WO2024096540A1 - 재조합 sod3 단백질의 생산 방법 - Google Patents

재조합 sod3 단백질의 생산 방법 Download PDF

Info

Publication number
WO2024096540A1
WO2024096540A1 PCT/KR2023/017177 KR2023017177W WO2024096540A1 WO 2024096540 A1 WO2024096540 A1 WO 2024096540A1 KR 2023017177 W KR2023017177 W KR 2023017177W WO 2024096540 A1 WO2024096540 A1 WO 2024096540A1
Authority
WO
WIPO (PCT)
Prior art keywords
sod3
deletion
hbd
ckaa
protein
Prior art date
Application number
PCT/KR2023/017177
Other languages
English (en)
French (fr)
Inventor
최소영
김상길
Original Assignee
재단법인 오송첨단의료산업진흥재단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 재단법인 오송첨단의료산업진흥재단 filed Critical 재단법인 오송첨단의료산업진흥재단
Publication of WO2024096540A1 publication Critical patent/WO2024096540A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C12N9/0089—Oxidoreductases (1.) acting on superoxide as acceptor (1.15)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/76—Albumins
    • C07K14/765—Serum albumin, e.g. HSA
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62—DNA sequences coding for fusion proteins
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/0004—Oxidoreductases (1.)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y115/00—Oxidoreductases acting on superoxide as acceptor (1.15)
    • C12Y115/01—Oxidoreductases acting on superoxide as acceptor (1.15) with NAD or NADP as acceptor (1.15.1)
    • C12Y115/01001—Superoxide dismutase (1.15.1.1)

