WO2023014062A1 - Hapln1을 포함하는 섬유성 질환의 예방 또는 치료용 조성물 - Google Patents
Hapln1을 포함하는 섬유성 질환의 예방 또는 치료용 조성물 Download PDFInfo
- Publication number
- WO2023014062A1 WO2023014062A1 PCT/KR2022/011419 KR2022011419W WO2023014062A1 WO 2023014062 A1 WO2023014062 A1 WO 2023014062A1 KR 2022011419 W KR2022011419 W KR 2022011419W WO 2023014062 A1 WO2023014062 A1 WO 2023014062A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition
- present
- fibrosis
- cells
- rhhapln1
- Prior art date
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 268
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 title claims abstract description 76
- 201000010099 disease Diseases 0.000 title claims abstract description 61
- 230000003176 fibrotic effect Effects 0.000 title claims abstract description 36
- 230000003405 preventing effect Effects 0.000 title claims abstract description 32
- 206010016654 Fibrosis Diseases 0.000 claims abstract description 91
- 230000004761 fibrosis Effects 0.000 claims abstract description 91
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 73
- 102100028084 Hyaluronan and proteoglycan link protein 1 Human genes 0.000 claims abstract description 41
- 101710191341 Hyaluronan and proteoglycan link protein 1 Proteins 0.000 claims abstract description 41
- 238000000034 method Methods 0.000 claims abstract description 38
- 239000004480 active ingredient Substances 0.000 claims abstract description 17
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 15
- 210000004027 cell Anatomy 0.000 claims description 99
- 102000004169 proteins and genes Human genes 0.000 claims description 56
- 238000011282 treatment Methods 0.000 claims description 49
- 210000004072 lung Anatomy 0.000 claims description 36
- 210000002950 fibroblast Anatomy 0.000 claims description 33
- 210000003734 kidney Anatomy 0.000 claims description 30
- 230000002401 inhibitory effect Effects 0.000 claims description 13
- 210000004024 hepatic stellate cell Anatomy 0.000 claims description 10
- 238000001727 in vivo Methods 0.000 claims description 10
- 210000004925 microvascular endothelial cell Anatomy 0.000 claims description 9
- 230000000747 cardiac effect Effects 0.000 claims description 8
- 210000004926 tubular epithelial cell Anatomy 0.000 claims description 7
- 239000013604 expression vector Substances 0.000 claims description 6
- 239000003153 chemical reaction reagent Substances 0.000 claims description 5
- 230000003902 lesion Effects 0.000 claims description 4
- 210000004185 liver Anatomy 0.000 claims description 4
- 210000001626 skin fibroblast Anatomy 0.000 claims description 4
- 230000000112 colonic effect Effects 0.000 claims description 3
- 210000002216 heart Anatomy 0.000 claims description 3
- 210000000936 intestine Anatomy 0.000 claims description 3
- 108020004707 nucleic acids Proteins 0.000 claims description 3
- 102000039446 nucleic acids Human genes 0.000 claims description 3
- 150000007523 nucleic acids Chemical class 0.000 claims description 3
- 210000003491 skin Anatomy 0.000 claims description 3
- 230000000302 ischemic effect Effects 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 230000003510 anti-fibrotic effect Effects 0.000 description 85
- 229960003073 pirfenidone Drugs 0.000 description 78
- ISWRGOKTTBVCFA-UHFFFAOYSA-N pirfenidone Chemical compound C1=C(C)C=CC(=O)N1C1=CC=CC=C1 ISWRGOKTTBVCFA-UHFFFAOYSA-N 0.000 description 74
- 230000014509 gene expression Effects 0.000 description 62
- 208000005069 pulmonary fibrosis Diseases 0.000 description 38
- 210000001519 tissue Anatomy 0.000 description 38
- 235000019624 protein content Nutrition 0.000 description 37
- 238000001262 western blot Methods 0.000 description 37
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 35
- 239000002953 phosphate buffered saline Substances 0.000 description 35
- 238000002474 experimental method Methods 0.000 description 31
- 108010006654 Bleomycin Proteins 0.000 description 29
- DDRJAANPRJIHGJ-UHFFFAOYSA-N creatinine Chemical compound CN1CC(=O)NC1=N DDRJAANPRJIHGJ-UHFFFAOYSA-N 0.000 description 28
- 229960001561 bleomycin Drugs 0.000 description 27
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 27
- 210000000651 myofibroblast Anatomy 0.000 description 26
- 102000008186 Collagen Human genes 0.000 description 21
- 108010035532 Collagen Proteins 0.000 description 21
- 229920001436 collagen Polymers 0.000 description 21
- 238000011156 evaluation Methods 0.000 description 21
- 230000000694 effects Effects 0.000 description 18
- 208000036971 interstitial lung disease 2 Diseases 0.000 description 18
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 17
- 239000003981 vehicle Substances 0.000 description 17
- 239000003814 drug Substances 0.000 description 16
- 210000002919 epithelial cell Anatomy 0.000 description 16
- 201000002793 renal fibrosis Diseases 0.000 description 16
- 230000002829 reductive effect Effects 0.000 description 15
- 241001465754 Metazoa Species 0.000 description 14
- 241000699666 Mus <mouse, genus> Species 0.000 description 14
- 229940109239 creatinine Drugs 0.000 description 14
- 230000001965 increasing effect Effects 0.000 description 14
- 229940079593 drug Drugs 0.000 description 13
- 239000000243 solution Substances 0.000 description 13
- 230000001225 therapeutic effect Effects 0.000 description 13
- 238000005406 washing Methods 0.000 description 13
- 241000699670 Mus sp. Species 0.000 description 12
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 12
- 208000028867 ischemia Diseases 0.000 description 12
- 108700041430 link Proteins 0.000 description 12
- 239000002609 medium Substances 0.000 description 12
- 238000002360 preparation method Methods 0.000 description 12
- 230000003449 preventive effect Effects 0.000 description 12
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 11
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 11
- 210000004369 blood Anatomy 0.000 description 11
- 239000008280 blood Substances 0.000 description 11
- 239000000872 buffer Substances 0.000 description 11
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 11
- 102000012422 Collagen Type I Human genes 0.000 description 10
- 108010022452 Collagen Type I Proteins 0.000 description 10
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 10
- 238000010171 animal model Methods 0.000 description 10
- 230000008859 change Effects 0.000 description 10
- 230000032683 aging Effects 0.000 description 9
- 150000001875 compounds Chemical class 0.000 description 9
- 238000010186 staining Methods 0.000 description 9
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 8
- 101100451392 Homo sapiens HAPLN1 gene Proteins 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- 208000035475 disorder Diseases 0.000 description 8
- 239000003550 marker Substances 0.000 description 8
- 206010061218 Inflammation Diseases 0.000 description 7
- 229920002674 hyaluronan Polymers 0.000 description 7
- 230000001939 inductive effect Effects 0.000 description 7
- 230000004054 inflammatory process Effects 0.000 description 7
- 230000001603 reducing effect Effects 0.000 description 7
- 230000010410 reperfusion Effects 0.000 description 7
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- 210000001072 colon Anatomy 0.000 description 6
- 230000007423 decrease Effects 0.000 description 6
- KIUKXJAPPMFGSW-MNSSHETKSA-N hyaluronan Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)C1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H](C(O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-MNSSHETKSA-N 0.000 description 6
- 229940099552 hyaluronan Drugs 0.000 description 6
- 230000006698 induction Effects 0.000 description 6
- 239000007928 intraperitoneal injection Substances 0.000 description 6
- 206010002091 Anaesthesia Diseases 0.000 description 5
- 230000037005 anaesthesia Effects 0.000 description 5
- 230000037396 body weight Effects 0.000 description 5
- 230000006378 damage Effects 0.000 description 5
- 230000002500 effect on skin Effects 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 238000010253 intravenous injection Methods 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 239000006199 nebulizer Substances 0.000 description 5
- 230000008569 process Effects 0.000 description 5
- 238000010814 radioimmunoprecipitation assay Methods 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- 239000002904 solvent Substances 0.000 description 5
- 210000002700 urine Anatomy 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 208000009304 Acute Kidney Injury Diseases 0.000 description 4
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 4
- 239000006180 TBST buffer Substances 0.000 description 4
- 239000000443 aerosol Substances 0.000 description 4
- 150000001413 amino acids Chemical group 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- AFYNADDZULBEJA-UHFFFAOYSA-N bicinchoninic acid Chemical compound C1=CC=CC2=NC(C=3C=C(C4=CC=CC=C4N=3)C(=O)O)=CC(C(O)=O)=C21 AFYNADDZULBEJA-UHFFFAOYSA-N 0.000 description 4
- CVSVTCORWBXHQV-UHFFFAOYSA-N creatine Chemical compound NC(=[NH2+])N(C)CC([O-])=O CVSVTCORWBXHQV-UHFFFAOYSA-N 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- 210000002889 endothelial cell Anatomy 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 235000011187 glycerol Nutrition 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 238000001990 intravenous administration Methods 0.000 description 4
- 210000000512 proximal kidney tubule Anatomy 0.000 description 4
- 239000011550 stock solution Substances 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 230000017423 tissue regeneration Effects 0.000 description 4
- 239000012096 transfection reagent Substances 0.000 description 4
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 3
- HRPVXLWXLXDGHG-UHFFFAOYSA-N Acrylamide Chemical compound NC(=O)C=C HRPVXLWXLXDGHG-UHFFFAOYSA-N 0.000 description 3
- 102000007469 Actins Human genes 0.000 description 3
- 108010085238 Actins Proteins 0.000 description 3
- 238000012935 Averaging Methods 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 238000011814 C57BL/6N mouse Methods 0.000 description 3
- 239000006145 Eagle's minimal essential medium Substances 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 101710088172 HTH-type transcriptional regulator RipA Proteins 0.000 description 3
- 208000029523 Interstitial Lung disease Diseases 0.000 description 3
- 206010072877 Intestinal fibrosis Diseases 0.000 description 3
- 208000009857 Microaneurysm Diseases 0.000 description 3
- 101100239698 Mus musculus Myof gene Proteins 0.000 description 3
- 108010067787 Proteoglycans Proteins 0.000 description 3
- 102000016611 Proteoglycans Human genes 0.000 description 3
- 239000012980 RPMI-1640 medium Substances 0.000 description 3
- 206010050207 Skin fibrosis Diseases 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 3
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 3
- 101100239699 Xenopus tropicalis myof gene Proteins 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 239000011230 binding agent Substances 0.000 description 3
- 238000009395 breeding Methods 0.000 description 3
- 230000001488 breeding effect Effects 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 230000009787 cardiac fibrosis Effects 0.000 description 3
- 239000008004 cell lysis buffer Substances 0.000 description 3
- 230000010094 cellular senescence Effects 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- -1 coatings Substances 0.000 description 3
- 230000009089 cytolysis Effects 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 239000002612 dispersion medium Substances 0.000 description 3
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 3
- 239000011536 extraction buffer Substances 0.000 description 3
- 239000012091 fetal bovine serum Substances 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 239000012139 lysis buffer Substances 0.000 description 3
- 238000013411 master cell bank Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- XZXHXSATPCNXJR-ZIADKAODSA-N nintedanib Chemical compound O=C1NC2=CC(C(=O)OC)=CC=C2\C1=C(C=1C=CC=CC=1)\NC(C=C1)=CC=C1N(C)C(=O)CN1CCN(C)CC1 XZXHXSATPCNXJR-ZIADKAODSA-N 0.000 description 3
- 239000002674 ointment Substances 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 231100000241 scar Toxicity 0.000 description 3
- 230000009758 senescence Effects 0.000 description 3
- 230000000391 smoking effect Effects 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 230000000472 traumatic effect Effects 0.000 description 3
- 210000005233 tubule cell Anatomy 0.000 description 3
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- WUIABRMSWOKTOF-OYALTWQYSA-N 3-[[2-[2-[2-[[(2s,3r)-2-[[(2s,3s,4r)-4-[[(2s,3r)-2-[[6-amino-2-[(1s)-3-amino-1-[[(2s)-2,3-diamino-3-oxopropyl]amino]-3-oxopropyl]-5-methylpyrimidine-4-carbonyl]amino]-3-[(2r,3s,4s,5s,6s)-3-[(2r,3s,4s,5r,6r)-4-carbamoyloxy-3,5-dihydroxy-6-(hydroxymethyl)ox Chemical compound OS([O-])(=O)=O.N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C WUIABRMSWOKTOF-OYALTWQYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- 238000011740 C57BL/6 mouse Methods 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 2
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- 206010023421 Kidney fibrosis Diseases 0.000 description 2
- 229930040373 Paraformaldehyde Natural products 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 2
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 208000033626 Renal failure acute Diseases 0.000 description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 2
- 241001147844 Streptomyces verticillus Species 0.000 description 2
- 102000046299 Transforming Growth Factor beta1 Human genes 0.000 description 2
- 101800002279 Transforming growth factor beta-1 Proteins 0.000 description 2
- 239000013504 Triton X-100 Substances 0.000 description 2
- 229920004890 Triton X-100 Polymers 0.000 description 2
- PNNCWTXUWKENPE-UHFFFAOYSA-N [N].NC(N)=O Chemical compound [N].NC(N)=O PNNCWTXUWKENPE-UHFFFAOYSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 230000009798 acute exacerbation Effects 0.000 description 2
- 201000011040 acute kidney failure Diseases 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 239000003429 antifungal agent Substances 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 210000001130 astrocyte Anatomy 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- 238000012742 biochemical analysis Methods 0.000 description 2
- 239000000090 biomarker Substances 0.000 description 2
- 229960004395 bleomycin sulfate Drugs 0.000 description 2
- 230000017531 blood circulation Effects 0.000 description 2
- 210000004271 bone marrow stromal cell Anatomy 0.000 description 2
- 230000032677 cell aging Effects 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 208000020832 chronic kidney disease Diseases 0.000 description 2
