC285118, TC285090, from GenBank database: AY967408, AF384145, AF384144, AY029312-AY029315, AY029317-AY029319, Z95352, AF369563-AF369565, AF369567, AF369569-AF369576, Z83834, Z95496, AY581255), BLAST comparison is carried out to shepherd's purse database (http://www.phytozome.net/search.php), select the highest sequence of similarity to download, obtain the MLO type gene (Carubv10008710 of 16 candidates altogether, Carubv10008691, Carubv10009086, Carubv10011850, Carubv10012285, Carubv10020030, Carubv10015854, Carubv10015833, Carubv10025579, Carubv10022893, Carubv10025059, Carubv10017025, Carubv10000540, Carubv10004686, Carubv10026162, Carubv10028002, ).
2) qualification of shepherd's purse MLO type gene conserved domain
In order to verify these MLO gene accuracys further, we have carried out the qualification of conserved domain " MLO " to the MLO gene of these 16 candidates.With the aminoacid sequence of the MLO type gene of each candidate for benchmark, PFAM (http://pfam.sanger.ac.uk/) website is carried out the qualification of ' MLO ' conserved domain, and concrete outcome is shown in Fig. 1.
3) the Phylogenetic Relationships analysis of shepherd's purse MLO type gene
In previous research, find that dicotyledons powdery mildew gene aggregates into district's group; Therefore, in phylogenetic tree construction, we have selected 15 MLO type genes (wherein 3 genes are powdery mildew genes: AtMLO02, AtMLO06 and AtMLO12) of model plant Arabidopis thaliana, the powdery mildew gene of Gene against Powdery Mildew in Tomato, barley powdery mildew gene and pea analyze with shepherd's purse MLO type gene clusters together with cluster analysis.Shepherd's purse MLO type gene and other crop powdery mildew gene protein sequences are carried out multisequencing connection to join (adopting Clustal X1.83 software to carry out), and utilize Genedoc software (http://www.nrbsc.org/gfx/genedoc/index.html) to show multisequencing to join the result of joining.Clustal multisequencing is joined the result of joining output in MEGA4.0 software, and utilize this software to construct adjacent tree (neighbor-joining, NJ) respectively, utilize Bootstrapping method to assess these evolutionary trees.Found that in dicotyledons mildew-resistance gene district group, there is the MLO type powdery mildew gene (see Fig. 2) of 4 shepherd's purse candidates.
4) comparison of shepherd's purse MLO type disease-resistant gene
In the research of barley MLO type powdery mildew gene, in succession found some important areas and single amino acids in research, they infect large wheat powdery mildew irreplaceable effect.In order to identify in the shepherd's purse powdery mildew gene of 4 candidates, these important areas and amino acid whether high conservative, we have carried out amino acid alignment analysis to from 3 mildew-resistance genes (AtMLO02, AtMLO6 and AtMLO12) of Arabidopis thaliana, tomato powdery mildew gene (SlMLO), powdery mildew of pea gene (PsMLO).Find the powdery mildew gene of shepherd's purse 4 candidates and known MLO type powdery mildew gene 7 cross-film districts, 30 important amino-acid residue, 1 calmodulin CaM binding region (CaMBD) and two regions played an important role with powdery mildew identification (I and II) high conservative (Fig. 3).Show that these four genes are exactly shepherd's purse MLO type mildew-resistance gene.

Claims (2)