Definitions

  • the present invention relates to a method for producing recombinant SOD3 protein.
  • SOD1 human superoxide dismutase
  • Cu/Zn SOD copper/zinc SOD
  • SOD1 the SOD1 gene polymorphisms
  • any mutant causes amyotrophic lateral lesions. It is associated with amyotrophic lateral sclerosis (ALS).
  • SOD2 which exists in the mitochondria of cells, is called manganese SOD (Mn SOD) and has the characteristic of containing manganese in the form of a tetramer.
  • SOD3 contains copper and zinc in the form of a tetramer in the extra cellular region and plays an antioxidant role in various parts of the human body.
  • SOD3 Extracellular superoxide dismutase 3
  • SOD3 Extracellular superoxide dismutase 3
  • this protein has the problem of inducing high oligomerization due to non-specific interactions and disulfide bonds, and also inducing heterogeneous SOD3 due to proteolytic cleavage of the C-terminus of SOD3.
  • SOD3 When SOD3 is expressed independently, drug development is limited due to the low expression rate. Accordingly, various studies have been reported to improve the expression rate of SOD3 by inducing glycosylation in the K41N mutant. In addition, SOD3 has a short half-life, which limits its development as a medicine, and research is underway to solve this problem by fusion with HSA.
  • Patent Document 1 “EC SOD and Cell-Permeable EC SOD and Their Uses” describes a pharmaceutical composition for preventing or treating skin diseases containing EC SOD protein as an active ingredient (Claim 1). Additionally, human EC SOD It is described that a fusion protein fusing the ⁇ HD/EC SOD protein with the heparin domain removed and HIV-1 Tat was prepared and used in experiments. (Identification number [129])
  • Patent Document 2 “Extracellular secretion superoxide dispersion” “Method for increasing cell permeability of a mutase (EC-SOD) protein” includes contacting a cell with an EC-SOD protein containing a heparin binding domain and a zinc divalent cation. A method for doing so is described.
  • Patent Document 3 describes “a composition for preventing or treating dry eyes containing SOD3.” Upon examination, it can be seen that the target is the SOD3 protein, which has a heparin binding domain in the C-terminal region (amino acid residues 210 to 215) (identification number [0023]).
  • Claim 1 of Patent Document 4 states, “A composition for stabilizing the catalytic activity of extracellularly secreted superoxide dismutase (EC-SOD) protein containing HSA (human serum albumin) as an active ingredient, wherein the composition is mixed with EC-SOD.
  • EC-SOD extracellularly secreted superoxide dismutase
  • HSA human serum albumin
  • Claim 4 describes that the EC-SOD of claim 1 is a human EC-SOD gene. Therefore, in this document, since EC-SOD, which is the subject of fusion with HSA, is a human gene, it cannot be said that it was intended to change or remove the heparin binding domain of EC SOD.
  • Patent Document 5 is about the EC-SOD gene adjusted to optimize expression in plants.
  • SEQ ID NO: 2 is the base sequence of hEC-SOD from which SP and HBD converted to the codon preferred by tobacco are removed (identification number [0093]).
  • SEQ ID NO: 2 is the base sequence of hEC-SOD from which SP and HBD converted to the codon preferred by tobacco are removed (identification number [0093]).
  • SOD3 superoxide dismutase 3
  • Claim 1 of Patent Document 8 states, “Extracellularly secreted superoxide dismutase (EC-SOD) protein stabilization containing at least one selected from the group consisting of BSA (bovine serum albumin) and FBS (fetal bovine serum) as an active ingredient.
  • BSA bovine serum albumin
  • FBS fetal bovine serum
  • Patent Document 9 describes a composition for preventing or treating diseases caused by angiogenesis, which uses a recombinant EC SOD (extracellular superoxide dismutase) protein from which the heparin-binding domain has been removed as an active ingredient.
  • EC SOD extracellular superoxide dismutase
  • Claim 1 of Patent Document 10 states, “Extracellularly secreted superoxide comprising the step of conjugating HSA (human serum albumin) protein to the N-terminus or C-terminus of the extracellularly secreted superoxide dismutase (EC-SOD) protein. “Method for stabilizing dismutase (EC-SOD) protein” is described. Looking at the description of EC-SOD, it is basically described as having a heparin binding domain in the C-terminal region (amino acid residues 210 to 215) (identification number [0047]), and also in the claims.
  • HSA human serum albumin
  • SEQ ID NO: 9 and SEQ ID NO: 22 described in 3 contain a heparin binding domain because they are the 19-240 fragment of SEQ ID NO: 5 and the 19-240 fragment of SEQ ID NO: 7, respectively. (ID: [0048], Sequence Listing)
  • the challenge is to solve the high oligomerization, proteolytic cleavage, and low expression rate that occur during SOD3 protein production.
  • Solution 1 is recombinant SOD3, which includes the step of removing amino acid residues 219-229 of the heparin binding domain (HBD) of the extracellular superoxide dismutase 3 (SOD3) protein. It is a method of producing protein.
  • HBD heparin binding domain
  • SOD3 extracellular superoxide dismutase 3
  • Solution 2 is a method for producing a recombinant SOD3 protein in Solution 1, which further includes the step of causing any one of the R213G, R213A, or R213L mutations.
  • Solution 3 is a method for producing recombinant SOD3 protein in Solution 1, which further includes the step of conjugating HSA (Human serum albumin).
  • HSA Human serum albumin
  • Solution 4 is a method for producing recombinant SOD3 protein in Solution 2, which further includes the step of conjugating HSA (Human serum albumin).
  • HSA Human serum albumin
  • Solution 5 is a method for producing a recombinant SOD3 protein in Solution 3, which further includes the step of causing any one of the R213G, R213A, or R213L mutations.
  • Solution 6 is a recombinant SOD3 protein produced by any one of solutions 1 to 5 above.
  • Solution 7 is recombinant SOD3, which includes the step of removing amino residues 219-229 of the heparin binding domain (HBD) of the extracellular superoxide dismutase 3 (SOD3) protein. It is a method of promoting protein expression.
  • HBD heparin binding domain
  • SOD3 extracellular superoxide dismutase 3
  • Solution 8 is recombinant SOD3, which includes the step of removing amino acid residues 219-229 of the heparin binding domain (HBD) of the extracellular superoxide dismutase 3 (SOD3) protein. It is a method of stabilizing proteins.
  • HBD heparin binding domain
  • SOD3 extracellular superoxide dismutase 3
  • HBD partial deletion is capable of producing SOD3 in a homogeneous tetramer form compared to SOD3-WT, and can also improve the expression rate by about two times and maintain enzyme activity.
  • R213A, R213G, and R213L mutants HBD deletion caused by existing proteolytic cleavage (Furin) can be suppressed.
  • HSA fusion HBD partial deletion (CKAA deletion) is capable of producing SOD3 in the form of a homogeneous tetramer when compared to HSA fusion SOD3-WT, and the expression rate can be improved by about 2 times, and the enzyme Activity can also be maintained well.
  • Figures 1 and 2 are graphs showing the results of the expression test of SOD3-CKAA deletion.
  • Figure 3 is a graph showing the results of the tetramer formation test of SOD3-CKAA deletion.
  • Figure 4 is a graph showing the results of the Proteolytic cleavage inhibition test of SOD3-CKAA deletion.
  • Figure 5 is a graph showing the enzyme activity test results of SOD3-CKAA deletion.
  • Figures 6 and 7 are graphs showing the expression test results of HSA-SOD3-CKAA deletion.
  • Figure 8 is a graph showing the results of the tetramer formation test of HSA-SOD3-CKAA deletion.
  • Figures 9 and 10 are graphs showing the enzyme activity test results of HSA-SOD3-CKAA deletion.
  • Partial HBD SOD3 which has "RKKRRRESE", a partial HBD with 219-222AA (CKAA) of the HBD (Heparin binding domain) removed, is formed.
  • RKKRRRESE a partial HBD with 219-222AA (CKAA) of HBD (Heparin binding domain) removed, is treated as R213 mutant to form "RKK G RRESE", resulting in partial HBD & point mutant SOD3.
  • RKKRRRESE a partial HBD with 219-222AA (CKAA) of HBD (Heparin binding domain) removed, is treated as R213 mutant to form partial HBD & point mutant SOD3, which is "RKK A RRESE” .
  • RKKRRRESE a partial HBD with 219-222AA (CKAA) of HBD (Heparin binding domain) removed, is treated as R213 mutant to form "RKK L RRESE", thereby forming partial HBD & point mutant SOD3.
  • Figures 1 and 2 are graphs showing the results of the expression test of SOD3-CKAA deletion.
  • Figure 1 is a SDS-PAGE analysis graph
  • Figure 2 is a protein expression yield analysis graph.
  • Figure 3 is a graph showing the results of the tetramer formation test of SOD3-CKAA deletion.
  • Figure 3 is a SE-HPLC analysis graph.
  • Figure 4 is a graph showing the results of the Proteolytic cleavage inhibition test of SOD3-CKAA deletion.
  • Figure 5 is a graph showing the enzyme activity test results of SOD3-CKAA deletion.
  • the activity of the SOD3-HBD deletion construct was reduced by about 70%, but the SOD3-CKAA deletion variants were confirmed to have similar activity to SOD3-WT .
  • SOD3 is known to maintain its function by forming a tetramer.
  • the HBD (Heparin binding domain) of SOD3 has the function of heparin binding and SOD3 interaction through a disulfide bridge.
  • HBD deletion construct and HBD partial deletion (CKAA deletion) constructs.
  • the HBD deletion construct was capable of producing SOD3 in the form of a homogeneous tetramer. However, it was confirmed that the expression rate and enzyme activity decreased.
  • HBD partial deletion (CKAA deletion) was able to produce SOD3 in the form of a homogeneous tetramer, and the expression rate was improved by about 2-fold, and enzyme activity was confirmed to be maintained.
  • R213A, R213G, and R213L mutants HBD deletion caused by existing proteolytic cleavage (Furin) could be suppressed.
  • HSA - partial HBD HSA - CKAA deletion
  • HSA Human serum albumin
  • HSA - partial HBD - point mutation HSA - CKAA deletion - R213G
  • HSA - partial HBD - point mutation HSA - CKAA deletion - R213A
  • HSA - partial HBD - point mutation HSA - CKAA deletion - R213L
  • Figures 6 and 7 are graphs showing the expression test results of HSA-SOD3-CKAA deletion.
  • Figure 6 is a SDS-PAGE analysis graph
  • Figure 7 is a protein expression yield analysis graph.
  • HSA-SOD3-WT Upon inspection, a high oligomerization pattern was confirmed in HSA-SOD3-WT. However, high oligomerization was not confirmed in HSA-SOD3-HBD_deletion (complete HBD removal) and HSA-partial deletion.
  • HSA-Partial deletion construction was confirmed to improve the expression rate by more than two times .
  • Figure 8 is a graph showing the results of the tetramer formation test of HSA-SOD3-CKAA deletion.
  • Figure 8 is a SE-HPLC analysis graph.
  • Figures 9 and 10 are graphs showing the enzyme activity test results of HSA-SOD3-CKAA deletion.
  • HSA-SOD3-HBD deletion construct was reduced by about 70%.
  • HSA-SOD3-CKAA deletion variants were confirmed to have similar activity to SOD3-WT.
  • HSA-SOD3-CKAA deletion variants were confirmed to have similar activity to HSA-SOD3-WT.
  • HSA Human serum albumin
  • CKAA deletion HSA fusion HBD partial deletion
  • the HSA fusion HBD deletion construct was capable of producing approximately 80% homogeneous tetramer form of SOD3. However, it was confirmed that the expression rate and enzyme activity were decreased.
  • HSA fusion HBD partial deletion (CKAA deletion) was able to produce SOD3 in the form of a homogeneous tetramer, and the expression rate was improved by about two times, and enzyme activity was also well maintained .
  • the method for producing recombinant SOD3 protein is 1 partial HBD (CKAA deletion) formation step: "RKKRRRESE” , a partial HBD with 219-222AA (CKAA) of HBD (Heparin binding domain) removed, has Step of forming partial HBD SOD3, 2 partial HBD - point mutation (CKAA deletion - R213G) formation step: Processing R213 mutant in "RKKRRRESE", a partial HBD with 219-222AA (CKAA) of HBD (Heparin binding domain) removed .
  • the method for producing recombinant SOD3 protein includes the following steps: 1 HSA - partial HBD (HSA - CKAA deletion) formation step, 2 HSA - partial HBD - point mutation (HSA - CKAA deletion - R213G) formation step, Optionally includes 3 HSA - partial HBD - point mutation (HSA - CKAA deletion - R213A) formation step, and 4 HSA - partial HBD - point mutation (HSA - CKAA deletion - R213L) formation step.
  • Example 5 Method for stabilizing recombinant SOD3 protein
  • Example 6 SOD3 protein produced according to the method of Examples 3, 4, and 5
  • Example 6 is the SOD3 protein produced according to the production method of Example 3 above.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biotechnology (AREA)
  • Biophysics (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Plant Pathology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Toxicology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