- 208000019425 cirrhosis of liver Diseases 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 238000010411 cooking Methods 0.000 description 2
- 229960003624 creatine Drugs 0.000 description 2
- 239000006046 creatine Substances 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 238000011118 depth filtration Methods 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 2
- 238000011026 diafiltration Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 238000007865 diluting Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000007884 disintegrant Substances 0.000 description 2
- 238000002224 dissection Methods 0.000 description 2
- 238000001647 drug administration Methods 0.000 description 2
- 208000028208 end stage renal disease Diseases 0.000 description 2
- 201000000523 end stage renal failure Diseases 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 210000002744 extracellular matrix Anatomy 0.000 description 2
- 239000000835 fiber Substances 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 230000003907 kidney function Effects 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- OSWPMRLSEDHDFF-UHFFFAOYSA-N methyl salicylate Chemical compound COC(=O)C1=CC=CC=C1O OSWPMRLSEDHDFF-UHFFFAOYSA-N 0.000 description 2
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 2
- 239000003595 mist Substances 0.000 description 2
- 238000012434 mixed-mode chromatography Methods 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 238000002663 nebulization Methods 0.000 description 2
- 229960004378 nintedanib Drugs 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 229920002866 paraformaldehyde Polymers 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 230000007170 pathology Effects 0.000 description 2
- WEXRUCMBJFQVBZ-UHFFFAOYSA-N pentobarbital Chemical compound CCCC(C)C1(CC)C(=O)NC(=O)NC1=O WEXRUCMBJFQVBZ-UHFFFAOYSA-N 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- 239000006187 pill Substances 0.000 description 2
- 239000013600 plasmid vector Substances 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 210000005084 renal tissue Anatomy 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 239000012679 serum free medium Substances 0.000 description 2
- 210000002460 smooth muscle Anatomy 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 230000000451 tissue damage Effects 0.000 description 2
- 231100000827 tissue damage Toxicity 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 238000000108 ultra-filtration Methods 0.000 description 2
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- LOGFVTREOLYCPF-KXNHARMFSA-N (2s,3r)-2-[[(2r)-1-[(2s)-2,6-diaminohexanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxybutanoic acid Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]1CCCN1C(=O)[C@@H](N)CCCCN LOGFVTREOLYCPF-KXNHARMFSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- 108010067219 Aggrecans Proteins 0.000 description 1
- 102000016284 Aggrecans Human genes 0.000 description 1
- 239000012099 Alexa Fluor family Substances 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 241001678559 COVID-19 virus Species 0.000 description 1
- 241001264766 Callistemon Species 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 206010011224 Cough Diseases 0.000 description 1
- 206010011376 Crepitations Diseases 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 230000005778 DNA damage Effects 0.000 description 1
- 231100000277 DNA damage Toxicity 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 206010019668 Hepatic fibrosis Diseases 0.000 description 1
- 102000003777 Interleukin-1 beta Human genes 0.000 description 1
- 108090000193 Interleukin-1 beta Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 244000246386 Mentha pulegium Species 0.000 description 1
- 235000016257 Mentha pulegium Nutrition 0.000 description 1
- 235000004357 Mentha x piperita Nutrition 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 206010073310 Occupational exposures Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102100037765 Periostin Human genes 0.000 description 1
- 101710199268 Periostin Proteins 0.000 description 1
- 229940122907 Phosphatase inhibitor Drugs 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- 208000001647 Renal Insufficiency Diseases 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- 208000037656 Respiratory Sounds Diseases 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 208000000260 Warts Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 210000001552 airway epithelial cell Anatomy 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 230000003385 bacteriostatic effect Effects 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 239000003833 bile salt Substances 0.000 description 1
- 229940093761 bile salts Drugs 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 239000012888 bovine serum Substances 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 238000005352 clarification Methods 0.000 description 1
- 238000003501 co-culture Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 229940075614 colloidal silicon dioxide Drugs 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 230000008828 contractile function Effects 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 239000000645 desinfectant Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- MQRJBSHKWOFOGF-UHFFFAOYSA-L disodium;carbonate;hydrate Chemical compound O.[Na+].[Na+].[O-]C([O-])=O MQRJBSHKWOFOGF-UHFFFAOYSA-L 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 206010013663 drug dependence Diseases 0.000 description 1
- 208000017574 dry cough Diseases 0.000 description 1
- 239000000428 dust Substances 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940079360 enema for constipation Drugs 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 201000001155 extrinsic allergic alveolitis Diseases 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 230000003328 fibroblastic effect Effects 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- IECPWNUMDGFDKC-MZJAQBGESA-N fusidic acid Chemical class O[C@@H]([C@@H]12)C[C@H]3\C(=C(/CCC=C(C)C)C(O)=O)[C@@H](OC(C)=O)C[C@]3(C)[C@@]2(C)CC[C@@H]2[C@]1(C)CC[C@@H](O)[C@H]2C IECPWNUMDGFDKC-MZJAQBGESA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 208000021302 gastroesophageal reflux disease Diseases 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 230000024924 glomerular filtration Effects 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 238000011553 hamster model Methods 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 239000000383 hazardous chemical Substances 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- MAHXCOMHJBHBGO-RTKIROINSA-N hematoxin Chemical compound C12=CC(O)=C(O)C=C2C[C@]2(O)[C@H](OC)C11C=CC(=O)C(O)=C1OC2 MAHXCOMHJBHBGO-RTKIROINSA-N 0.000 description 1
- 238000007490 hematoxylin and eosin (H&E) staining Methods 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 235000001050 hortel pimenta Nutrition 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 208000022098 hypersensitivity pneumonitis Diseases 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 201000006370 kidney failure Diseases 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 210000004924 lung microvascular endothelial cell Anatomy 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- STZCRXQWRGQSJD-GEEYTBSJSA-M methyl orange Chemical compound [Na+].C1=CC(N(C)C)=CC=C1\N=N\C1=CC=C(S([O-])(=O)=O)C=C1 STZCRXQWRGQSJD-GEEYTBSJSA-M 0.000 description 1
- 229940012189 methyl orange Drugs 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 229960001047 methyl salicylate Drugs 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 210000005087 mononuclear cell Anatomy 0.000 description 1
- 230000004660 morphological change Effects 0.000 description 1
- 239000002324 mouth wash Substances 0.000 description 1
- 229940051866 mouthwash Drugs 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 239000006218 nasal suppository Substances 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 231100000675 occupational exposure Toxicity 0.000 description 1
- 229940015847 ofev Drugs 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 229960001412 pentobarbital Drugs 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 238000011176 pooling Methods 0.000 description 1
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 1
- 229960005205 prednisolone Drugs 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000002250 progressing effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 210000003456 pulmonary alveoli Anatomy 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000004451 qualitative analysis Methods 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 238000011552 rat model Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000001172 regenerating effect Effects 0.000 description 1
- 230000029058 respiratory gaseous exchange Effects 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 229940081974 saccharin Drugs 0.000 description 1
- 235000019204 saccharin Nutrition 0.000 description 1
- 239000000901 saccharin and its Na,K and Ca salt Substances 0.000 description 1
- 238000007790 scraping Methods 0.000 description 1
- 201000010153 skin papilloma Diseases 0.000 description 1
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 1
- 229940076133 sodium carbonate monohydrate Drugs 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 210000004500 stellate cell Anatomy 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 208000011117 substance-related disease Diseases 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 239000002511 suppository base Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 108091035539 telomere Proteins 0.000 description 1
- 210000003411 telomere Anatomy 0.000 description 1
- 102000055501 telomere Human genes 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 230000003867 tiredness Effects 0.000 description 1
- 208000016255 tiredness Diseases 0.000 description 1
- 210000003371 toe Anatomy 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 229940099456 transforming growth factor beta 1 Drugs 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 239000003656 tris buffered saline Substances 0.000 description 1
- 210000005239 tubule Anatomy 0.000 description 1
- 238000011870 unpaired t-test Methods 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 238000009777 vacuum freeze-drying Methods 0.000 description 1
- 210000004509 vascular smooth muscle cell Anatomy 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 239000002699 waste material Substances 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
Definitions
- the present invention relates to a composition for repairing various tissue damage due to fibrosis, preventing or treating fibrotic diseases, comprising hyaluronan and proteoglycan link protein 1 (HAPLN1) or a gene encoding the same as an active ingredient. It's about Specifically, the present invention relates to a composition for repairing and regenerating damage caused by fibrosis of tissue containing HAPLN1 as an active ingredient. In addition, the present invention relates to a composition for repairing and recovering various tissue damage and functional loss due to fibrosis, and preventing or treating aging/degenerative diseases including fibrotic diseases.
- HPLN1 proteoglycan link protein 1
- the present invention discloses a composition for preventing or treating fibrotic disease and a method for preventing or inhibiting fibrosis of cells using the composition. According to the present invention, by preventing and inhibiting cell fibrosis, the occurrence or progression of various diseases caused by intervening cell fibrosis can be fundamentally suppressed as well as treated.
- 'lung fibrosis' in which the lungs harden like stones, refers to a disease in which healthy lung tissue is changed into scar tissue for some reason, causing the lung tissue to become thick or hard.
- the cause is clearly known as a specific hazardous chemical used to maintain the sterilization action in the humidifier, but the disease in which the lungs harden without knowing the cause is 'idiopathic pulmonary fibrosis (IPF)' , Idiopathic Pulmonary Fibrosis)'.
- IPF pulmonary fibrosis
- Idiopathic Pulmonary Fibrosis Idiopathic Pulmonary Fibrosis
- This disease is a kind of interstitial lung disease (ILD) that histologically shows symptoms of 'Usual Interstitial Pneumonia (UIP)' characterized by inflammation and fibrosis of the lung parenchyma, and is characterized by aging,
- ILD interstitial lung disease
- UIP 'Usual Interstitial Pneumonia
- Various risk factors are known, including smoking, gastroesophageal reflux disease, environmental/occupational exposure, dust work, radiation exposure, autoimmunity, drug addiction, hypersensitivity pneumonitis, viral/pathogen infection, and family history.
- the etiology of this disease is not clearly known.
- the average age of onset is 69 years old, and it mainly occurs in the elderly, and males are more than twice as common as females, and the prognosis is poor.
- 'idiopathic pulmonary fibrosis' a representative pulmonary fibrosis
- the number of domestic patients is 1.7 per 100,000 people, and as the cause is unknown, it is a very scary disease that is difficult to treat.
- the average survival time is 60 months, but acute exacerbation due to infection occurs in 14% of patients per year. When an acute exacerbation occurs, the survival time drops sharply to 15 months.
- the alveolar wall is thickened with scar tissue, and as the scar tissue gradually deteriorates, the lung parenchymal tissue is destroyed. Inhalation, especially inhaling air, becomes difficult at this time, making it impossible to breathe in enough air to oxygenate the blood. Eventually, the alveoli lose their original function, and rapid breathing, frequent dry cough, tiredness, and club-shaped changes appear on the fingertips and toes. Crackles are induced.
- the COVID-19 virus which has recently become popular as a pendemic, also infects and inflames the lungs, sometimes causing pulmonary fibrosis in the process of healing.
- the most well-known risk factor for fibrosis is old age.
- researchers who have been exploring lung tissue lesions have recently discovered that the lung cells of patients with pulmonary fibrosis cannot sustain division and growth, which are signs of cellular senescence.
- the cellular senescence theory believes that the aging of organisms, including humans, is due to the accumulation of senescent cells that are not physiologically useful but rather promote pathological conditions. It is a phenomenon that enters the process and no longer divides and produces cells at the normal rate.
- the effect of cellular senescence on fibrosis in elderly pneumonia is systematically well described (Yanagi 2017, Int. J. Mol. Sci. 18, 503).