1. shepherd's purse mildew-resistance gene, it is characterized in that being selected from following 4 genes or its one of:
carubv10022893m.g
Aminoacid sequence:
MAIKERTLEETPTWAVAVVCFVLLFISIMIEYFLHFVGHWFKKKHKKALYEALEKVKAELMLLGFISLLLVVLQDPVSQICIPRKVASTWHPCTHHQEMVKYGKDYVDDGRKILEDFDSTDVFGPRRSLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHILYCIITYALGKTKMKKWKSWEKETKTIEYQYANDPERFRFARDTSFGRRHLNMWSKSSVTLWITCFFRQFFGSVTKVDYLTLRHGFIMAHLPAGSAARFDFQKYIQRSLEEDFTVVVGISPLIWCIAVLFILTNTNGWASYLWLPFIPLLVILVVGAKLQMIISKLGLRIQDKGDVVKGAPVVEPGDDLFWFGRPRLILFLIHLVLFTNAFQLAFFVWSTYEFTLRNCFHHKNEDIAIRITMGVLIQVICSYITLPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHGQSGSNTPHSSRPATPTHGMSPVHLLHNYHNRSSLDQQTSFTASPSPPRFSDYSGHGHGHHQFFDPESQNHSYQREITDSEFSNSHHPHTDVASPVREEMQIVEHVKVDLPEFTFKK
Nucleotide sequence:
ATGGCGATAAAAGAGCGAACACTGGAGGAGACACCAACATGGGCTGTTGCTGTTGTTTGCTTCGTTCTCCTTTTCATTTCCATCATGATCGAATATTTCTTGCACTTTGTTGGTCACTGGTTTAAAAAGAAGCACAAGAAAGCTTTATATGAAGCTCTTGAAAAGGTTAAAGCAGAATTGATGCTACTGGGATTCATATCGCTTCTATTGGTGGTATTGCAAGATCCAGTCTCTCAGATTTGCATTCCAAGAAAAGTTGCTTCGACTTGGCATCCTTGTACCCACCATCAAGAAATGGTTAAATACGGTAAAGATTATGTCGACGATGGCCGCAAGATTCTTGAAGACTTTGACTCCACCGACGTTTTTGGTCCTCGCCGCAGTTTAGCCACCAAAGGTTATGACAAATGCGCAGAAAAGGGAAAAGTAGCATTAGTATCTGCATATGGTATCCACCAGCTGCATATATTCATCTTTGTGCTTGCTGTTTTTCATATCCTCTACTGCATTATAACCTATGCTTTGGGGAAGACCAAGATGAAGAAATGGAAGTCATGGGAGAAAGAGACCAAAACAATTGAGTACCAATATGCCAATGATCCCGAGAGGTTCAGATTTGCAAGAGACACATCGTTCGGACGTAGACATTTGAACATGTGGAGCAAGTCTTCCGTTACCCTCTGGATTACATGTTTCTTCAGACAATTCTTTGGATCAGTGACAAAAGTGGATTATCTTACACTAAGACATGGCTTTATTATGGCGCATTTGCCAGCAGGAAGTGCAGCTCGTTTCGATTTCCAAAAATACATTCAAAGATCTTTGGAAGAAGATTTCACGGTGGTGGTCGGCATAAGTCCATTGATATGGTGCATTGCTGTCTTATTCATATTGACCAACACAAATGGATGGGCTTCATATCTTTGGTTGCCCTTCATCCCATTGCTTGTGATATTGGTAGTAGGAGCAAAACTTCAAATGATAATATCCAAGTTAGGATTAAGGATTCAAGACAAAGGAGATGTGGTTAAAGGAGCTCCTGTGGTTGAACCGGGTGATGATCTCTTCTGGTTTGGTCGTCCTCGTTTGATCCTCTTCCTCATCCACTTGGTCCTTTTCACGAATGCATTTCAACTGGCTTTCTTCGTTTGGAGCACTTACGAATTCACACTCCGAAACTGCTTCCACCACAAAAACGAAGATATTGCAATTAGGATCACCATGGGGGTATTAATACAAGTTATATGCAGCTACATCACTCTACCTCTCTATGCTCTTGTTACTCAGATGGGAACTTCAATGAGGCCGACCATATTCAACGATAGGGTAGCAAATGCATTGAAGAAATGGCACCACACAGCCAAGAAACAGACGAAACATGGACAGTCGGGATCTAACACACCTCACTCTAGCCGCCCTGCTACGCCAACTCATGGCATGTCACCGGTGCATCTCCTCCACAACTACCATAACCGCAGCAGCCTCGACCAACAAACCAGCTTCACGGCCTCTCCTTCTCCTCCTAGATTCTCTGATTATAGCGGCCATGGCCATGGCCATCATCAGTTCTTCGACCCTGAATCTCAGAATCACTCTTACCAGCGTGAGATCACAGATTCTGAATTCAGCAACAGTCATCATCCCCATACTGACGTTGCAAGTCCTGTTAGAGAAGAGATGCAGATTGTTGAGCATGTCAAGGTTGATTTGCCTGAATTTACCTTCAAGAAGTAG
carubv10009086m.g
Aminoacid sequence:
MADATLEETSTWTVAVVCFVLLLISIALEHLLHTLGTWFKKKHKSDLFEALEKVKAELMLLGFISLLLTIAQAPISHICISKKLASIMQPCSPAQAAKLKADRAKKEGGYGEKPGGKLLLELAEFYIPRRSLAGKVENTCEKKGKVPFVSYYGIHQLHIFIFVLAVVHIIYCIVIYALGKTKMRRWQPWEEEAKSIEYQFSNDPERFRFARDTSFGRRHLSFWSKRSVTLWTVCFFRQFFGSITKVDYLTLRHGFITAHFAPGQSSYDFRKLIQRTLEKDFKTVVEISPVIWFVAVLFLLTNTSGLYSHFWLPFIPLVVSLIVGTKLEVIITQLGQSIQEKDEIVRGAPVVRPKDDLFWFSKPRFVLFLIHLVLFTNAFQLAFFAWSTFSFGIKNCFHASIPDVVTRLVSFCTDTLQLCDSSTLCTCYSHGYSNEANSIQRRSSHSIREVASDGEEPD
Nucleotide sequence:
ATGGCAGACGCGACTTTAGAGGAGACCTCTACGTGGACAGTAGCTGTGGTTTGCTTCGTCTTACTACTCATTTCGATTGCGCTCGAACATTTGCTTCACACACTTGGAACCTGGTTTAAAAAGAAGCACAAAAGCGATCTATTTGAAGCTCTTGAAAAGGTCAAAGCAGAGCTTATGTTGTTGGGATTCATATCACTACTCCTAACAATTGCACAAGCACCAATCTCACATATTTGCATCTCCAAGAAACTTGCATCGATAATGCAACCTTGCAGTCCCGCCCAAGCAGCGAAATTAAAGGCCGATAGGGCAAAGAAAGAAGGTGGATATGGAGAAAAACCCGGTGGAAAACTTCTTCTTGAGCTGGCTGAATTTTATATCCCTAGAAGAAGTTTAGCCGGCAAAGTTGAGAACACATGCGAAAAGAAGGGGAAAGTGCCTTTTGTATCTTATTATGGAATCCACCAGCTGCATATATTCATCTTCGTGCTCGCAGTGGTTCATATTATTTACTGCATTGTTATTTATGCTCTCGGAAAGACCAAGATGAGAAGGTGGCAGCCGTGGGAGGAGGAGGCAAAGTCAATAGAGTATCAGTTTTCCAACGATCCTGAGAGGTTCAGGTTTGCGAGGGACACATCTTTTGGGAGAAGACATCTCAGTTTCTGGAGCAAGAGGAGTGTTACACTATGGACTGTGTGTTTTTTCAGACAGTTCTTTGGATCCATCACCAAAGTTGATTACTTAACATTAAGACATGGTTTTATCACGGCGCATTTCGCTCCCGGCCAATCAAGCTACGATTTCCGTAAGTTAATCCAGAGAACGTTAGAGAAAGACTTCAAAACCGTTGTTGAAATCAGTCCTGTTATCTGGTTTGTCGCCGTGCTATTCCTCTTGACCAATACAAGTGGGTTATATTCTCACTTCTGGTTACCATTCATTCCACTAGTCGTAAGTCTAATCGTTGGAACAAAGCTTGAAGTCATAATAACACAATTGGGTCAAAGTATCCAAGAGAAAGACGAAATAGTGAGAGGCGCCCCTGTGGTTCGGCCTAAAGATGACCTCTTCTGGTTTAGCAAGCCACGTTTCGTTCTTTTCCTTATCCACTTGGTCCTCTTTACGAATGCATTTCAACTTGCCTTCTTTGCCTGGAGCACGTTTTCATTCGGGATCAAGAATTGTTTCCATGCAAGCATTCCAGATGTGGTCACTAGACTTGTTAGCTTTTGTACAGATACTTTGCAGCTATGTGACTCTTCCACTCTATGCACTTGTTACTCACATGGGTACTCAAATGAAGCCAACAGTATTCAACGAAGGAGTAGCCACAGCATTAGAGAAGTGGCATCAGACGGCGAAGAACCAGACTAA