본 발명은 재조합 SOD3 단백질의 생산 방법에 관한 것이다. HBD partial deletion (CKAA deletion)은 SOD3-WT과 비교시, homogeneous tetramer 형태의 SOD3 생산이 가능하고, 또한 발현율은 약2배 향상시킬 수 있으며, enzyme activity를 유지시킨다. 또한, R213A, R213G, R213L mutants를 도입함으로써, 기존의 proteolytic cleavage (Furin)로 인한 HBD deletion도 억제할 수 있다. HSA fusion HBD partial deletion(CKAA deletion)은 HSA fusion SOD3-WT과 비교시, Homogeneous tetramer 형태의 SOD3 생산이 가능하고, 또한 발현율은 약 2배 향상시킬 수 있으며, Enzyme activity도 잘 유지시킬 수 있다.

Description

재조합 SOD3 단백질의 생산 방법
본 발명은 재조합 SOD3 단백질의 생산 방법에 관한 것이다.
사람의 슈퍼옥사이드 디스뮤타제(superoxide dismutase ; SOD)는 3가지 유형이 있다. 사람의 SOD1은 세포의 세포질에 이량체(dimer) 형태로 구리 및 아연이 함유되어 기능을 발현하며 구리/아연 에스오디(Cu/Zn SOD)라 불리우고 SOD1 유전자 다형성 중에서 그 어떤 돌연변이체는 근위축성측삭경화증 (amyotrophic lateral sclerosis ; ALS)과 관련되어 있다. 그리고 세포의 미토콘드리아에 존재하는 SOD2는 망간 에스오디(Mn SOD)라 불리면서 사량체(tetramer) 형태로 망간이 함유되는 특성을 가지고 있다. SOD3은 세포 바깥족(extra cellular)에서 사량체(tetramer) 형태로 구리와 아연이 함유되어 사람의 여러신체 부위에서 항산화 역할을 한다.
SOD3(Extracellular superoxide dismutase 3) 단백질은 tetramer로 구성되어 활성을 띄는 것으로 보고가 되어있다. 하지만 해당 단백질은 non-specific interaction 및 disulfide bond로 인하여 High oligomerization이 유도되고, 또한 SOD3의 C-말단의 proteolytic cleavage로 인하여 heterogeneous SOD3가 유도되는 문제점을 가지고 있다.
SOD3의 독립 발현 시, 낮은 발현율로 인해 의약품 개발에 한계를 갖는다. 이에, K41N mutant는 glycosylation을 유도하여 SOD3의 발현율 향상을 유도하는 등 발현율을 향상하기 위한 다양한 연구가 보고되어 있다. 또한 SOD3는 half-life가 짧아 의약품으로써의 개발에 한계가 있고, 이에 HSA를 fusion하여 해결하는 방법으로 연구가 진행되고 있다.
선행기술문헌을 살펴보면 다음과 같다.
1. 대한민국 등록특허공보 10-0676502 (2007.01.24 등록)
2. 대한민국 등록특허공보 10-1898198 (2018.09.06 등록)
3. 대한민국 등록특허공보 10-1966330 (2019.04.01 등록)
4. 대한민국 등록특허공보 10-1815317 (2017.12.28 등록)
5. 대한민국 등록특허공보 10-1774931 (2017.08.30 등록)
6. 대한민국 등록특허공보 10-2245312 (2021.04.21 등록)
7. 대한민국 공개특허공보 10-2021-0066005 (2021.06.04 공개)
8. 대한민국 등록특허공보 10-1749665 (2017.06.15 등록)
9. 대한민국 등록특허공보 10-1019470 (2011.02.25 등록)
10. 대한민국 등록특허공보 10-2223576 (2021.02.26 등록)
특허문헌 1 "EC SOD 및 세포 침투성 EC SOD와 이들의 용도"에는 EC SOD 단백질을 유효성분으로 포함하는 피부질환의 예방 또는 치료용 약학적 조성물이 기재되어 있다, (청구항 1) 또한, 인간 EC SOD에서 헤파린 도메인이 제거된 △HD/EC SOD 단백질과 HIV-1 Tat를 융합시킨 융합 단백질을 제조하여 실험에 이용하는 것이 기재되어 있다.(식별번호 [129]) 특허문헌 2 "세포외 분비 슈퍼옥사이드 디스뮤테이즈(EC-SOD) 단백질의 세포 투과성을 증가시키는 방법"에는 헤파린 결합 도메인을 포함하는 EC-SOD 단백질과 아연 2가 양이온을 세포에 접촉시키는 단계를 포함하는 EC-SOD 단백질의 세포 투과성을 증가시키는 방법이 기재되어 있다.(청구항 1) 특허문헌 3에는 "SOD3를 함유하는 건성안의 예방 또는 치료용 조성물"이 기재되어 있다. 살펴보면, C-말단 영역(아미노산 잔기 210번~215번)에 헤파린 결합 도메인(heparin binding domain)을 가지고 있는 SOD3 단백질을 대상으로 하고 있음을 알 수 있다.(식별번호 [0023])
특허문헌 4의 청구항 1에는 "HSA(human serum albumin)를 유효성분으로 포함하는 세포외 분비 슈퍼옥사이드 디스뮤테이즈(EC-SOD) 단백질 촉매활성 안정화용 조성물로서, 상기 조성물은 EC-SOD와 혼합되는 것을 특징으로 하는 조성물"이 기재되어 있다. 청구항 4에서는 청구항 1의 EC-SOD 가 인간 EC-SOD 유전자인 것을 기재하고 있다. 따라서 본 문헌에서는 HSA와 퓨젼되는 대상으로서의 EC-SOD가 인간 유전자이기 때문에 EC SOD의 헤파린 결합 도메인 변경이나 제거를 의도했다고 볼 수 없다.
특허문헌 5는 식물에서 발현이 최적화되도록 조정된 EC-SOD 유전자에 대한 것이다. 살펴보면, 서열번호 2는 표시되는 담배가 선호하는 코돈으로 변환된 SP와 HBD가 제거된 hEC-SOD의 염기서열이다.(식별번호 [0093]) 특허문헌 6의 청구항 1에는 SOD3를 과발현하는 중간엽 줄기세포가 기재되어 있다. 특허문헌 7의 청구항 1에는 슈퍼옥사이드 디스무타아제 3(superoxide dismutase 3, SOD3)를 과발현시킨 줄기세포 유래 세포외 소낭이 기재되어 있다. 특허문헌 8의 청구항 1에는 "BSA(bovine serum albumin) 및 FBS(fetal bovine serum)로 이루어진 군에서 선택되는 하나 이상을 유효성분으로 포함하는 세포외 분비 슈퍼옥사이드 디스뮤테이즈(EC-SOD) 단백질 안정화용 조성물로서, 상기 조성물은 EC-SOD와 혼합되는 것을 특징으로 하는 조성물."이 기재되어 있다.
특허문헌 9에는 헤파린 결합 도메인이 제거된 재조합 EC SOD(extracellular superoxide dismutase) 단백질을 유효성분으로 하는 혈관신생에 의한 질병의 예방 또는 치료용 조성물이 기재되어 있다.
특허문헌 10의 청구항 1에는 "세포외 분비 슈퍼옥사이드 디스뮤테이즈(EC-SOD) 단백질의 N-말단 또는 C-말단에 HSA(human serum albumin) 단백질을 접합시키는 단계를 포함하는 세포외 분비 슈퍼옥사이드 디스뮤테이즈(EC-SOD) 단백질의 안정화 방법"이 기재되어 있다. EC-SOD에 대한 기재를 살펴보면, 기본적으로 C-말단 영역(아미노산 잔기 210번~215번)에 헤파린 결합 도메인(heparin binding domain)을 가지고 있는 것으로 기재하고 있으며(식별번호 [0047]), 또한 청구항 3에 기재된 서열번호 9, 서열번호 22는 각각 서열번호 5의 19-240 fragment, 서열번호 7의 19-240 fragment이기 때문에 헤파린 결합 도메인을 포함하게 된다.(식별번호 [0048], 서열목록)
해결과제는, SOD3 단백질 생산시 발생되는 High oligomerization, proteolytic cleavage, 낮은 발현율을 해결하는 것이다.