- SASP serine-associated secretory phenotype
- IL-1 ⁇ interleukin 1 beta
- the present inventors paid attention to the fact that the risk factor for pulmonary fibrosis is old age, and in order to discover 'endogenous substances in blood' that can prevent or treat the onset of this disease, the disease combination between young and old mice ( While exploring through qualitative and quantitative analysis techniques using heterochronic parabiosis and proteomics technology, hyaluronan (HA) and proteoglycan link protein (HAPLN1) drew attention as the most likely substance. It became.
- HA hyaluronan
- HPLN1 proteoglycan link protein
- HAPLN1 protein is one of the constituent proteins in the extracellular matrix (ECM) first discovered in vertebrate cartilage, and plays a role in stabilizing the structural aggregate of hyaluronic acid and proteoglycan, At this time, it is reported that it acts as a hinge to make a bottle-brush shape by making the gap between the proteoglycans to be bound very densely.
- ECM extracellular matrix
- the present inventors have found that recombinant human HAPLN1 (rhHAPLN1) actually suppresses the degradation of its partner molecules, high molecular weight HA (HMW HA) and aggrecan (a type of proteoglycan), through its hinge-type linkage function, resulting in damage-associated molecules. It has been proven that it can reduce the production of low molecular weight HA (LMW HA) or 32-mer peptide as a model (DAMPs, damage-associated molecular patterns) substance.
- LMW HA low molecular weight HA
- DAMPs
- Myofibroblasts are major cells that excessively form fibrous tissue such as collagen in fibrotic diseases. These myofibroblasts characteristically show the expression of ⁇ smooth muscle actin ( ⁇ SMA), and therefore the level of ⁇ SMA expression is an important indicator for determining the level of expression of myofibroblasts.
- ⁇ SMA-expressing myofibroblasts are increasing in various fibrotic diseases such as idiopathic pulmonary fibrosis and renal fibrosis, and ⁇ SMA expression has also been reported to increase in in vivo fibrosis models. These myofibroblasts are mainly derived from fibroblasts, and are also reported to be derived from endothelial cells, epithelial cells, stem cells, etc.
- TGF ⁇ 1 is the most well-known factor for inducing differentiation of myofibroblasts (or activation of hepatic stellate cells), and in addition, mechanical stress in a stiff environment has been reported as a factor for differentiation of myofibroblasts (The American Journal of Pathology, 2007. 170(6): 1807-1816). Therefore, induction of ⁇ SMA expression by TGF ⁇ 1 in various cells is used as an in vitro fibrosis model, and the activity of reducing induced ⁇ SMA expression is judged as anti-fibrotic efficacy (Molecular Medicine 2021 27:22).
- BIPF Pulmonary Fibrosis
- pirfenidone a candidate drug, on pulmonary fibrosis
- the research team administered bleomycin three times a day for 10 days or 28 days from the day after the first administration of bleomycin (day 0) (day 1), followed by treatment.
- the efficacy of each was examined.
- the level of inflammation-related biomarkers decreased in the group treated with prednisolone, a type of anti-inflammatory corticosteroid, but the level of TGF ⁇ 1, a measure of anti-fibrotic efficacy, was not decreased.
- the present inventors have found that the HAPLN1 protein composition prevents and prevents fibrosis of various tissues even at very low concentrations using the TGF ⁇ 1-induced fibrotic disease cell model and the bleomycin-induced pulmonary fibrosis mouse model (BIPF) as described above.
- BIPF bleomycin-induced pulmonary fibrosis mouse model
- HAPLN1 for example, US Patent Publication US 2013/0052198 discloses the HAPLN1 polypeptide as one of a wide range of individual factors secreted by Marrow stromal cells (MSC), and when administered to an inflammatory disease subject, the characteristics of the disease suggests that it can weaken However, nothing has been said about the action of preventing or treating fibrosis in various tissues.
- MSC Marrow stromal cells
- the present invention relates to a composition for preventing and treating fibrotic diseases comprising hyaluronan and proteoglycan link protein 1 (HAPLN1) or a gene encoding the same as an active ingredient, and preventing and treating fibrotic diseases using the same.
- HPLN1 hyaluronan and proteoglycan link protein 1
- a reagent composition containing hyaluronan and proteoglycan link protein 1 (HAPLN1) or a gene encoding it as an active ingredient it is used in the study of the disease to identify the mechanism of the disease and related disease It is intended to contribute to the development of preventive or therapeutic compositions.
- HPLN1 hyaluronan and proteoglycan link protein 1
- the present invention provides the following aspects of the invention.
- One aspect of the present invention is a pharmaceutical composition for preventing or treating fibrotic diseases comprising hyaluronan and proteoglycan link protein 1 (HAPLN1) or a gene encoding the same as an active ingredient. it's about
- Another aspect of the present invention relates to a composition in which the protein of the composition has 80% or more sequence identity to the amino acid sequence of SEQ ID NO: 1.
- Another aspect of the present invention relates to a composition in which the nucleic acid related to the gene in the composition is included in an expression vector.
- Another aspect of the present invention relates to a composition in which the lesion of the fibrotic disease is selected from the group consisting of skin, liver, intestine, heart, lung, and kidney.
- one aspect of the present invention is that the foci of the fibrotic disease are skin fibroblasts, hepatic stellate cells, colonic fibroblasts, cardiac microvascular endothelial cells, lung fibroblasts, renal tubular cells, and renal proximal tubular epithelial cells. It relates to a composition selected from the group consisting of.
- Another aspect of the present invention relates to a composition wherein the fibrotic disease is ischemic fibrosis.
- one aspect of the present invention relates to a composition in which a single dose of the composition is 0.1 ng/ml to 500 ng/ml.
- Another aspect of the present invention relates to a composition that is administered at a dose of 0.001 to 5 mg/kg BW of rhHAPLN1 protein when the composition is administered in vivo.
- one aspect of the present invention relates to a composition that is included as a main or auxiliary active ingredient in a composition for preventing or inhibiting cellular fibrosis.
- another aspect of the present invention is to treat cells with a composition containing hyaluronan and proteoglycan link protein 1 (HAPLN1) or a gene encoding the same as an active ingredient to prevent cell fibrosis. It relates to methods of preventing or suppressing it.
- HPLN1 hyaluronan and proteoglycan link protein 1
- kits for preventing or inhibiting cell fibrosis comprising the composition according to any one of items [1] to item [9] and instructions for treatment according to the method of item [10] It is about.
- a further aspect of the present invention relates to an experimental reagent composition related to preventing or inhibiting cell fibrosis, including the composition according to any one of [1] to [9].
- composition and method of the present invention by preventing and inhibiting cell fibrosis, the occurrence or progression of various diseases caused by cell fibrosis is fundamentally inhibited, thereby increasing the possibility of preventing or treating the disease. dramatically enhances That is, it is possible to prevent or treat fibrosis occurring in each tissue caused by a decrease in tissue regeneration/repair ability caused by environmental factors such as aging and smoking.
- composition of the present invention can safely and effectively cope with fibrotic diseases, which are increasing every year along with the global aging trend, because of the low side effects of conventional fibrotic disease treatment drugs.
- the reagent composition of the present invention can be used in the study of various diseases related to cell fibrosis to help identify the mechanism of the disease and develop a preventive or therapeutic composition for the disease.
- Figure 1a is a protein band photograph of Western blot showing the anti-fibrotic action of the composition of the present invention on skin fibrosis using normal human dermal fibroblast (NHDF) as a sample.
- NHDF normal human dermal fibroblast
- the expression levels of ⁇ SMA and GAPDH proteins according to the composition of the present invention and various concentrations of pirfenidone are shown as Western blot band intensities.
- Figure 1b is a graph showing the relative levels of ⁇ SMA according to various concentrations of the composition of the present invention and pirfenidone by quantifying the intensities of the western blot bands of Figure 1a.
- Figure 2a is an experimental plan for evaluating the anti-fibrotic action of the composition of the present invention on liver fibrosis using human hepatic stellate cells (HHSC) as a sample.
- HHSC human hepatic stellate cells
- FIG. 2b is a photograph of Western blot bands showing the expression levels of ⁇ SMA and GAPDH proteins according to the composition of the present invention and various concentrations of pirfenidone according to the experimental plan of FIG. 2a.
- Figure 2c is a graph showing the relative levels of ⁇ SMA according to various concentrations of the composition of the present invention and pirfenidone by quantifying the intensities of the western blot bands of FIG. 2a.
- Figure 3a is an experimental plan for evaluating the anti-fibrotic action of the composition of the present invention on intestinal fibrosis using a human colon fibroblast cell line (CCD-18Co) as a sample.
- CCD-18Co human colon fibroblast cell line
- Figure 3b is a Western blot band photograph showing the expression levels of ⁇ SMA and GAPDH proteins according to the composition of the present invention and various concentrations of pirfenidone according to the experimental plan of Figure 3a.
- Figure 3c is a graph showing the relative levels of ⁇ SMA according to various concentrations of the composition of the present invention and pirfenidone by quantifying the intensities of the western blot bands of Figure 3b.
- Figure 4a is an experimental plan for evaluating the antifibrotic action of the composition of the present invention on cardiac fibrosis using human cardiac microvascular endothelial cells (HCMEC) as a sample.
- HCMEC human cardiac microvascular endothelial cells
- FIG. 4b is a photograph of Western blot bands showing the expression levels of ⁇ SMA and GAPDH proteins according to the composition of the present invention and various concentrations of pirfenidone according to the experimental plan of FIG. 4a.
- Figure 4c is a graph showing the relative levels of ⁇ SMA according to various concentrations of the composition of the present invention and pirfenidone by quantifying the intensities of the western blot bands of Figure 4b.
- Figure 5a is a Western blot band photograph showing the anti-fibrotic action of the composition of the present invention on skin fibrosis using normal human lung fibroblasts (NHLF) as a sample.
- NHLF normal human lung fibroblasts
- the expression levels of ⁇ SMA and GAPDH proteins according to the composition of the present invention and various concentrations of pirfenidone are shown as Western blot band intensities.
- Figure 5b is a graph showing the relative levels of ⁇ SMA according to various concentrations of the composition of the present invention and pirfenidone by quantifying the intensities of the western blot bands of Figure 5a.
- Figure 6a is an experimental plan for evaluating the fibrosis preventing action of the composition of the present invention on renal fibrosis using an epithelial cell line of human kidney renal tubular cells (Human Kidney 2, HK-2) as a sample.
- Figure 6b is a Western blot band photograph showing the expression levels of ⁇ SMA and GAPDH proteins according to the composition of the present invention and various concentrations of pirfenidone according to the experimental plan of Figure 6a.
- Figure 6c is a graph showing the relative levels of ⁇ SMA according to various concentrations of the composition of the present invention and pirfenidone by quantifying the intensities of the western blot bands of Figure 6b.
- Figure 7a is an experimental plan for evaluating the antifibrotic action of the composition of the present invention on renal fibrosis using an epithelial cell line of human kidney renal tubular cells (Human Kidney 2, HK-2) as a sample.
- FIG. 7b is a photograph of western blot bands showing the expression levels of ⁇ SMA and GAPDH proteins according to the composition of the present invention and various concentrations of pirfenidone according to the experimental plan of FIG. 7a.
- FIG. 7c is a graph showing the relative levels of ⁇ SMA according to various concentrations of the composition of the present invention and pirfenidone by quantifying the intensity of the western blot band of FIG. 7b.
- 8a is an experimental plan for evaluating the efficacy of rhHAPLN1 in changing the fibrotic morphology of HK-2 cells by TGF ⁇ 1 induction using an epithelial cell line of human kidney renal tubular cells (Human Kidney 2, HK-2) as a sample.
- FIG. 8B is a photomicrograph showing changes in shape of cells according to various concentrations of the composition of the present invention and pirfenidone according to the experimental plan of FIG. 8A.
- Figure 9a is a Western blot band photograph showing the anti-fibrotic action of the composition of the present invention on fibrosis caused by senescence, using Renal Proximal Tubule Epithelial Cells (RPTEC) as a sample.
- RPTEC Renal Proximal Tubule Epithelial Cells
- the expression levels of ⁇ SMA and GAPDH proteins according to various concentrations of the composition of the present invention for cultured cells of passage 11 are shown as Western blot band intensities.
- Figure 9b is a graph showing the relative levels of ⁇ SMA according to various concentrations of the composition of the present invention by quantifying the intensity of the western blot band shown in Figure 9a.
- 10a shows the cell nucleus observed by staining with DAPI (4',6-diamidino-2-phenylindole) during the 4th and 11th passage cultures, and ⁇ SMA antibody (abcam, ab7817) at 1:1000 in 1XPBST (1X PBS with 0.1% Triton X-100, 1% BSA) to stain intracellular ⁇ SMA, and this is a photograph showing the degree of expression by fluorescence.