carubv10008691m.g
Aminoacid sequence:
MANQVKERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFRKKHKKALFEALEKVKAELMLLGFISLLLTIGQTPISNICISEQVASTMHPCSAAEEARKYHKKDPAKKEHGDGDGEKSGRRLLLELAESYIPRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFVLAVVHVIYCIVTYALGKTKMRRWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLNFWSKSSVTLWVVCFFRQFFGSVTKVDYLALRHGFIMAHLAHGSESRFDFRKYIQRSLEEDFKTVVEISPVIWF VAVLFLLTNTNGLRSYLWLPFIPLIVILIVGTKLQVIITKLGLRIQEKGDVVRGAPVVQPGDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLRNCFHESNADVVIRIAVGVVVQILCSYVTLPLYALVTQMGTKMKPTVFNERVATALKKWHHTAKSQTKHGRHSESNTPFSSRPTTPTHGSSPIHLLHNFNNRNVDSYPTSPSPRYSGHGHHDEHQFWDPESQRQEAETSTHHSLAHESSERKPALASVELPPIRTSKSLKDFSFKR
Nucleotide sequence:
ATGGCGAATCAAGTTAAGGAGCGGACTTTAGAAGAGACCTCTACGTGGGCAGTAGCTGTGGTTTGCTTCGTCTTACTATTTATTTCGATTGTTCTCGAACATTCGATTCACAAAATTGGAACCTGGTTTAGAAAGAAGCACAAGAAGGCTCTATTTGAAGCTCTTGAAAAGGTCAAAGCAGAGCTTATGCTGTTGGGATTCATATCACTACTCCTCACTATTGGACAAACGCCAATCTCAAATATCTGCATCTCCGAGCAGGTTGCATCGACAATGCACCCTTGCAGCGCCGCGGAAGAAGCTAGAAAATACCACAAGAAAGACCCCGCAAAGAAAGAACATGGAGATGGAGATGGAGAAAAATCGGGTCGAAGACTTCTTCTTGAGTTAGCTGAATCTTATATCCCTAGACGAAGTTTAGCCACCAAAGGTTATGACAAATGTGCAGAGAAGGGGAAAGTGGCTTTTGTATCTGCTTATGGAATCCACCAGTTGCATATATTCATCTTTGTGCTGGCCGTGGTTCATGTTATTTATTGCATTGTTACTTATGCTCTCGGAAAGACTAAGATGAGGAGGTGGAAGTCATGGGAGGAGGAGACGAAGACAATAGAGTATCAGTATTCCAATGATCCTGAGAGGTTCAGGTTTGCGAGGGACACATCCTTTGGGAGAAGACATCTCAATTTCTGGAGTAAGTCGAGTGTTACACTATGGGTTGTGTGTTTTTTCAGACAGTTCTTTGGATCTGTCACCAAAGTTGATTACTTAGCACTAAGACATGGTTTCATCATGGCGCATTTGGCTCACGGGAGCGAATCAAGATTTGATTTCCGCAAGTATATTCAGAGATCATTAGAGGAAGACTTCAAAACTGTTGTTGAAATCAGTCCGGTTATTTGGTTTGTCGCGGTGCTATTCCTCTTGACCAATACAAATGGACTACGTTCTTACCTTTGGTTACCATTTATTCCACTAATCGTAATTCTAATAGTTGGAACAAAGCTTCAAGTCATAATTACCAAATTGGGTCTAAGAATCCAAGAGAAAGGTGATGTGGTGAGAGGTGCTCCGGTGGTTCAGCCTGGTGATGACCTCTTCTGGTTTGGCAAGCCACGGTTCATTCTTTTTCTTATCCACTTGGTCCTCTTTACGAATGCATTTCAACTAGCCTTCTTTGCCTGGAGTACGTATGAGTTCAATCTCAGGAATTGTTTCCATGAAAGCAATGCAGATGTGGTCATTAGGATTGCAGTTGGAGTTGTTGTGCAGATACTTTGCAGCTATGTGACTCTTCCACTCTATGCACTTGTTACTCAGATGGGTACTAAGATGAAGCCAACAGTATTTAACGAAAGAGTAGCCACAGCATTAAAGAAGTGGCATCACACGGCAAAGAGCCAGACTAAACACGGAAGACACTCTGAATCAAACACACCTTTCTCTAGCCGTCCAACCACACCAACACATGGCTCATCTCCCATCCATCTCCTTCACAATTTCAATAACCGGAACGTTGACAGTTACCCAACTTCTCCTTCTCCTAGATACTCTGGTCATGGTCATCATGATGAACACCAGTTTTGGGATCCTGAGTCTCAACGCCAAGAAGCTGAAACGTCCACACATCATTCTCTTGCGCATGAAAGCTCAGAAAGGAAGCCGGCTCTTGCATCTGTTGAACTTCCTCCAATAAGGACTAGCAAAAGCTTAAAAGATTTCTCTTTTAAGAGATGA
carubv10020030m.g
Aminoacid sequence:
MAEQVKEKTLEETSTWAVAVVCFVLLLISIVIENLIHKIGSWFKNKNKKALYEALEKVKAELMLMGFISLLLTIGQGYISNICIPKNIAASMHPCSAAEEARKYGKKLVPKVQEDGGDDDDNSRRKLLQLVDSIIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIYCIVTYALGKTKMRRWKRWEQETKTIEYQYSHDPERFRFARDTSFGRRHLNFWSRTTVTLWIVCFFRQFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTVVEINPVIWFVAVLFLLTNTNGLNSYLWLPFIPFVVILIVGTKLQVIITKLGLRIQEKGDVVKGTPLVQPSDHFFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFGLKNCFHESSVDVIIRISIGLIVQILCSYVTLPLYALVTQMGSKMKPTVFNERVAIALKSWHHTAKKQIKHGRTSESTTPFSSRPTTPTHGSSPIHLLRNVPHKRSRSVDDNSFANSMSPRRNSDFDSWDPESQHETAETSTNSNHRSRFREEESEKKLGPSSSVELPPGPGQIRTQHDISNISLRDFSFKR
Nucleotide sequence:
ATGGCGGAACAAGTGAAAGAAAAAACATTAGAGGAAACTTCTACATGGGCCGTCGCTGTGGTTTGCTTCGTCTTGCTTCTGATTTCTATTGTTATTGAGAATCTTATTCATAAAATTGGATCCTGGTTTAAAAACAAGAACAAAAAAGCTTTATATGAAGCTCTTGAAAAAGTGAAAGCAGAGCTTATGCTGATGGGATTCATATCACTACTGCTTACTATTGGACAAGGCTACATCTCGAATATTTGCATCCCTAAGAACATCGCAGCGTCGATGCACCCTTGTAGTGCAGCCGAAGAAGCGAGAAAGTACGGTAAGAAATTAGTCCCAAAGGTCCAGGAAGACGGAGGAGACGACGATGACAACTCGCGTCGAAAGCTTCTCCAATTAGTCGATTCTATCATTCCTCGAAGGAGTTTGGCTACCAAAGGTTATGATAAGTGTGCAGAGAAGGGGAAAGTCGCTTTTGTATCGGCTTATGGCATGCATCAGCTGCATATATTCATCTTTGTTCTTGCGGTTTGTCATGTGATTTACTGCATTGTTACTTATGCTTTGGGGAAGACCAAGATGAGAAGGTGGAAGAGGTGGGAACAGGAGACGAAGACAATCGAATATCAGTATTCACACGATCCCGAGAGGTTTAGGTTCGCGAGGGATACATCTTTCGGGCGTAGACATCTGAATTTCTGGAGCAGAACAACTGTTACGCTGTGGATTGTATGTTTCTTCAGACAGTTCTTTAGATCAGTAACCAAAGTTGATTACTTAACACTGAGACATGGTTTCATCATGGCTCATTTGGCTCCTGGGAGCGATGCAAGATTCGATTTCCGAAAGTACATTCAGAGATCATTAGAGGAAGACTTTAAAACCGTTGTCGAGATCAATCCTGTGATCTGGTTCGTCGCTGTCTTGTTTCTCCTGACCAACACAAACGGATTGAATTCTTACCTCTGGTTACCTTTCATTCCTTTTGTCGTGATTCTTATCGTTGGGACAAAACTTCAAGTGATAATAACAAAACTAGGACTACGAATCCAAGAGAAAGGCGACGTAGTAAAAGGCACACCGCTTGTTCAGCCCAGTGATCATTTCTTCTGGTTCGGTCGCCCACGTTTCATTCTCTTCCTCATTCACTTGGTTCTCTTCACGAACGCGTTTCAACTCGCTTTCTTTGTCTGGAGTACGTATGAATTCGGTCTAAAGAACTGTTTCCATGAAAGCAGTGTAGATGTAATCATCAGAATCTCAATCGGACTTATTGTCCAGATTCTTTGCAGCTACGTTACTCTTCCTCTTTACGCTCTTAGTCACTCAGATGGGTTCAAAGATGAAACCAACAGTGTTCAACGAGAGAGTAGCAATAGCATTAAAGAGTTGGCACCACACAGCAAAGAAACAGATCAAACATGGAAGAACCTCAGAATCAACCACACCTTTCTCTAGCCGACCAACAACACCAACACATGGTTCTTCTCCGATTCATCTCCTCCGCAACGTCCCTCACAAACGAAGCAGAAGCGTTGACGATAACAGCTTTGCGAATTCAATGTCTCCGAGAAGAAACTCTGATTTCGATTCGTGGGATCCTGAGTCTCAACACGAAACTGCTGAGACTTCGACGAACTCAAATCATCGTTCAAGGTTTAGAGAAGAAGAATCGGAGAAAAAGCTTGGACCTTCTTCATCTGTTGAACTTCCTCCTGGACCTGGTCAGATACGAACTCAGCATGATATTAGTAATATCAGCTTAAGGGATTTTTCGTTTAAGCGGTGA。
2. the application of Rapid identification shepherd's purse powdery mildew gene described in claim 1, comprising:
1) initiative or the new variety initiative of the breeding material of mildew-resistance MLO gene is carried: utilize the MLO GENE SOURCES given by right 1 to be parent material, in hybridization, backcross progeny, the breeding material that transformation has MLO resistant gene can be obtained.
2) mildew-resistance fundamental research: molecular marker analysis is carried out to the MLO type mildew-resistance gene of right 1; Molecular Mapping or the assignment of genes gene mapping are carried out to this gene; This gene is cloned and Interaction among genes analysis.
3) mildew-resistance transgenic research: utilize the MLO type powdery mildew gene given by claim 1 to carry out transgenic research.
CN201310541423.XA 2013-11-04 2013-11-04 Rapid identification of Capsella bursa-pastoris anti-powdery mildew gene by using comparative genomics Pending CN104611409A (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN201310541423.XA CN104611409A (en) 2013-11-04 2013-11-04 Rapid identification of Capsella bursa-pastoris anti-powdery mildew gene by using comparative genomics