해결수단 1은, 세포외 분비 슈퍼옥사이드 디스뮤테이즈(SOD3, Extracellular superoxide dismutase 3) 단백질의 헤파린 결합 도메인(HBD, Heparin binding domain) 중 219-229 아미노잔 잔기를 제거하는 단계를 포함하는, 재조합 SOD3 단백질의 생산 방법이다.
해결수단 2는, 상기 해결수단 1에서, R213G, R213A 또는 R213L 변이 중 어느 하나의 변이를 일으키는 단계를 추가로 포함하는 것을 특징으로 하는, 재조합 SOD3 단백질의 생산 방법이다.
해결수단 3은, 상기 해결수단 1에서, HSA(Human serum albumin)를 접합하는 단계를 추가로 포함하는 것을 특징으로 하는, 재조합 SOD3 단백질의 생산 방법이다.
해결수단 4는, 상기 해결수단 2에서, HSA(Human serum albumin)를 접합하는 단계를 추가로 포함하는 것을 특징으로 하는, 재조합 SOD3 단백질의 생산 방법이다.
해결수단 5는, 상기 해결수단 3에서, R213G, R213A 또는 R213L 변이 중 어느 하나의 변이를 일으키는 단계를 추가로 포함하는 것을 특징으로 하는, 재조합 SOD3 단백질의 생산 방법이다.
해결수단 6은, 상기 해결수단 1 내지 5 중 어느 하나의 방법에 의하여 생산된 재조합 SOD3 단백질이다.
해결수단 7은, 세포외 분비 슈퍼옥사이드 디스뮤테이즈(SOD3, Extracellular superoxide dismutase 3) 단백질의 헤파린 결합 도메인(HBD, Heparin binding domain) 중 219-229 아미노잔 잔기를 제거하는 단계를 포함하는, 재조합 SOD3 단백질의 발현 촉진 방법이다.
해결수단 8은, 세포외 분비 슈퍼옥사이드 디스뮤테이즈(SOD3, Extracellular superoxide dismutase 3) 단백질의 헤파린 결합 도메인(HBD, Heparin binding domain) 중 219-229 아미노잔 잔기를 제거하는 단계를 포함하는, 재조합 SOD3 단백질의 안정화 방법이다.
본 발명의 효과는 다음과 같다 : HBD partial deletion (CKAA deletion)은 SOD3-WT과 비교시, homogeneous tetramer 형태의 SOD3 생산이 가능하고, 또한 발현율은 약2배 향상시킬 수 있으며, enzyme activity를 유지시킨다. 또한, R213A, R213G, R213L mutants를 도입함으로써, 기존의 proteolytic cleavage (Furin)로 인한 HBD deletion도 억제할 수 있다.
본 발명의 효과는 다음과 같다 : HSA fusion HBD partial deletion(CKAA deletion)은 HSA fusion SOD3-WT과 비교시, Homogeneous tetramer 형태의 SOD3 생산이 가능하고, 또한 발현율은 약 2배 향상시킬 수 있으며, Enzyme activity도 잘 유지시킬 수 있다.
도 1 및 2는 SOD3-CKAA deletion의 Expression test 결과를 나타내는 그래프이다. 도 3은 SOD3-CKAA deletion의 Tetramer formation test 결과를 나타내는 그래프이다. 도 4는 SOD3-CKAA deletion의 Proteolytic cleavage inhibition test 결과를 나타내는 그래프이다. 도 5는 SOD3-CKAA deletion의 Enzyme activity test 결과를 나타내는 그래프이다.
도 6 및 7은 HSA-SOD3-CKAA deletion의 Expression test 결과를 나타내는 그래프이다. 도 8은 HSA-SOD3-CKAA deletion의 Tetramer formation test 결과를 나타내는 그래프이다. 도 9 및 10은 HSA-SOD3-CKAA deletion의 Enzyme activity test 결과를 나타내는 그래프이다.
본 명세서 및 청구 범위에 사용된 용어나 단어는 통상적이거나 사전적인 의미로 한정해서 해석되어서는 안되며, 발명자는 그 자신의 발명을 가장 최선의 방법으로 설명하기 위해 용어의 개념을 적절하게 정의할 수 있다는 원칙에 입각하여 본 발명의 기술적 사상에 부합하는 의미와 개념으로 해석되어야만 한다.
따라서 본 명세서에 기재된 실험, 실시예 및 도면에 기술된 사항은 본 발명의 가장 바람직한 일 예에 불과할뿐이고 본 발명의 기술적 사상을 모두 대변하는 것은 아니므로, 본 출원시점에 있어서 이들을 대체할 수 있는 다양한 균등물과 변형예들이 있을 수 있음을 이해하여야 한다.
실시예 1. SOD3-CKAA deletion Construction and Test
1) SOD3-CKAA deletion Construction
하기의 표 1을 보면, SOD3 서열정보가 표시되어 있다. SOD3의 C-말단 HBD(Heparin binding domain) "RKKRRRESECKAA" , 그 뒤의 Linker "GGGGS", 그 뒤의 Histag "HHHHHH"를 확인할 수 있다.
① partial HBD : CKAA deletion
; HBD(Heparin binding domain)의 219-222AA(CKAA) 제거된 partial HBD인 "RKKRRRESE"가 갖는 partial HBD SOD3가 형성된다.
② partial HBD - point mutation : CKAA deletion - R213G
; HBD(Heparin binding domain)의 219-222AA(CKAA) 제거된 partial HBD인 "RKKRRRESE"에서 R213 mutant 처리하여 "RKK G RRESE"가 형성된 partial HBD & point mutation SOD3가 형성된다.
③ partial HBD - point mutation : CKAA deletion - R213A
; HBD(Heparin binding domain)의 219-222AA(CKAA) 제거된 partial HBD인 "RKKRRRESE"에서 R213 mutant 처리하여 "RKK A RRESE"가 형성된 partial HBD & point mutation SOD3가 형성된다.
④ partial HBD - point mutation : CKAA deletion - R213L
; HBD(Heparin binding domain)의 219-222AA(CKAA) 제거된 partial HBD인 "RKKRRRESE"에서 R213 mutant 처리하여 "RKK L RRESE"가 형성된 partial HBD & point mutation SOD3가 형성된다.
구분 서열정보
SOD3 WTGEDSAEPNSDSAEWIRDMYANVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVCRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAREHSERKKRRRESECKAAGGGGSHHHHHH
SOD3-CKAA deletion-WT WTGEDSAEPNSDSAEWIRDMYANVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRANLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVCRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAREHSERKKRRRESEGGGGSHHHHHH
SOD3-CKAA deletion