- DAPI 4,6-diamidino-2-phenylindole
- FIG. 10B is a photograph showing the relative levels of ⁇ SMA in cells by fluorescence according to various concentrations of the composition of the present invention and treatment with pirfenidone during culture of 4 passages and 11 passages in which senescence was induced as a control group.
- Figure 11a is an experiment confirming the effect of rhHAPLN1 on anti-fibrotic markers using the BioMAP Fibrosis panel.
- the composition of the present invention (rhHAPLN1) showed significant effects on ⁇ SMA and collagen I at each concentration. It is a graph showing the reduction effect as a relative fold (fold change) compared to the vehicle control group.
- Figure 11b is an experiment confirming the effect of rhHAPLN1 on anti-fibrotic markers using the BioMAP Fibrosis panel.
- the composition of the present invention (rhHAPLN1) significantly reduced collagen I for each concentration It is a graph showing the effect as a relative fold compared to the vehicle control group.
- Figure 11c is an experiment confirming the effect of rhHAPLN1 on anti-fibrotic markers using the BioMAP Fibrosis panel, and the composition of the present invention (rhHAPLN1) in myofibroblasts showed a significant reducing effect on collagen IV at each concentration compared to the vehicle control group. It is a graph expressed as a relative multiple.
- Figure 12a is a diagram illustrating the outline of an experiment to evaluate the anti-fibrotic efficacy (preventive ability of fibrotic diseases) of the composition of the present invention using a mouse bleomycin-induced pulmonary fibrosis (BIPF) model.
- BIPF mouse bleomycin-induced pulmonary fibrosis
- Figure 12b is divided into four groups (Mouse 1 to 4) in the experiment using the mouse Bleomycin-induced pulmonary fibrosis model of Figure 12a normal group (Normal) group (Normal) is treated with PBS, the control group (Control) is treated with no treatment 0.0005% (w/w) of the composition of the present invention (rhHAPLN1) and 0.0015% (w/w) of the composition of the present invention (rhHAPLN1) were respectively treated and the lung tissues of 4 mice per group were extracted. Next, the left large lobe was cut in half horizontally, the upper part was fixed in formalin, and hematoxylin and eosin (H&E) staining was performed.
- Normal normal group
- Control Control
- rhHAPLN1 the composition of the present invention
- rhHAPLN1 0.0015%
- 12c shows that the middle part of the largest lobe lung tissue of the left mouse was cut to make 3 tissue slides per mouse, and 3 pictures were taken at random on each slide, and then the stained red part and the other 9 parts were taken. It is a graph confirming statistical significance by obtaining an average value per animal by averaging each value obtained by measuring the area of the stained red part using 'Image J' software.
- 12d and 12e are photographs and descriptions of the Ashcroft score, which provides an official guideline that can easily measure the severity of pulmonary fibrosis with the naked eye (Ashcroft et al 1988, J Clin Pathol 41:467-470).
- Figure 12f is a graph of the experimental results showing the severity of pulmonary fibrosis as Ashcroft score according to Figures 13a and 13b.
- Figure 13a is a diagram illustrating the outline of an experiment to evaluate the anti-fibrotic efficacy (therapeutic ability of fibrotic diseases) of the composition of the present invention using a mouse bleomycin-induced pulmonary fibrosis (BIPF) model.
- BIPF mouse bleomycin-induced pulmonary fibrosis
- Figure 13b shows mice in four groups (Normal, PBS Control, 0.00075% (w / w) rhHAPLN1, 0.0015% (w / w) rhHAPLN1, 0.003% ( w/w) rhHAPLN1), set to 4 mice per group, and after the experiment, the lung tissue of 4 mice per group was extracted, and then the left large lobe was cut in half horizontally, the upper part was fixed in formalin, and hematoxin and eosin ( H&E) This is a photograph of staining.
- H&E hematoxin and eosin
- 13c and 13d show that the middle part of the largest lobe lung tissue of the left mouse was cut to make 3 tissue slides per animal, and 3 pictures were taken at random on one slide, respectively, and the red part stained for a total of 9 parts It is a graph confirming the statistical significance by dividing the white color and the non-white color, and obtaining the average value per animal by averaging each value obtained by measuring the area of the stained red part using 'Image J' software.
- FIG. 13e is a graph of experimental results showing the severity of pulmonary fibrosis as an Ashcroft score in relation to the results of FIG. 13c.
- Figure 14a is an experimental plan for evaluating the anti-fibrotic action of the composition of the present invention on renal fibrosis using ischemia/reperfusion as an animal model for inducing renal fibrosis.
- Figure 14b is a protein band photograph of Western blot showing the expression level of ⁇ SMA protein according to the administration of the composition of the present invention and pirfenidone according to the experimental plan of Figure 14a (SV; sham-vehicle, SB; sham-rhHAPLN1-dissolving Sham-rhHAPLN1 dose B as a solution, group to check the effect of rhHAPLN1 treatment on Sham control, IRV; IR-vehicle, IRP; IR-pirfenidone, IRA; IR-rhHAPLN1 dose A, IRB; IR- rhHAPLN1 dose B, IRC; IR-rhHAPLN1 dose C).
- SV sham-vehicle, SB
- sham-rhHAPLN1-dissolving Sham-rhHAPLN1 dose B as a solution, group to check the effect of rhHAPLN1 treatment on Sham control
- IRV
- FIG. 14c is a graph showing the expression level of ⁇ SMA against IRV as a fold change according to various concentrations of pirfenidone and the composition of the present invention by quantifying the intensity of the Western blot band of FIG. 14b.
- 14D is a photograph showing the expression level of Collagen according to various concentrations of pirfenidone and the composition of the present invention in a Sirus red and PAS staining photograph in an acute renal injury-induced model. Purple color shows collagen expression.
- FIG. 14e shows two random sites in the outer medulla of the kidney in tissue staining to quantify the expression level of Collagen according to various concentrations of pirfenidone and the composition of the present invention in the acute kidney injury induced model. This is a picture showing only the collagen-positive area after imaging with .
- FIG. 14f is a graph shown by marking collagen-positive sites in FIG. 14e and quantifying the area (%) of collagen using i-solution software (IMT).
- IMT i-solution software
- 14g is a graph showing values of creatinine clearance measured at 21 days after ischemia/recanalization according to various concentrations of pirfenidone and the composition of the present invention in an acute renal injury-induced model.
- rhHAPLN1 represents recombinant human HAPLN1 as an abbreviation for recombinant human HAPLN1.
- fibroblast refers to cells involved in maintaining tissue structures by making connective tissues such as collagen fibers, not epithelial, blood vessels, lymph vessels, and inflammatory cells.
- Myofibroblast refers to fibroblasts activated by physical injury or inflammation and having a contractile function like smooth muscle cells by expressing ⁇ -SMA (alpha-smooth muscle actin).
- ⁇ SMA or " ⁇ -SMA (alpha smooth muscle actin)
- ⁇ SMA alpha smooth muscle actin
- ⁇ SMA is a protein expressed in pathological vascular smooth muscle cells and stromal fibroblastic cells, It is a major marker of tissue fibrosis. Expression is high in the kidney showing findings of renal fibrosis, and such a high expression level or activity means that the activity of myofibroblasts, which is closely related to the degree of interstitial fibrosis, is high.
- ⁇ SMA since the expression of ⁇ SMA in the patient is closely related to the decrease in creatine clearance in the kidney, it functions as a marker that can confirm that creatine, a waste product in the body, is not cleared.
- transforming growth factor beta 1 refers to a cytokine used to transform fibroblasts into myofibroblasts in various embodiments of the present invention, and the conversion capacity for each cell is different
- various physiologically active substances such as cytokines, chemokines, growth factors, and hormones are involved in the transformation of fibroblasts into myofibroblasts.
- Pirfenidone is an anti-fibrotic drug that has been approved as a treatment for pulmonary fibrosis and is currently undergoing clinical trials as a treatment for renal fibrosis. It was used as a control material in the experiments of the examples of the present invention. Although the effective dose may be different for each cell, it has been reported to show efficacy from 100 ⁇ g/mL or more in related literature.
- One aspect of the present invention relates to an anti-fibrotic composition
- an anti-fibrotic composition comprising hyaluronan and proteoglycan link protein 1 (HAPLN1) or a gene encoding the same as an active ingredient. It can function as a pharmaceutical composition for preventing or treating fibrotic diseases.
- HPLN1 proteoglycan link protein 1
- the recombinant human HAPLN1 protein represented by SEQ ID NO: 1 in the composition of the present invention may be used.
- the HAPLN1 protein of the present invention is 80%, preferably 85%, more preferably 90%, still more preferably 95%, most preferably 95% of the amino acid sequence of SEQ ID NO: 1 as long as it maintains the anti-fibrotic function. may be a protein having 100% sequence identity.
- the nucleic acid related to the gene encoding the HAPLN1 protein in the composition of the present invention may be included in the composition by being included in an expression vector.
- the cells to which the composition of the present invention acts are not particularly limited, but preferably include various fibroblasts, astrocytes, endothelial cells and epithelial cells, and more specifically, skin fibroblasts, liver Astrocytes, human colon cells, microvascular endothelial cells, lung fibroblasts, kidney renal tubular cells, and proximal tubular epithelial cells, etc., including cells in various situations such as in vivo, in vitro, ex vivo, and in situ.
- the organ to be applied is not particularly limited as long as it is an organ that is likely to induce fibrosis, but preferably includes the lung, kidney, skin, liver, intestine, heart, and the like.
- the composition of the present invention has a single dose to cells of 0.1 ng/ml to 500 ng/ml, preferably 1 ng/ml to 300 ng/ml, more preferably 3.0 ng/ml to 50 ng/ml, more preferably 10 ng/ml to 13 ng/ml. However, it may be more specifically 3, 5, 11, 30, 50, or 100 ng/ml depending on the area to be applied or in some cases.
- the composition of the present invention is 0.00001 to 0.1% (w / w), preferably 0.0001 to 0.05% (w / w), more preferably 0.0003 to 0.03% (w/w), still more preferably 0.0005 to 0.015% (w/w).
- the composition of the present invention may be included as a main or auxiliary active ingredient of the composition for preventing or inhibiting the fibrosis of cells.
- hyaluronan and proteoglycan link protein 1 HPLN1
- a composition comprising hyaluronan and proteoglycan link protein 1 (HAPLN1) or a gene encoding the same as an active ingredient, preventing or inhibiting cell fibrosis It's about how.
- kits for preventing or inhibiting fibrosis of cells comprising the composition and treatment instructions of the present invention.
- the present invention relates to an experimental reagent composition related to the prevention or inhibition of cell fibrosis, including the composition of the present invention.
- the present invention relates to the use of the composition of the present invention for use in the preparation of a pharmaceutical composition for preventing or treating diseases caused by cell fibrosis.
- the pharmaceutical composition may generally include a molecule and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier includes saline solutions, solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are compatible with pharmaceutical administration. Supplementary active compounds may also be included in the composition.
- the pharmaceutical composition of the present invention may further include a pharmaceutical additive selected from the group consisting of a pharmaceutically acceptable carrier, diluent, binder, disintegrant, lubricant, and any combination thereof.
- the pharmaceutical composition may be formulated to be compatible with the intended route of administration.
- the composition of the present invention may be a formulation selected from the group consisting of eye drops, ointments, tablets, pills, capsules, troches, inhalants, injections, patches, and suppositories.
- routes of administration include parenteral, eg intravenous, intradermal, subcutaneous, oral (eg, inhalation), transdermal (topical), transmucosal and rectal administration. It is preferably for parenteral administration.
- Solutions or suspensions used for parenteral, intradermal or subcutaneous application may include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetate, citrate or phosphate and tonicity adjusting agents such as sodium chloride or dextrose.
- the pH can be adjusted with acids or bases such as hydrochloric acid or sodium hydroxide.
- Parenteral preparations may be enclosed in ampoules, disposable syringes, or multi-dose vials made of glass or plastic.
- compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- Suitable carriers for intravenous administration include physiological saline, bacteriostatic water, or phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- the composition must be sterile and must be fluid enough to facilitate syringability. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyols (eg, glycerol, propylene glycol, liquid polyethylene glycol, and the like) and suitable mixtures thereof. Adequate fluidity can be maintained, for example, by the use of a coating such as lecithin, the maintenance of the required particle size in the case of dispersion, and the use of a surfactant. Prevention of microbial action can be achieved by various antibacterial and antifungal agents such as, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal and the like.
- isotonic agents eg sugars, polyalcohols such as mannitol, sorbitol, sodium chloride
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, aluminum monostearate and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- preferred methods of preparation are vacuum drying and freeze drying, resulting in the powder of the active ingredient and any additional ingredients desired from a previously sterile filtered solution.
- Oral compositions generally include an inert diluent or an edible carrier.
- the active compounds may be incorporated with excipients and used in the form of tablets, troches or capsules, eg gelatin capsules.