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201310541423.XA CN104611409A (en) 2013-11-04 2013-11-04 Rapid identification of Capsella bursa-pastoris anti-powdery mildew gene by using comparative genomics

Publications (1)

Publication Number Publication Date
CN104611409A true CN104611409A (en) 2015-05-13

Family

ID=53146058

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201310541423.XA Pending CN104611409A (en) 2013-11-04 2013-11-04 Rapid identification of Capsella bursa-pastoris anti-powdery mildew gene by using comparative genomics

Country Status (1)

Country Link
CN (1) CN104611409A (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109913466A (en) * 2019-03-12 2019-06-21 天津大学 The sedum lineare gene of resistance to Cd SlSERK3 and its application

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102703463A (en) * 2012-03-31 2012-10-03 常熟市支塘镇新盛技术咨询服务有限公司 Rapid identification of powdery mildew resistance Lotus corniculatus genes utilizing comparative genomics

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102703463A (en) * 2012-03-31 2012-10-03 常熟市支塘镇新盛技术咨询服务有限公司 Rapid identification of powdery mildew resistance Lotus corniculatus genes utilizing comparative genomics

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
WRIGHT S. ET AL.: "ROGGU9", 《UNIPROTKB》 *
WRIGHT S.ET AL.: "ROGW59", 《UNIPROTKB》 *
WRIGHT S.ET AL.: "ROGWN9", 《UNIPROTKB》 *
WRIGHT S.ET AL.: "ROHRZ6", 《UNIPROTKB》 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109913466A (en) * 2019-03-12 2019-06-21 天津大学 The sedum lineare gene of resistance to Cd SlSERK3 and its application

Similar Documents

Publication Publication Date Title
Du et al. Resequencing of 243 diploid cotton accessions based on an updated A genome identifies the genetic basis of key agronomic traits
CN102719448A (en) Application of bioinformatics in fast identifying powdery mildew resistance gene of carica papaya l
CN102703463A (en) Rapid identification of powdery mildew resistance Lotus corniculatus genes utilizing comparative genomics
CN102796745A (en) Method for quickly identifying manihot esculenta mildew-resistance locus (MLO) gene by applying comparative genomics
CN102703464A (en) Rapid identification of MLO (mildew resistance locus o) powdery mildew resistance Poncirus trifoliata genes
CN102703462A (en) Rapid identification of anti-powdery-mildew gene of Brachypodium distachyon
CN102719447A (en) Rapid identification of linum usitatissimum MLO-type powdery mildew resistance genes
CN102719445A (en) Rapid identification of powdery mildew gene of Medicago truncatula by utilizing comparative genomics
Jia et al. Genome-wide survey and expression analysis of the stress-associated protein gene family in desert poplar, Populus euphratica
CN102719446A (en) Method for rapidly identifying orange MLO powdery mildew resistance gene
Douglas Populus as a model tree
Song et al. Genome-wide analysis of nucleotide-binding site disease resistance genes in Medicago truncatula
CN104593481A (en) Rapid identification of soybean anti-powdery mildew gene by using candidate gene strategy
Majumder et al. Molecular breeding for improving drought tolerance in rice: recent progress and future perspectives
CN104593480A (en) Application of comparative genomics to rapid identification of phaseolus vulgaris mildew resistance locus o gene
CN104611408A (en) Rapid identification of watermelon MLO type anti-powdery mildew gene
CN104611409A (en) Rapid identification of Capsella bursa-pastoris anti-powdery mildew gene by using comparative genomics
CN104561024A (en) Rapid identification of MLO (Mycoplasma Like Organism) powdery mildew resistant genes of melon
CN104611407A (en) Rapid identification of strawberry powdery mildew gene by using comparative genomics
CN104593379A (en) Rapid identification of powdery mildew resistant gene of Chinese cabbage by using comparative genomics
Assefa et al. Application of molecular tools in breeding cereal crops for drought tolerance
CN104561034A (en) Rapid identification method for powdery mildew resistant gene of foxtail millet
CN104561035A (en) Rapid identification of sorghum gene resistant to powdery mildew
CN104561033A (en) Rapid identification on wheat MLO type powdery mildew gene
Lin et al. Chinese fir genome and the evolution of gymnosperms

Legal Events

Date Code Title Description
C06 Publication
PB01 Publication
C10 Entry into substantive examination
SE01 Entry into force of request for substantive examination
WD01 Invention patent application deemed withdrawn after publication
WD01 Invention patent application deemed withdrawn after publication

Application publication date: 20150513