-R213G		 WTGEDSAEPNSDSAEWIRDMYANVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRANLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVCRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAREHSERKKGRRESEGGGGSHHHHHH
SOD3-CKAA deletion
-R213A		 WTGEDSAEPNSDSAEWIRDMYANVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRANLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVCRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAREHSERKKARRESEGGGGSHHHHHH
SOD3-CKAA deletion
-R213L		 WTGEDSAEPNSDSAEWIRDMYANVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRANLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVCRAVVVHAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAREHSERKKLRRESEGGGGSHHHHHH
2) SOD3-CKAA deletion Test
① Expression test
도 1 및 2는 SOD3-CKAA deletion의 Expression test 결과를 나타내는 그래프이다. 도 1은 SDS-PAGE 분석 그래프이고, 도 2는 단백질 발현 수율 분석 그래프이다.
살펴보면, SOD3-WT 에서는 high oligomerization 패턴이 확인되었다. 그러나 SOD3-HBD_deletion(HBD 완전 제거) 및 partial deletion에서는 High oligomerization이 확인되지 않았다. 또한 Partial deletion construction은 약 2배 이상 발현율이 향상되는 것을 확인하였다.
② Tetramer formation test
도 3은 SOD3-CKAA deletion의 Tetramer formation test 결과를 나타내는 그래프이다. 도 3은 SE-HPLC 분석 그래프이다.
살펴보면, SOD3-WT에서는 high oligomerization 패턴이 확인되었으나, SOD3-HBD_deletion 및 partial deletion에서는 High oligomerization 확인되지 않고, homogenous tetramer가 형성되는 것을 확인하였다.
③ Proteolytic cleavage inhibition test
도 4는 SOD3-CKAA deletion의 Proteolytic cleavage inhibition test 결과를 나타내는 그래프이다.
SOD3의 HBD는 Furin 에 의해 proteolytic cleavage 가 일어난다. 이에 따라 재조합 SOD3 생산 시, heterogeneous SOD3가 생산된다. R213G는 Furin cleavage를 저해하는 mutant로 보고가 되었다. (비특허 1 참조)
살펴보면, In silico library를 통해 도입한 R213L, R213A도 Furin cleavage가 일어나지 않음을 확인하였다.
④ Enzyme activity test
도 5는 SOD3-CKAA deletion의 Enzyme activity test 결과를 나타내는 그래프이다.
살펴보면, SOD3-HBD deletion construct 는 활성이 약 70% 감소되었으나, SOD3-CKAA deletion variants 는 SOD3-WT과 유사 활성 갖는 것을 확인하였다.
3) 평가 분석 고찰
SOD3는 tetramer를 형성함으로써, 기능을 유지하는 것으로 알려져 있다. SOD3의 HBD (Heparin binding domain)는 heparin binding과 disulfide bridge를 통한 SOD3 interaction의 기능을 갖는다.
그러나 재조합 SOD3를 생산함에 있어, HBD는 disulfide bridge로 인한 high oligomerization을 유도 하여 heterogeneous protein이 생산된다. 또한, proteolytic cleavage (Furin)로 인한 HBD deletion으로 heterogeneous protein이 생산된다. 해당 문제를 해결하기 위해, HBD deletion construct와 HBD partial deletion (CKAA deletion) constructs를 디자인하였다.
HBD deletion construct 은 SOD3-WT 과 비교시, homogeneous tetramer 형태의 SOD3 생산이 가능하였다. 그러나 발현율 및 enzyme activity가 감소함을 확인하였다.
HBD partial deletion (CKAA deletion)은 SOD3-WT과 비교시, homogeneous tetramer 형태의 SOD3 생산이 가능하였고, 또한 발현율은 약2배 향상되었으며, enzyme activity는 유지되는 것을 확인하였다. 또한 R213A, R213G와 R213L mutants를 도입함으로써, 기존의 proteolytic cleavage (Furin)로 인한 HBD deletion도 억제할 수 있었다.
실시예 2. HSA-SOD3-CKAA deletion Construction and Test
1) HSA-SOD3-CKAA deletion Construction
① HSA - partial HBD : HSA - CKAA deletion
; HSA(Human serum albumin)
"ASDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLGGGGSAS", HBD(Heparin binding domain)의 219-222AA(CKAA) 제거된 partial HBD인 "RKKRRRESE" 를 갖는 SOD3, Linker "GGGGS", Histag "HHHHHH"를 확인할 수 있다.
② HSA - partial HBD - point mutation : HSA - CKAA deletion - R213G
③ HSA - partial HBD - point mutation : HSA - CKAA deletion - R213A
④ HSA - partial HBD - point mutation : HSA - CKAA deletion - R213L
구분 서열정보
HSA-
SOD3-CKAA
deletion-WT		 ASDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLGGGGSASWTGEDSAEPNSDSAEWIRDMYANVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRANLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVCRAVVVHAGEDDLGRGGNQASVENG NAGRRLACCVVGVCGPGLWERQAREHSERKKRRRESEGGGGSHHHHHH
HSA-
SOD3-CKAA deletion
-R213G		 ASDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLGGGGSASWTGEDSAEPNSDSAEWIRDMYANVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRANLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVCRAVVVHAGEDDLGRGGNQASVENG NAGRRLACCVVGVCGPGLWERQAREHSERKKGRRESEGGGGSHHHHHH