- Oral compositions can also be prepared using a fluid carrier for use as a mouthwash.
- Pharmaceutically compatible binders and/or adjuvant materials may be included as part of the composition.
- Tablets, pills, capsules, troches and the like may contain any of the following ingredients or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; excipients such as starch or lactose, disintegrants such as alginic acid, Primogel or corn starch; lubricants such as magnesium stearate or sterotes; glidants such as colloidal silicon dioxide; sweeteners such as sucrose or saccharin; or a flavoring such as peppermint, methyl salicylate, or orange flavoring.
- a binder such as microcrystalline cellulose, gum tragacanth or gelatin
- excipients such as starch or lactose, disintegrants such as alginic acid, Primogel or corn starch
- lubricants such as magnesium stearate or sterotes
- glidants such as colloidal silicon dioxide
- sweeteners such as sucrose or saccharin
- a flavoring such as peppermint
- the compounds are delivered in the form of an aerosol spray from a pressure vessel or dispenser containing a suitable propellant, for example a gas such as carbon dioxide, or a nebulizer.
- a suitable propellant for example a gas such as carbon dioxide, or a nebulizer.
- Systemic administration may also be by transmucosal or transdermal means.
- penetrants suitable for the barrier to be penetrated are used in the formulation.
- penetrants are generally known in the art and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
- Transmucosal administration can be carried out using nasal sprays or suppositories.
- the active compounds are formulated into ointments, salves, gels or creams as is generally known in the art.
- the compounds may also be prepared in the form of suppositories (eg, with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
- suppositories eg, with conventional suppository bases such as cocoa butter and other glycerides
- retention enemas for rectal delivery.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED 50 with little or no toxicity.
- the dosage can vary within this range depending on the dosage form used and the route of administration used.
- a therapeutically effective amount (ie effective dosage) of the composition of the present invention will depend on the circumstances of the selected patient. For example, a single dose ranging from about 1 pg to 1000 mg may be administered; In some embodiments, 10, 30, 100, or 1000 pg, or 10, 30, 100, or 1000 ng, or 10, 30, 100, or 1000 ⁇ g, or 10, 30, 100, or 1000 mg may be administered. there is.
- the dose of rhHAPLN1 protein is 0.001 to 10 mg/kg/BW, preferably 0.004 to 5 mg/kg/BW. , more preferably 0.1 to 1.0 mg/kg/BW, still more preferably 0.15 to 0.5 mg/kg/BW.
- composition may be administered.
- the pharmaceutical composition may be administered from one or more times a day to one or more times a week, including once every other day. Skilled artisans will recognize that certain factors may influence the dosage and timing required to effectively treat a subject, including the severity of the disease or disorder, previous treatments, general health and/or age of the subject, and other pre-existing factors. diseases, including but not limited to.
- treatment of a subject with a therapeutically effective amount of a molecule of the invention may include a single treatment or, preferably, may include a series of treatments.
- the dosage of the composition of the present invention is 5 mg/kg/week to 500 mg/kg/week, for example 5 mg/kg/week, 10 mg/kg/week, 15 mg/kg/week, depending on the patient's circumstances. , 20 mg/kg/week, 25 mg/kg/week, 30 mg/kg/week, 35 mg/kg/week, 40 mg/kg/week, 45 mg/kg/week, 50 mg/kg/week, 55mg/kg/week, 60mg/kg/week, 65mg/kg/week, 70mg/kg/week, 75mg/kg/week, 80mg/kg/week, 85mg/kg/week, 90mg/kg/week, 95mg/week kg/week, 100mg/kg/week, 150mg/kg/week, 200mg/kg/week, 250mg/kg/week, 300mg/kg/week, 350mg/kg/week, 400mg/kg/week, 450mg/kg/ weeks and 500 mg/kg/week.
- the dosage of the bifunctional molecule according to the present invention is 10 mg/kg/week to 200 mg/kg/week, 20 mg/kg/week to 150 mg/kg/week or 25 mg/kg/week. weeks to 100 mg/kg/week.
- a composition of the present invention is administered for 2 weeks to 6 months, for example 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks. weeks, 13 weeks, 26 weeks, 6 months, 8 months, 10 months, or 1x administration per week for longer than 1 year.
- the composition of the present invention is administered 2x times per week.
- the composition of the present invention is administered every other week.
- composition of the present invention can also be formulated as a pharmaceutical composition comprising a pharmacologically effective amount of the HAPLN1 protein molecule and a pharmaceutically acceptable carrier.
- a pharmacologically or therapeutically effective amount means an amount effective to produce the intended pharmacological, therapeutic or prophylactic result.
- the phrases "pharmacologically effective amount” and “therapeutically effective amount” or simply “effective amount” refer to an amount of a bifunctional molecule effective to produce the intended pharmacological, therapeutic or prophylactic result. For example, if a given clinical treatment is considered effective when it reduces a measurable parameter associated with a disease or disorder by at least 20%, then a therapeutically effective amount of a drug to treat that disease or disorder will reduce that parameter by at least 20%. is the amount needed to reduce
- compositions of the present invention can be administered by parenteral routes, including intravenous, intramuscular, intraperitoneal, subcutaneous, transdermal, airway (aerosol), rectal, vaginal and topical (including buccal and sublingual) administration. Administration can be by any means known in the art.
- the pharmaceutical composition is administered by intravenous or parenteral infusion or injection.
- a suitable dosage unit of the molecule is in the range of 0.001 to 0.25 mg per kilogram of body weight of the recipient per day, or in the range of 0.01 to 20 micrograms per kilogram of body weight per day, or in the range of 0.01 to 10 micrograms per kilogram of body weight per day; or in the range of 0.10 to 5 micrograms per kilogram of body weight per day, or in the range of 0.1 to 2.5 micrograms per kilogram of body weight per day.
- a pharmaceutical composition comprising the molecule may be administered once daily. However, the therapeutic agent may also be administered in dosage units containing 2, 3, 4, 5, 6 or more sub-doses administered at appropriate intervals throughout the day.
- Dosage units may also be formulated into a single dose over several days using, for example, conventional sustained release formulations that provide sustained and consistent release of the molecule over a period of several days. Sustained release formulations are well known in the art.
- the dosage unit contains multiples corresponding to the daily dosage.
- the pharmaceutical composition may be included in a kit, container, pack, or dispenser along with instructions for administration.
- treatment means to treat, cure, alleviate, alleviate, alter, relieve, ameliorate, ameliorate, or affect a disease or disorder, a symptom of a disease or disorder, or a predisposition to a disease. It is defined as the application or administration of a therapeutic agent (e.g., a molecule of the invention) to a patient, or the application or administration of a therapeutic agent to an isolated tissue or cell line, wherein the patient has a disease or disorder, a symptom of the disease or disorder, or predisposition to a disease or disorder.
- a therapeutic agent e.g., a molecule of the invention
- one aspect of the present invention relates to the use of a composition containing hyaluronan and proteoglycan link protein 1 (HAPLN1) as an active ingredient to prevent or inhibit fibrosis of cells.
- HPLN1 hyaluronan and proteoglycan link protein 1
- HPLN1 hyaluronan and proteoglycan link protein 1
- a CHO-K1 cell line producing recombinant human HAPLN1 protein was constructed by inserting a vector containing a polynucleotide encoding the human HAPLN1 protein of amino acid sequence number 1 into CHO-K1 cells.
- amino acid sequence number 1 is as follows:
- MCB Master Cell Bank
- the MCB was subcultured and inoculated into Thermo's Hyperforma SUB 250 L bioreactor at a concentration of 0.40 ⁇ 0.05 ⁇ 10 6 cells/mL, followed by fed-batch culture.
- As a basic medium 22.36 g ActiProTM medium + 0.5846 g glutamine + 10.00 g HT Supplement (Thermo Fisher Scientific) + 4.29 g 10 N NaOH + 1.80 g NaHCO 3 was used.
- the culture temperature was set at 36.5°C, dissolved oxygen (DO) at 40.0%, and pH at 7.00 ⁇ 0.20. 1 M sodium carbonate monohydrate was used as a pH control solution.
- FM020a 181.04 g HyCloneTM Cell Boost 7a + 12.28 g 10 N NaOH and 94.60 g HyCloneTM Cell Boost 7b + FM020b of 105.93 g 10 N NaOH were used.
- rhHAPLN1 recombinant human HAPLN1 (rhHAPLN1) protein from cells cultured as above (Harvest and Clarification), ultrafiltration/diafiltration 1 (UF/DF1), anion exchange chromatography, S/D (Solvent/Detergent ) Virus Inactivation, Cation Exchange Chromatography, Mixed-mode Chromatography (MMC), Hydrophobic Interaction Chromatography, Ultrafiltration/Diafiltration 2 (UF/DF2) and Medium Depth Filtration ( It was separated and purified through processes such as Intermediate Depth Filtration, Int. DF).
- the composition of the present invention was used.
- composition of the present invention containing the HAPLN1 protein
- the HAPLN1 protein purified in Preparation Example 1 was stabilized in 20 mM acetate buffer, 8% (w/v) sucrose, 0.04% (w/v) PS80, pH 5.0 to contain the HAPLN1 protein itself as the main active ingredient.
- a composition of the invention was prepared.
- composition of the present invention containing an expression vector containing the gene encoding the HAPLN1 protein
- a composition containing an expression vector containing the gene encoding the HAPLN1 protein was prepared using the jetPRIME Transfection Reagent Kit (114-15, PolyPlus). More specifically, a plasmid vector designed to express Human HAPLN1 was prepared using OriGene's RC209274 product (hereinafter referred to as "Human HAPLN1 ORF Clone"). It can express the genes it transports in the host cell's nucleus.
- the jetPRIME Transfection Reagent Kit consists of jetPRIME buffer and jetPRIME Transfection reagent. It works to infiltrate the inside.
- the human HAPLN1 ORF clone was diluted in jetPRIME buffer to prepare a composition of the present invention containing an expression vector containing a gene encoding the HAPLN1 protein.
- jetPRIME Transfection reagent is added and allowed to stand for 10 minutes so that the plasmid vector is captured in the form of a vesicle (liposome) and then dropped onto the cells in culture. After culturing the cells for more than 48 hours, an increase in human HAPLN1 gene expression was confirmed by real-time qPCR, and an increase in human HAPLN1 protein expression was confirmed by Western blot.
- composition of the present invention on skin fibrosis was verified using normal human dermal fibroblast (NHDF) as a sample.
- NHDF normal human dermal fibroblast
- Human dermal fibroblasts Normal Human Dermal Fibroblast, NHDF
- FBM-2 Fibroblast Growth Medium-2, CC-3131, Lonza
- composition of the present invention was applied to each well of the plate under conditions in which fibrosis was induced by treatment with TGF ⁇ 1 (10 ng/ml), but rhHAPLN1 protein content of 0, 3, 10, 30, and After treatment with 100 ng/ml and commercially available anti-fibrotic agent pirfenidone (Selleckchem) 100 ⁇ g/mL and 200 ⁇ g/mL, respectively, the cells were incubated for 24 hours.
- FIG. 1a it can be seen from the Western blot band photograph that the composition of the present invention exhibits a much better anti-fibrotic action than pirfenidone, considering the thickness and thickness of the ⁇ SMA protein band with respect to the degree of fibrosis of normal human dermal fibroblasts. there was.
- the expression level of ⁇ SMA was significant in all rhHAPLN1 protein content ranges when treated with the composition of the present invention, compared to when treated with a composition without rhHAPLN1 protein after inducing fibrosis with TGF1 ⁇ (10 ng/ml). showed low anti-fibrotic efficacy.
- the sample with rhHAPLN1 protein content of 100 ng/ml showed the best anti-fibrotic efficacy, which is 1/1000 of the content of pirfenidone 100 ⁇ g/mL (100,000 ng/ml). 25% higher results.
- pirfenidone since the expression level of ⁇ SMA is higher at 200 ⁇ g/mL than at 100 ⁇ g/mL, it can be assumed that the anti-fibrotic efficacy at high concentration is rather low and 100 ⁇ g/mL is the optimal anti-fibrotic concentration. Then, it was found that the composition of the present invention has much better antifibrotic efficacy than pirfenidone, a commercially available antifibrotic agent.
- composition of the present invention on liver fibrosis was verified using human hepatic stellate cells (HHSC) as a sample.
- HHSC human hepatic stellate cells
- each well of the plate was treated with the composition of the present invention with rhHAPLN1 protein content of 0, 3, 10, 30, and 100 ng/ml and pirfenidone 100 ⁇ g/mL and 200 ⁇ g/mL, respectively, for 24 hours incubated.
- each sample was treated with a cell lysis buffer and harvested.
- samples with a rhHAPLN1 protein content of 3 ng/ml showed the best anti-fibrotic efficacy, which was demonstrated by pirfenidone 100 ⁇ g/mL (100000 ng/ml) as well as pirfenidone 200 ⁇ g/mL (200000 ng/ml), despite the content being 3/200000, the anti-fibrotic efficacy showed much higher results.
- composition of the present invention on intestinal fibrosis was verified using human colon fibroblast cell line (CCD-18Co) as a sample.
- human colon fibroblast cell line (CCD-18Co (human colon fibroblast cell line; ATCC, CRL-1459)) was seeded in a 6-well plate (1.5 X 10 5 cells/well). ) and EMEM (Eagle's minimum essential medium, ATCC) medium containing 10% fetal bovine serum (FBS) was incubated for 24 hours in an incubator at 37°C and 5% CO 2 condition.
- CCD-18Co human colon fibroblast cell line
- ATCC human colon fibroblast cell line
- CRL-1459 human colon fibroblast cell line
- FBS fetal bovine serum
- each well of the plate was treated with the composition of the present invention with rhHAPLN1 protein content of 0, 3, 10, 30, and 100 ng/ml and pirfenidone 100 ⁇ g/mL and 200 ⁇ g/mL, respectively, for 24 hours incubated.
- Figure 3b shows that the composition of the present invention exhibits much better anti-fibrotic activity than pirfenidone in all rhHAPLN1 protein content ranges, as seen from the thickness and thickness of the ⁇ SMA protein band with respect to the degree of fibrosis of human colonic fibroblasts. Western blot This could be confirmed from the band photos.
- myofibroblasts (myofibroblasts) were significantly reduced in all rhHAPLN1 protein content ranges when treated with the composition of the present invention, compared to the case where fibrosis was induced with TGF ⁇ 1 (10 ng/ml) and then treated with a composition that did not contain rhHAPLN1 protein. )
- the expression level of ⁇ SMA as a marker was low, showing anti-fibrotic efficacy.
- intestinal fibrosis myofibroblasts are transformed into myofibroblasts to produce excessive fibrous tissue.
- samples with rhHAPLN1 protein content of 10 ng/ml showed the best anti-fibrotic efficacy, which was induced by TGF ⁇ 1 even though the content was 1/10000 of that of pirfenidone 100 ⁇ g/mL (100,000 ng/ml).
- the antifibrotic efficacy is about 7 times higher when comparing the efficacy of drugs, and the antifibrotic efficacy is much higher than 2 times even though the content is 1/20000 of pirfenidone 200 ⁇ g/mL (200000 ng/ml) .
- pirfenidone since the expression level of ⁇ SMA is higher at 200 ⁇ g/mL than at 100 ⁇ g/mL, it can be assumed that the anti-fibrotic efficacy at high concentrations is rather low, and that 100 ⁇ g/mL is the optimal anti-fibrotic concentration of pirfenidone. Then, it can be seen that the composition of the present invention has excellent antifibrotic efficacy compared to pirfenidone, which is a commercially available antifibrotic agent.
- HCMEC human cardiac microvascular endothelial cells
- HCMEC human cardiac microvascular endothelial cells
- ScienCell #6000
- each well of the plate was treated with the composition of the present invention with rhHAPLN1 protein content of 0, 3, 10, 30, and 100 ng/ml and pirfenidone 100 ⁇ g/mL and 200 ⁇ g/mL, respectively, for 2 days incubated.
- each sample was treated with a cell lysis buffer and harvested.
- Figure 4b shows that the composition of the present invention exhibits much better anti-fibrotic activity than pirfenidone in all rhHAPLN1 protein content ranges, in terms of the thickness and thickness of the ⁇ SMA protein band for the degree of fibrosis of human cardiac microvascular endothelial cells. It could be confirmed from the Western blot band picture.
- myofibroblasts (myofibroblasts) were significantly reduced in all rhHAPLN1 protein content ranges when treated with the composition of the present invention, compared to when fibrosis was induced with TGF ⁇ 1 (5 ng/ml) and then treated with a composition not containing rhHAPLN1 protein. )
- the expression level of ⁇ SMA as a marker was low, showing anti-fibrotic efficacy.
- endothelial cells are transformed into myofibroblasts to produce excessive fibrous tissue.
- compositions of the present invention a sample with a rhHAPLN1 protein content of 3 ng/ml showed the best anti-fibrotic efficacy, which was 3/100,000 higher than that of 100 ⁇ g/mL (100,000 ng/ml) of pirfenidone.
- An antifibrotic effect that was not shown was shown, and an antifibrotic effect that was not shown in pirfenidone was shown despite the content of 3/200000 of pirfenidone 200 ⁇ g/mL (200000 ng/ml).
- composition of the present invention can be an almost unique antifibrotic agent, at least for cardiac microvascular endothelial cells.
- composition of the present invention on pulmonary fibrosis was verified using normal human lung fibroblast (NHLF) as a sample.
- NHLF normal human lung fibroblast
- NHLF normal human lung fibroblasts
- composition of the present invention was administered to each well of the plate under conditions in which fibrosis was induced by treatment with TGF ⁇ 1 (10 ng/ml), rhHAPLN1 protein content of 0, 3.1, 12.5, 25, and 100 ng/ml and Pirfeni.
- Pigs (Selleckchem) were treated with 100 ⁇ g/mL and 200 ⁇ g/mL, respectively, and then incubated for 24 hours.
- Figure 5a shows that the composition of the present invention exhibits a much better anti-fibrotic action than pirfenidone in all rhHAPLN1 protein content ranges, as seen from the thickness and thickness of the ⁇ SMA protein band for the degree of fibrosis of normal human lung fibroblasts. Western It could be confirmed from the blot band picture.
- myofibroblasts (myofibroblasts) were significantly reduced in all rhHAPLN1 protein content ranges when treated with the composition of the present invention, compared to when fibrosis was induced with TGF ⁇ 1 (10 ng/ml) and then treated with a composition without rhHAPLN1 protein.
- the expression level of ⁇ SMA as a marker was low, showing anti-fibrotic efficacy.
- the sample with rhHAPLN1 protein content of 12.5 ng/ml showed the best anti-fibrotic efficacy, which is 1/10,000 higher than that of pirfenidone 100 ⁇ g/mL (100,000 ng/ml). It is about 2 times higher, and it was also about 2 times higher for pirfenidone 200 ⁇ g/mL (200000 ng/ml).
- pirfenidone has no antifibrotic effect, at least in lung fibroblasts, since there is almost no difference in the expression level of ⁇ SMA compared to the case of treatment with a composition not containing rhHAPLN1 protein even when treated at any concentration.
- the composition of the present invention can be an almost unique anti-fibrotic agent for lung fibroblasts.
- the fibrosis preventive action of the composition of the present invention on renal fibrosis was verified using an epithelial cell line of human kidney renal tubular cells (Human Kidney 2, HK-2) as a sample.
- TGF ⁇ 1 (5 ng/ml) and the composition of the present invention (rhHAPLN1 protein content of 0, 5, 10, 20, and 50 ng/ml) and pirfenidone 0.2 were added to each well of the plate. They were treated simultaneously with mg/mL (200 ⁇ g/mL) and then incubated for 24 hours.
- the primary antibody was diluted 1:1000 in 1% BSA-TBST and reacted overnight at 4°C.
- the secondary antibody was diluted 1:2000 in 1% BSA-TBST (Bovine Serum Albumin-Tris-Buffered Saline & Polysorbate 20), dispensed, and shaken for about 1 hour at room temperature.
- BSA-TBST Bovine Serum Albumin-Tris-Buffered Saline & Polysorbate 20
- the composition of the present invention is superior to pirfenidone in a specific rhHAPLN1 protein content range (rhHAPLN1 protein content of 50 ng/ml) in terms of the thickness and thickness of the ⁇ SMA protein band for the degree of fibrosis of human renal tubular cells. It was confirmed from the Western blot band picture that the fibrosis preventive action was exhibited.
- composition of the present invention on renal fibrosis was verified using an epithelial cell line of human renal tubular cells (Human Kidney 2, HK-2) as a sample.
- human renal tubular cells (HK-2) were seeded (2.8 X 10 5 cells/well) in a 60-well plate, and RPMI 1640 Medium (11875 -093, Gibco) in an incubator at 37° C. 5% CO 2 conditions for 24 hours.
- composition of the present invention rhHAPLN1 protein content of 0, 5, 10, 20, and 50 ng/ml
- 0.2 mg/mL (200 ⁇ g/mL) of pirfenidone were incubated for 48 hours.
- the secondary antibody was diluted 1:2000 in 1% BSA-TBST and shaken for about 1 hour at room temperature.
- the composition of the present invention has an anti-fibrotic activity in a specific rhHAPLN1 protein content range (rhHAPLN1 protein content of 10 to 50 ng / ml), considering the thickness and thickness of the ⁇ SMA protein band for the degree of fibrosis of human renal tubular cells. It could be confirmed from the Western blot band picture.
- the composition of the present invention when fibrosis was induced with TGF- ⁇ (10 ng/ml) and then treated with a composition without rhHAPLN1 protein, the composition of the present invention was treated with rhHAPLN1 protein content of 10 to 50 ng/ml. , especially when treated with rhHAPLN1 protein content of 50 ng/ml, it showed excellent antifibrotic efficacy. It is quite noteworthy that the treatment with 50 ng/ml of the composition of the present invention showed antifibrotic efficacy almost equivalent to that of pirfenidone, even though the amount was 1/4 smaller than 0.2 mg/ml of pirfenidone, that is, 200 ng/ml. .
- composition of the present invention on renal fibrosis was verified by observing changes in cell morphology using an epithelial cell line of human kidney renal tubular cells (Human Kidney 2, HK-2) as a sample.
- Human kidney renal tubular cells (HK-2) were seeded (3.0 X 10 5 cells/well) in a 6-well plate according to the experimental plan of FIG. 8a and supplemented with 10% FBS in RPMI 1640 Medium (11875 -093, Gibco) in an incubator at 37° C. 5% CO 2 conditions for 24 hours.
- composition of the present invention (rhHAPLN1 protein content of 0, 5, 10, 20, 50 and 100 ng/ml) and pirfenidone 0.2 mg/mL (200 ⁇ g/mL) were respectively treated and incubated for 24 hours. .
- the shape of the cell is shown in various ways depending on the treated material.
- the control group which is a normal cell without any treatment
- the cell shape was round, but it was confirmed that the round cell shape changed to a fibrotic form by 10ng/ml TGF ⁇ 1 treatment.
- composition of the present invention having various rhHAPLN1 protein contents was added thereto, the shape of the cells was changed to round as in the case of pirfenidone.
- composition of the present invention clearly exhibited excellent anti-fibrotic efficacy against cells.
- the antifibrotic activity of the composition of the present invention against renal fibrosis due to aging induction was verified using primary epithelial cells of renal proximal tubule epithelial cells (RPTEC) as samples.
- RPTEC renal proximal tubule epithelial cells
- Renal proximal tubular epithelial cells (RPTEC) of passage 3 and passage 10 were seeded (5.0 X 10 5 cells) in a 60 ⁇ culture dish, and complete Renal Epithelial Cell Medium (ATCC PCS-400-030+ATCC PCS-400-040) in an incubator at 37°C and 5% CO 2 conditions for 24 hours.
- RPTEC Renal proximal tubular epithelial cells
- each well was treated with 300 ⁇ l of RIPA Lysis and Extraction Buffer containing a protease inhibitor and a phosphatase inhibitor, and the cells were recovered by scraping with a scraper and transferred to an E-tube.
- the antifibrotic activity of the composition of the present invention against renal fibrosis due to aging induction was verified using primary epithelial cells of renal proximal tubule epithelial cells (RPTEC) as samples.
- RPTEC renal proximal tubule epithelial cells
- Renal proximal tubular epithelial cells (RPTEC) of 3 and 10 passages were seeded (1.5 X 10 5 cells) in a 12-well plate, and complete Renal Epithelial Cell Medium (ATCC PCS-400-030+ATCC PCS-400-040) in an incubator at 37°C and 5% CO 2 conditions for 24 hours.
- the composition of the present invention is It can be seen that it exhibited excellent antifibrotic efficacy compared to conventional antifibrotic agents.
- composition of the present invention on pulmonary fibrosis and renal fibrosis was verified by examining the expression levels of various fibrosis markers using the BioMAP Fibrosis Panel (provided by Eurofins discovery).
- the BioMAP Fibrosis panel consists of three models: SAEMyoF system (co-culturing small airway epithelial cells and adult fibroblasts), REMyoF system (co-culture of renal proximal tubule epithelial cells and adult fibroblasts), and MyoF system (differentiated lung myofibroblasts).
- SAEMyoF system represents interstitial lung diseases (IDL) including pulmonary fibrotic diseases such as idiopathic pulmonary fibrosis (IPF), and the REMyoF system represents end-stage renal disease (end-stage renal disease). It represents kidney fibrosis disease associated with stage renal failure.