HSA-
SOD3-CKAA deletion
-R213A		 ASDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLGGGGSASWTGEDSAEPNSDSAEWIRDMYANVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRANLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVCRAVVVHAGEDDLGRGGNQASVENG NAGRRLACCVVGVCGPGLWERQAREHSERKKARRESEGGGGSHHHHHH
HSA-
SOD3-CKAA deletion
-R213L		 ASDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLGGGGSASWTGEDSAEPNSDSAEWIRDMYANVTEIWQEVMQRRDDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLAPRANLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVCRAVVVHAGEDDLGRGGNQASVENG NAGRRLACCVVGVCGPGLWERQAREHSERKKLRRESEGGGGSHHHHHH
2) HSA-SOD3-CKAA deletion Test
① Expression test
도 6 및 7은 HSA-SOD3-CKAA deletion의 Expression test 결과를 나타내는 그래프이다. 도 6은 SDS-PAGE 분석 그래프이고, 도 7은 단백질 발현 수율 분석 그래프이다.
살펴보면, HSA-SOD3-WT 에서는 high oligomerization 패턴이 확인되었다. 그러나 HSA-SOD3-HBD_deletion(HBD 완전 제거) 및 HSA-partial deletion에서는 High oligomerization이 확인되지 않았다.
또한 HSA-Partial deletion construction은 약 2배 이상 발현율이 향상되는 것을 확인하였다.
② Tetramer formation test
도 8은 HSA-SOD3-CKAA deletion의 Tetramer formation test 결과를 나타내는 그래프이다. 도 8은 SE-HPLC 분석 그래프이다.
살펴보면, HSA-SOD3-WT에서는 high oligomerization 패턴이 확인되었으나, HSA- SOD3-HBD_deletion 및 HSA-partial deletion에서는 High oligomerization이 확인되지 않고, homogenous tetramer가 형성되는 것을 확인하였다.
③ Enzyme activity test
도 9 및 도 10은 HSA-SOD3-CKAA deletion의 Enzyme activity test 결과를 나타내는 그래프이다.
살펴보면, HBD deletion constructs는 활성이 약 70% 감소되는 것을 확인하였다. 그러나 SOD3-CKAA-deletion와 HSA-SOD3-CKAA-deletion construct는 SOD3-WT 과 유사활성을 갖는 것을 확인하였다.
또한 HSA-SOD3-HBD deletion construct는 활성이 약 70% 감소되는 것을 확인하였다. 그러나 HSA-SOD3-CKAA deletion variants는 SOD3-WT과 유사 활성을 갖는 것을 확인하였다. 또한 HSA-SOD3-CKAA deletion variants는 HSA-SOD3-WT과 유사 활성 갖는 것을 확인하였다.
3) 평가 분석 고찰
의약품 개발을 목적으로, 안정성 및 Half-life 증가를 위해 HSA(Human serum albumin) fusion HBD deletion construct와 HSA fusion HBD partial deletion(CKAA deletion) Construct를 디자인하였다.
HSA fusion HBD deletion construct은 HSA fusion SOD3-WT 과 비교시, 약 80% Homogeneous tetramer 형태의 SOD3 생산이 가능하였다. 하지만, 발현율 및 Enzyme activity가 감소되는 것을 확인하였다.
그러나 HSA fusion HBD partial deletion(CKAA deletion)은 HSA fusion SOD3-WT과 비교시, Homogeneous tetramer 형태의 SOD3 생산이 가능하였고, 또한 발현율은 약 2배 향상되었 으며, Enzyme activity도 잘 유지되는 것을 확인 하였다.
실시예 3. 재조합 SOD3 단백질의 생산 방법
1) 상기 실시예 1에 따라, 재조합 SOD3 단백질의 생산 방법은, ① partial HBD(CKAA deletion) 형성단계 : HBD(Heparin binding domain)의 219-222AA(CKAA) 제거된 partial HBD인 "RKKRRRESE"가 갖는 partial HBD SOD3를 형성하는 단계, ② partial HBD - point mutation(CKAA deletion - R213G) 형성단계 : HBD(Heparin binding domain)의 219-222AA(CKAA) 제거된 partial HBD인 "RKKRRRESE"에서 R213 mutant 처리하여 "RKK G RRESE"가 형성된 partial HBD & point mutation SOD3를 형성하는 단계, ③ partial HBD - point mutation(CKAA deletion - R213A) : HBD(Heparin binding domain)의 219-222AA(CKAA) 제거된 partial HBD인 "RKKRRRESE"에서 R213 mutant 처리하여 "RKK A RRESE"가 형성된 partial HBD & point mutation SOD3를 형성하는 단계, ④ partial HBD - point mutation(CKAA deletion - R213L) : HBD(Heparin binding domain)의 219-222AA(CKAA) 제거된 partial HBD인 "RKKRRRESE"에서 R213 mutant 처리하여 "RKK L RRESE"가 형성된 partial HBD & point mutation SOD3를 형성하는 단계를 선택적으로 포함한다.
2) 상기 실시예 2에 따라, 재조합 SOD3 단백질의 생산 방법은, ① HSA - partial HBD(HSA - CKAA deletion) 형성 단계, ② HSA - partial HBD - point mutation(HSA - CKAA deletion - R213G) 형성 단계, ③ HSA - partial HBD - point mutation(HSA - CKAA deletion - R213A) 형성 단계, ④ HSA - partial HBD - point mutation(HSA - CKAA deletion - R213L) 형성 단계를 선택적으로 포함한다.
실시예 4. 재조합 SOD3 단백질의 발현 촉진 방법
상기 실시예 1, 2, 3에 근거한다.
실시예 5. 재조합 SOD3 단백질의 안정화 방법
상기 실시예 1, 2, 3에 근거한다.
실시예 6. 실시예 3, 4, 5의 방법에 따라 생산된 SOD3 단백질
실시예 6는 상기 실시예 3의 생산 방법에 따라 생산된 SOD3 단백질이다.