- IDL interstitial lung diseases
- IPF pulmonary fibrotic diseases
- REMyoF system represents end-stage renal disease (end-stage renal disease). It represents kidney fibrosis disease associated with stage renal failure.
- experiments were conducted to determine the effect of the MyoF system only on myofibroblasts.
- peripheral blood mononuclear cells peripheral blood mononuclear cells
- composition of the present invention (rhHAPLN1 protein content of 0, 3.7, 11, and 33 ng/ml) was treated at each concentration and incubated for 1 hour.
- the composition of the present invention (rhHAPLN1) had a significant reducing effect on ⁇ SMA and collagen I in the SAEMyoF system, which is a pulmonary fibrosis disease model (FIG. 11a). That is, in the case of ⁇ SMA, it was confirmed that the treatment with the composition of the present invention consistently reduced the expression of ⁇ SMA by 0.9 times or less, regardless of the content of rhHAPLN1 protein in the composition, compared to the treatment with the composition not containing the rhHAPLN1 protein.
- the composition of the present invention (rhHAPLN1) had a significant reducing effect on collagen IV (FIG. 11c). That is, it was confirmed that the treatment with the composition of the present invention reduced the expression level of collagen I to 0.8 times or less in proportion to the content of rhHAPLN1 protein in the composition, compared to the treatment with the composition not containing the rhHAPLN1 protein. Therefore, when the content of rhHAPLN1 protein in the composition was 33 ng/ml, the expression level of collagen IV was reduced by 0.7 times.
- mice 8-week-old female C57BL/6N (KBSI, Daejeon City, Korea) mice were used, and a normal control group (Normal, PBS) and two dose groups (composition of the present invention containing rhHAPLN1 protein) were set. Water was exchanged every two days and allowed to eat freely. Four mice were placed in one cage, and the temperature in the breeding room was maintained at 21 to 24 ° C and the humidity was maintained at 40% to 60%, and the day and night cycles were each 12 hours. .
- KBSI normal, PBS
- two dose groups composition of the present invention containing rhHAPLN1 protein
- PF pulmonary fibrosis
- idiopathic pulmonary fibrosis (IPF) was performed using a 1ml-syringe and an oral needle (Oral Zonde Needle 0.9x50mm; 20Guage). After anesthesia, 25 ⁇ l once orally intratracheal at a concentration of 2 U/kg was carefully administered (instillation), followed by fresh 10 ml phosphate-buffered saline (1X PBS, pH 7.4, Gibco Co.) was added dropwise to a nebulizer to nebulize and inhale freely.
- Control was 50 ⁇ l of a stock solution composed of 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol and 10 ml PBS (1X, pH 7.4, Gibco Co.
- rhHAPLN1 stock solution 50 ⁇ l rhHAPLN1 weight ratio concentration 0.0005% (w / w), that is, 5000ng / mL, and 0.0015% (w / w), that is, 15000ng
- each was mixed in 10 ml PBS (1X, pH 7.4, Gibco Co.), and administered in groups for 1 hour once a day in a nebulization manner through the above nebulizer. .
- the weight of each experimental animal was measured every 2 days to confirm that there was no change in weight, and a Mass Dosing System and Aerosol Chamber (Data Science International Co.) were used for mist generation.
- the total experimental period was 12 days, and recombinant HAPLN1 protein administration at each concentration was administered 10 times daily for 1 hour for 10 days, and dissection was performed after anesthesia on the 11th day.
- Figure 12b is a photograph of the left large lobe after lung tissue was removed, cut in half horizontally, and the upper part was fixed in formalin and stained with hematoxylin and eosin (H&E). It can be seen from the photograph that when the composition of the present invention is administered compared to the control group, in particular, in the case of rhHAPLN1 weight ratio concentration of 0.0015% (w/w), it shows a very similar form to the normal group.
- H&E hematoxylin and eosin
- the middle part of the left large lobe of the mouse was cut to make 3 tissue slides per mouse, and 3 pictures were taken at random on each slide, and then, for a total of 9 parts, the stained red part and the unstained white part were distinguished, The average value per animal was obtained by averaging each value obtained by measuring the area of the stained red part using Image J software.
- the red part represents the part where fibrosis has progressed.
- FIG. 12c which shows these average values as a graph
- the composition of the present invention when the composition of the present invention was administered compared to the control group, in particular, in the case of rhHAPLN1 weight ratio concentration of 0.0015% (w/w), the average value of the area of the red part was reduced to be considerably close to the normal group. Able to know. That is, it was confirmed that the composition of the present invention exhibits a preventive effect against pulmonary fibrosis in vivo.
- 12d and 12e are photographs and descriptions (Ashcroft et al 1988, J Clin Pathol 41:467-470) explaining official guidelines that can simply measure the severity of pulmonary fibrosis with the naked eye.
- the grade of fibrosis can be divided by the Ashcroft score as follows:
- Score 1 isolated soft fibrosis change (diaphragm thickness less than or equal to 3 times normal), alveoli partially enlarged, sparse, but no fibrotic mass (lump).
- Score 2 Clear fibrotic change (diaphragm thickness greater than 3 times normal), alveoli are partially enlarged and sparse, but no fibrotic mass is observed.
- Score 4 Changes in structure, single fibrous mass less than or equal to 10% of the microscopic area.
- Score 5 Structural changes, confluent fibrous masses (greater than 10% and less than or equal to 50% of the microscopic area), lung structures severely damaged but still retaining morphology.
- each of the three observers judged and scored individually under the condition that they were not affected by the evaluation of others with the same data, and then combined the results to determine the final average score. Results of each rater were very similar and the results of a double representative observer are shown in FIG. 12f.
- PF pulmonary fibrosis
- idiopathic pulmonary fibrosis (IPF) was performed using a 1ml-syringe and an oral needle (Oral Zonde Needle 0.9x50mm; 20Guage). After anesthesia, 20 ⁇ l per mouse at a concentration of 50 U/kg was administered orally intratracheal once (instillation), followed by fresh 10 ml phosphate-buffered saline (1X PBS, pH 7.4, Gibco Co.) was added dropwise to a nebulizer to nebulize and inhale freely.
- the control was 50 ⁇ l of a stock solution composed of 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol and 10 ml PBS (1X, pH 7.4, Gibco Co. ) was used as a mixture of solutions.
- the rhHAPLN1 stock solution (20 mM acetate, pH 5.0, 8.0 M sucrose, 0.04% PS80) was diluted with phosphate buffered saline (PBS) to obtain a rhHAPLN1 weight ratio concentration of 0.00075% (w /w), i.e.
- the total experimental period was 23 days, and 10 ml of recombinant human HAPLN1 protein at each concentration was administered 14 times a day for 1 hour each time for 14 days, and dissection was performed after anesthesia the day after the final exposure.
- Figure 13b is a photograph of the left large lobe after lung tissue was removed, cut in half horizontally, and the upper part was fixed in formalin and stained with hematoxylin and eosin (H&E). From the photograph, it can be seen that when the composition of the present invention is administered compared to the control group, especially in the case of rhHAPLN1 weight ratio concentration of 0.0015% (w/w), it also shows a very similar form to the normal group.
- H&E hematoxylin and eosin
- the middle part of the left large lobe of the mouse was cut to make 3 tissue slides per mouse, and 3 pictures were taken at random from each slide, and then, for a total of 9 parts, the red part that was stained and the white part that was not stained were distinguished, and Image Each value obtained by measuring the area of the stained red part using J software was averaged to obtain an average value per animal.
- the red part represents the part where fibrosis has progressed.
- FIG. 13c which shows these average values as a graph
- the composition of the present invention when the composition of the present invention was administered compared to the control group, especially in the case of rhHAPLN1 weight ratio concentration of 0.0015% (w/w), the area of the red part was compared to that of untreated lung fibrosis. It can be seen that the average value is reduced by 51%. That is, it was confirmed that the composition of the present invention exhibits an excellent therapeutic effect on pulmonary fibrosis in vivo. This is also graphed in FIG. 13D. *** p ⁇ 0.001, calculated by Student's t-test.
- mice After 1 day of ischemia, blood urea nitrogen (BUN) was measured, and only mice whose value rose to about 98 mg/dL (to be specified as 100 mg/dL in the future) or higher were grouped into experimental groups and the experiment was conducted.
- BUN blood urea nitrogen
- mice To the experimental groups, various drugs including the composition of the present invention were administered daily from the 7th day after surgery, and the kidneys were taken on the 14th day and used for histological and biochemical analysis. The drug concentration is shown in Table 1, and the details of the experimental groups are shown in Table 2.
- composition rhHAPLN1 (0.2 ⁇ g/ ⁇ l) rhHAPLN1 buffer PBS rhHAPLN1 dose A (0.1mg/kg B.W.) 12.5 ⁇ l 0 ⁇ l 187.5 ⁇ l rhHAPLN1 dose B (0.02mg/kg B.W) 2.5 ⁇ l 10 ⁇ l 187.5 ⁇ l rhHAPLN1 dose C (0.004mg/kg B.W) 0.5 ⁇ l 12 ⁇ l 187.5 ⁇ l rhHAPLN1 buffer (Vehicle) 0 ⁇ l 12.5 ⁇ l 187.5 ⁇ l Pirfenidone (300mg/kg B.W.)
- Biochemical analysis evaluation of expression of fibrosis markers: To determine the expression level of ⁇ SMA in kidney tissue, Western blot was performed using antibodies against these.
- SV sham-vehicle, SB; sham-rhHAPLN1-dissolving solution, IRV; IR-vehicle, IRP; IR-pirfenidone, IRA; IR-composition of the present invention (rhHAPLN1) A, IRB; IR-composition of the present invention (rhHAPLN1) B, IRC; IR-represents the composition (rhHAPLN1) C of the present invention, respectively, and more details are as shown in Tables 1 and 2 above. More specifically, the Sham-vehicle group was IP injected by diluting only the rhHAPLNB1-free buffer in PBS in the Sham control group.
- Sham-rhHAPLN1-dissolving solution is a group that was IP injected by diluting rhHAPLN1 concentration B (0.02mg/kg) to check the effect of rhHAPLN1 on normal conditions.
- IR-vehicle is a buffer-treated group without rhHAPLN1 in the I/R fibrosis induction model.
- IR-pirfenidone was a group in which 300 mg/kg of pirfenidone was orally administered after induction of I/R fibrosis.
- ⁇ SMA which is an indicator of fibrosis in the kidney, was significantly higher in cases of ischemia/reperfusion compared to control operations (sham-operation, SV and SB).
- ⁇ SMA in the groups (IRA and IRB) administered with the composition (rhHAPLN1) of the present invention showed a low level similar to that of pirfenidone compared to the control drug-treated group (IRV).
- IRC is considered to be high enough to be equivalent to IRV because the concentration is extremely low.
- SV sham-vehicle, SB; sham-rhHAPLN1-dissolving solution, IRV; IR-vehicle, IRP; IR-pirfenidone, IRA; IR-composition of the present invention (rhHAPLN1) concentration 0.1 mg/kg, IRB; IR-composition of the present invention (rhHAPLN1) concentration 0.02mg/kg, IRC; IR-represents the composition of the present invention (rhHAPLN1) at a concentration of 0.004 mg/kg, respectively.
- blood for this use was taken through the retroorbital vein plexus with heparinized glass capillaries, and urine was obtained using a metabolic cage.
- Blood urea nitrogen and creatinine (plasma creatinine, PCr) concentrations were measured using Vitros250 (Johnson & Johnson).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Marine Sciences & Fisheries (AREA)
- Zoology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
본 발명은 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1) 또는 이를 코딩하는 유전자를 유효성분으로 포함하는 섬유성 질환의 예방 또는 치료용 약학적 조성물 및 상기 조성물을 이용한 섬유성 질환의 예방 또는 치료 방법을 개시한다. 본 발명에 의하면 세포 내지 조직의 섬유화를 예방 및 억제함으로써 섬유화에 기인하여 유발되는 각종 질환의 발생 또는 진행을 근본적으로 억제하게 되어 해당 질환을 예방 내지 치료할 수 있다.
Description
본 발명은 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1) 또는 이를 코딩하는 유전자를 유효성분으로 포함하는 섬유화로 인한 각종 조직 손상의 수리, 섬유성 질환의 예방 또는 치료용 조성물에 관한 것이다. 구체적으로, 본 발명은 HAPLN1을 유효성분으로 함유하는 조직의 섬유화, 이에 따른 손상의 수리 및 재생용 조성물에 관한 것이다. 또한, 본 발명은 섬유화로 인한 각종 조직 손상과 기능 상실의 수리와 회복, 그리고 섬유성 질환을 포함하는 노화성·퇴행성 질환의 예방 또는 치료용 조성물에 관한 것이다.