Claims (8)

  1. 세포외 분비 슈퍼옥사이드 디스뮤테이즈(SOD3, Extracellular superoxide dismutase 3) 단백질의 헤파린 결합 도메인(HBD, Heparin binding domain) 중 219-229 아미노잔 잔기를 제거하는 단계를 포함하는, 재조합 SOD3 단백질의 생산 방법.
  2. 청구항 1에 있어서,
    R213G, R213A 또는 R213L 변이 중 어느 하나의 변이를 일으키는 단계를 추가로 포함하는 것을 특징으로 하는, 재조합 SOD3 단백질의 생산 방법.
  3. 청구항 1에 있어서,
    HSA(Human serum albumin)를 접합하는 단계를 추가로 포함하는 것을 특징으로 하는, 재조합 SOD3 단백질의 생산 방법.
  4. 청구항 2에 있어서,
    HSA(Human serum albumin)를 접합하는 단계를 추가로 포함하는 것을 특징으로 하는, 재조합 SOD3 단백질의 생산 방법.
  5. 청구항 3에 있어서,
    R213G, R213A 또는 R213L 변이 중 어느 하나의 변이를 일으키는 단계를 추가로 포함하는 것을 특징으로 하는, 재조합 SOD3 단백질의 생산 방법.
  6. 청구항 1 내지 5 중 어느 하나의 방법에 의하여 생산된 재조합 SOD3 단백질.
  7. 세포외 분비 슈퍼옥사이드 디스뮤테이즈(SOD3, Extracellular superoxide dismutase 3) 단백질의 헤파린 결합 도메인(HBD, Heparin binding domain) 중 219-229 아미노잔 잔기를 제거하는 단계를 포함하는, 재조합 SOD3 단백질의 발현 촉진 방법.
  8. 세포외 분비 슈퍼옥사이드 디스뮤테이즈(SOD3, Extracellular superoxide dismutase 3) 단백질의 헤파린 결합 도메인(HBD, Heparin binding domain) 중 219-229 아미노잔 잔기를 제거하는 단계를 포함하는, 재조합 SOD3 단백질의 안정화 방법.
PCT/KR2023/017177 2022-10-31 2023-10-31 재조합 sod3 단백질의 생산 방법 WO2024096540A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020220142109A KR20240060975A (ko) 2022-10-31 2022-10-31 재조합 sod3 단백질의 생산 방법
KR10-2022-0142109 2022-10-31

Publications (1)

Publication Number Publication Date
WO2024096540A1 true WO2024096540A1 (ko) 2024-05-10

Family

ID=90931047

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/017177 WO2024096540A1 (ko) 2022-10-31 2023-10-31 재조합 sod3 단백질의 생산 방법

Country Status (2)

Country Link
KR (1) KR20240060975A (ko)
WO (1) WO2024096540A1 (ko)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7740839B2 (en) * 2003-10-31 2010-06-22 Tae-Yoon Kim EC SOD and cell transducing EC SOD and use thereof
WO2016164787A2 (en) * 2015-04-08 2016-10-13 Microvascular Health Solutions, LLC Synergistic glycocalyx treatment compositions and methods
KR101898198B1 (ko) * 2016-09-01 2018-09-12 가톨릭대학교 산학협력단 세포외 분비 슈퍼옥사이드 디스뮤테이즈(ec-sod) 단백질의 세포 투과성을 증가시키는 방법
KR102223576B1 (ko) * 2017-09-22 2021-03-05 가톨릭대학교 산학협력단 N 말단 또는 c 말단의 알부민 접합을 이용한 세포외 분비 슈퍼옥사이드 디스뮤테이즈(ec-sod) 단백질의 안정화 방법

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101019470B1 (ko) 2007-03-22 2011-03-07 신동헌 Ｅｃ ｓｏｄ 단백질을 유효성분으로 하는 혈관신생에 의한질병의 예방 또는 치료용 조성물
KR101749665B1 (ko) 2014-10-21 2017-06-21 가톨릭대학교 산학협력단 세포외 분비 슈퍼옥사이드 디스뮤테이즈(ec-sod) 단백질 안정화용 조성물 및 이를 이용한 ec-sod 안정화 방법
KR101815317B1 (ko) 2015-05-26 2018-01-30 가톨릭대학교 산학협력단 세포외 분비 슈퍼옥사이드 디스뮤테이즈(ec-sod) 단백질 안정화용 조성물 및 이를 이용한 ec-sod 안정화 방법
US11730766B2 (en) 2015-09-15 2023-08-22 Kangstem Biotech Co., Ltd. Composition for preventing or treating inflammatory diseases, containing, as active ingredient, stem cells overexpressing SOD3
KR101774931B1 (ko) 2015-10-14 2017-09-05 가톨릭대학교 산학협력단 식물에서의 발현이 최적화된 재조합 ec-sod 유전자와 이를 이용한 재조합 ec-sod 단백질의 대량 생산 방법
KR101966330B1 (ko) 2017-05-18 2019-04-05 가톨릭대학교 산학협력단 Sod3를 함유하는 건성안의 예방 또는 치료용 조성물
KR20210066005A (ko) 2018-10-25 2021-06-04 가톨릭대학교 산학협력단 Sod3를 과발현시킨 줄기세포 유래 세포외 소낭의 신규한 용도

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7740839B2 (en) * 2003-10-31 2010-06-22 Tae-Yoon Kim EC SOD and cell transducing EC SOD and use thereof
WO2016164787A2 (en) * 2015-04-08 2016-10-13 Microvascular Health Solutions, LLC Synergistic glycocalyx treatment compositions and methods
KR101898198B1 (ko) * 2016-09-01 2018-09-12 가톨릭대학교 산학협력단 세포외 분비 슈퍼옥사이드 디스뮤테이즈(ec-sod) 단백질의 세포 투과성을 증가시키는 방법
KR102223576B1 (ko) * 2017-09-22 2021-03-05 가톨릭대학교 산학협력단 N 말단 또는 c 말단의 알부민 접합을 이용한 세포외 분비 슈퍼옥사이드 디스뮤테이즈(ec-sod) 단백질의 안정화 방법

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
SUNGHWAN KIM: "Enhancement of potency and stability of human extracellular superoxide dismutase", BMB REPORTS, KOREAN SOCIETY FOR BIOCHEMISTRY AND MOLECULAR BIOLOGY, KR, vol. 48, no. 2, 28 February 2015 (2015-02-28), KR , pages 91 - 96, XP093167978, ISSN: 1976-6696, DOI: 10.5483/BMBRep.2015.48.2.093 *

Also Published As

Publication number Publication date
KR20240060975A (ko) 2024-05-08

Similar Documents

Publication Publication Date Title
ES2139591T3 (es) Asialoglicoproteinas del virus de la hepatitis c.
WO2011152694A2 (en) Fusion protein having factor vii activity
WO2018194413A1 (en) Method for producing dual function proteins and its derivatives
WO2024096540A1 (ko) 재조합 sod3 단백질의 생산 방법
WO2012050402A2 (ko) 세포투과성 parkin 재조합 단백질 및 이를 함유하는 퇴행성 뇌질환 치료용 약학적 조성물
Erlanson et al. The primary structure of porcine colipase II. II. The disulfide bridges
Pinna et al. Structural features determining the site specificity of a rat liver cAMP-independent protein kinase
WO2016175565A1 (en) Medium composition for preparing botulinum toxin
WO2018151560A1 (ko) 항주름 효능을 가지는 저분자 말태반 효소가수분해물의 제조방법
WO2023055007A1 (ko) 항노화 활성을 갖는 펩타이드 및 이의 용도
WO2013042868A1 (en) Method of obtaining silkworm gland-derived hydrolysate
WO2019004674A1 (ko) 아세틸콜린수용체 결합 펩타이드
WO2023054817A1 (ko) 항노화 활성을 갖는 펩타이드 및 이의 용도
WO2021125866A1 (ko) 보툴리눔 신경 독소의 안전한 제조 방법
WO2022124494A1 (ko) 자궁내막 비후용 약학적 조성물
WO2017105094A1 (ko) 재조합 배트록소빈 혼합 조성물 및 이를 포함하는 지혈 분말 또는 지혈 패드
WO2024101624A1 (ko) 보툴리눔 독소의 정제방법
WO2021029740A2 (ko) 보툴리눔 독소의 제조방법
WO2016208942A1 (ko) Tlr5 아고니스트 단백질의 생산방법
WO2022015106A1 (ko) 종양괴사인자-자극된 유전자 6을 발현하는 중간엽 줄기세포를 포함하는 골관절염의 예방 또는 치료용 조성물
WO2023277433A1 (ko) 재조합 보툴리눔 독소 타입 a 경쇄, 재조합 보툴리눔 독소 및 이의 조성물, 용도 및 방법
WO2023277432A1 (ko) 재조합 보툴리눔 독소 타입 a 경쇄, 재조합 보툴리눔 독소 및 이의 조성물, 용도 및 방법
WO2016175567A1 (en) Medium composition for preparing botulinum toxin
WO2023214627A1 (ko) 신규한 e3 리가아제 리간드 및 이의 용도
WO2020071652A1 (ko) 세포의 텔로미어를 신장시키는 방법

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23886236

Country of ref document: EP

Kind code of ref document: A1