나아가 본 발명은 섬유성 질환의 예방 또는 치료용 조성물 및 상기 조성물을 이용한 세포의 섬유화를 예방 또는 억제하는 방법을 개시한다. 본 발명에 의하면 세포의 섬유화를 예방 및 억제함으로써 세포의 섬유화가 개입하여 유발되는 각종 질환의 발생 또는 진행을 근본적으로 억제할 뿐만 아니라 치료할 수 있는 가능성을 제시한다.
폐가 돌처럼 굳는 '폐섬유화증(Lung Fibrosis)'의 의학적 정의는 건강한 폐조직이 어떤 원인에 의해 상흔(scar) 조직으로 바뀌어 폐조직이 두꺼워지거나 딱딱해지는 상태의 질병을 말한다. 우리나라에서 발생했던 가습기 살균제 사건에서와 같이 가습기 내 살균 작용을 유지하기 위해 사용한 특정 유해 화학물질이라는 그 원인이 명확히 알려져 있기도 하지만, 원인도 명확히 모른 채 폐가 굳어버리는 질환이 바로 '특발성폐섬유화증(IPF, Idiopathic Pulmonary Fibrosis)'이다. 이러한 질병은 조직학적으로 폐실질의 염증과 섬유화가 특징인 '통상성의 간질성 폐렴'(Usual Interstitial Pneumonia, UIP) 증상을 보이는 일종의 간질성폐질환(Interstitial Lung Disease, ILD)이며, 고령(aging), 흡연, 위식도역류질환, 환경성·직업성 노출, 분진 작업, 방사능 노출, 자가면역성, 약물중독성, 과민성 폐렴, 바이러스·병원균 감염, 가족력 등 다양한 위험인자들이 알려져 있다. 다만 최근 발달된 의학적 기술과 과학자들의 노력에도 불구하고, 이 질병의 병인은 명확히 밝혀져 있지 않다. 평균 발병 나이는 69세로 고령에서 주로 발생하며, 남성이 여성보다 2배 이상 많고 예후도 나쁘다. 대표적인 폐섬유화증인 ‘특발성폐섬유화증'의 경우 국내 환자 수는 10만명 당 1.7명으로 원인이 밝혀지지 않은 만큼, 치료도 어려워 매우 무서운 질환이다. 평균 생존 기간은 60개월이지만, 1년에 환자 14%에게서 감염(infection) 등에 의한 급성 악화(exacerbation)가 발생한다. 급성 악화가 오면 생존 기간은 15개월로 급격히 떨어진다.
폐섬유화증 환자는 폐포벽이 상흔(scar) 조직으로 두꺼워져 있으며, 이러한 상흔조직은 점점 악화되면서 폐실질 조직이 파괴된다. 이 때 특히 공기를 들여 마시는 흡기가 어려워져 혈액에 산소를 공급할 만큼의 충분한 공기를 마실 수 없게 된다. 결국에는 폐포(alveoli)가 원래의 기능을 할 수 없게 되고 가쁜 호흡, 잦은 마른 기침, 피곤증, 손끝과 발가락에 곤봉형의 특징적인 변화가 나타나며 3대 증상으로 기침, 운동성 호흡곤란, 가래로 인한 수포음(Crackle)이 유발된다. 최근 펜데믹으로 유행하고 있는 코로나-19 바이러스 역시 폐에 감염, 염증이 생기면 낫는 과정에서 폐섬유화가 발생하기도 한다.
가장 잘 알려진 섬유화증의 위험 요인은 고령(高齡, aging)이다. 특히 폐조직 병변을 탐구해온 연구자들은 폐섬유화증 환자들의 폐 세포가 세포노화(cellular senescence)의 징후인 분열과 성장을 지속할 수 없다는 사실을 최근 밝혀냈다. 세포노화 이론으로 사람을 포함한 유기체가 노화되는 것은 생리적으로 유용하지 않고 오히려 병리적 상태를 촉진하는 노화세포가 축적되기 때문으로 보고 있으며, 노화는 세포가 세포주기정지(cell cycle arrest)로 불리는 일련의 과정에 들어가 더 이상 정상적인 속도로 세포를 분열시키고 생산하지 않는 현상이다. 최근 보고에 따르면, 노인성 폐증(elderly pneumonia)에 있어서 섬유화증에 대한 세포노화 영향에 대해 체계적으로 잘 설명하고 있다(Yanagi 2017, Int. J. Mol. Sci. 18, 503).
흡연 또는 나이를 먹으면서 발생하는 세포 내 DNA 손상과 염색체 '끝분절 마모', 즉 텔로미어 단축(telomere attrition)은 고령에 따른 면역노화(immunosenescence) 현상과 함께 진행되면서 체내 존재하는 노화세포를 제거하는데 한계가 있을 뿐 아니라 세포가 더 이상 증식을 포기하며 수적인 증가에 실패(cell growth arrest)하면서 대신 세포 외로 인터루킨 1 베타(IL-1β) 등 SASP(senescence-associated secretory phenotype)라는 염증·노화 유도성 물질을 분비함으로써 주위의 정상세포까지 영향을 주게 되어 노화세포로 바뀐다. 이에 점점 노화세포의 수가 증가하면서 더 많은 SASP를 분비하고 이에 따라 저수준의 염증(chronic low-grade inflammation)을 동반하는 병리적 상태에 이르면서 조직 재생과 수복 능력은 자연히 점차 감소하게 되고 급기야 정상적인 폐조직 구조가 파괴되기 시작하며, 특히 고령자의 경우 그들이 가지는 다양한 합병 요인들이 추가되면서 결국 다양한 외부 병인 공격에 대한 저항성이 떨어져서(high vulnerability) 초기적으로 발생하고 있던 섬유화증은 더욱더 발전·악화된다는 것이다.
즉, 본 발명자들은 상기한 바와 같이 폐섬유화증의 위험 요인이 고령이라는 점에 주목하고, 본 질환의 발병을 예방하거나 치료할 수 있는 '혈액 중 내인성 물질'을 발굴하고자 젊은 및 노령 마우스 간 병체결합(heterochronic parabiosis) 및 프로테오믹스 기술을 이용한 정성·정량 분석 기법을 통해 탐색하던 중, 히알루론산(hyaluronan, HA)과 프로테오글리칸(proteoglycan) 연결 단백질(hyaluronan and proteoglycan link protein1; HAPLN1)을 가장 가능성 있는 물질로 주목하게 되었다. 여러 문헌에 따르면, HAPLN1 단백질은 척추동물의 연골(cartilage)에서 처음 발견된 세포외기질(ECM; extracellular matrix) 내의 구성 단백질의 하나로 히알루론산과 프로테오글리칸의 구조적 응집체(aggregate)를 안정화시키는 역할은 물론, 이때 결합되는 프로테오글리칸들 간의 간격을 매우 밀집하여 결합하도록 하는 역할을 함으로써 병브러쉬(bottle-brush) 모양을 만들도록 하는 마치 경첩(hinge) 역할을 한다고 보고되어 있다. 본 발명자들은 재조합 인간 단백질 HAPLN1(recombinant human HAPLN1; rhHAPLN1)이 그 경첩형 링크 기능을 통해 실제로 그 파트너 분자인 high molecular weight HA(HMW HA)와 aggrecan(proteoglycan의 일종)의 분해를 억제함으로써 손상연관분자모형(DAMPs, damage-associated molecular patterns) 물질로서 low molecular weight HA(LMW HA) 또는 32-mer peptide의 생성을 감소시킬 수 있음을 증명한 바 있다.
근섬유아세포(myofibroblast)는 섬유성 질환에서 콜라겐 등의 섬유조직을 과다하게 형성하는 주요 세포이다. 이런 근섬유아세포는 특징적으로 α smooth muscle actin(αSMA)의 발현을 나타내며, 따라서 αSMA 발현 정도는 근섬유아세포의 발현 정도를 알 수 있는 중요 지표가 된다. 실제로 특발성폐섬유화증, 신장섬유화증 등 다양한 섬유성 질환에서 αSMA를 발현하는 근섬유아세포가 증가해 있으며, in vivo 섬유화 모델에서 역시 αSMA 발현의 증가가 보고되어 있다. 이러한 근섬유아세포는 주로 섬유아세포(fibroblast)에서 유래하며, 그 외에 내피세포(endothelial cell), 상피세포(epithelial cell), 줄기세포(stem cell) 등에서도 유래하는 것으로 보고되고 있다(The American Journal of Pathology,. 2007. 170(6): 1807-1816). 간섬유화의 경우엔 간성상세포(stellate cell)가 활성화되어 콜라겐 등의 섬유조직을 과다하게 형성하는 역할을 하며, 간성상세포의 활성화시에도 αSMA 발현이 증가하여 이를 간성상세포의 활성화 지표로 삼고 있다(Cells 2019, 8(11), 1419).
근섬유아세포의 분화(혹은 간성상세포의 활성화) 유도 인자로 가장 잘 알려진 인자는 TGFβ1이며, 이 외에도 딱딱한(stiff) 환경의 mechanical stress가 근섬유아세포의 분화요인으로 보고되어 있다(The American Journal of Pathology,. 2007. 170(6): 1807-1816). 따라서, 다양한 세포에서 TGFβ1에 의해 αSMA 발현을 유도하는 것을 in vitro 섬유화 모델로 사용하고 있으며, 유도된 αSMA 발현을 감소시키는 활성에 대해 항섬유화 효능으로 판단하고 있다(Molecular Medicine 2021 27:22).
폐섬유화증에 대한 유효성을 증명하기 위해 현재까지 다양한 동물모델이 수립되어 있지만, 가장 널리 공인되어 사용되고 있는 모델은 '흡입 블레오마이신(Bleomycin, BL) 유도 폐섬유증(Bleomycin-induced Pulmonary Fibrosis, BIPF) 마우스 모델'이다. 원래 블레오마이신은 항암제로 또는 사마귀 치료로 사용하여 왔으나, 1998년 데이비스 캘리포니아대 수의대 Giri 교수 연구팀이 수립한 3회 기관지 흡입 햄스터 모델(a three-dose bleomycin (BL)-hamster model)(Iyer 1998), 2008년 Oku 등이 수립한 블레오마이신 마우스 정맥 1일 1회 5일간 연속 투여하는 모델(Oku 2008, European Journal of Pharmacology 590;400-408), 그리고, 최근 Song 등 (EXPERIMENTAL AND THERAPEUTIC MEDICINE 16: 1800-1806, 2018)은 랫트 모델에서 블레오마이신을 1회 기관지 경로로 투여한 바로 다음 날부터 허가된 약물인 pirfenidone (PFD)을 하루 1회 경구로 14회 또는 28회 투여하는 모델을 수립하여 성공적으로 폐섬유증을 유발시키고 해당 약물의 효능과 함께 몇몇 기전을 연구하였다. 그 결과 14일, 28일 그룹에서 블레오마이신에 의해 증가하였던 periostin과 TGFβ1의 레벨이 감소하였음을 보고하고 있다 (Song 2018).
실제로 이러한 IPF 마우스 모델을 이용하여 유일하게 판매허가를 받은 IPF 치료제는 현재 단 2종뿐인데, 그 중 하나인 pirfenidone(PFD; 상품명 Pirespa)은 시오노기 제약회사(Shionogi & Co., Ltd.)가 일본에서 최초로 2008년, 이어서 유럽연합에서 2011년, 캐나다에서 2012년, 미국에서 2014년 각각 허가 승인이 이루어졌다. 또 다른 하나인 닌테다닙(nintedanib)은 상품명 Ofev 또는 Vargatef로서 최근 2020년 3월 미국에서 허가 받은 폐섬유화증 치료제이다. Pirfenidone (PFD)을 개발한 Oku 등(Oku 2008)에 의하면 마우스에 블레오마이신을 매일 연속 5회 정맥 투여(intravenous injection, IV)하면 투여 개시 10일쯤에 염증 반응(inflammation)이 최고조에 달한 후 점차 염증 반응은 줄어들며, 투여 개시 후 약 8 ~ 9일부터는 섬유화(fibrosis)가 점차 진행됨을 밝혔다.
보다 구체적으로 상기 연구팀은 후보약물인 pirfenidone의 폐섬유화증 효능을 보기 위해서는 블레오마이신 첫번째 투여한 날(day 0) 바로 다음날(day 1)부터 10일 또는 28일 간 매일 3회 각각 투여한 후 그 치료 효능을 각각 살펴보았다. Oku 등 연구팀에 따르면 이 때 항염증 corticosteroid 제제의 일종인 prednisolone을 동시에 처리한 군에서는 염증 관련 바이오마커들의 레벨은 감소하였지만, 항섬유증 효능의 척도인 TGFβ1의 레벨 감소는 보이지 않았다. 따라서 이로 추론하여 보면, 섬유화 과정에 있어서 염증의 역할은 결정적이지 않을 뿐 아니라 블레오마이신 투여 직후 빠른 염증반응이 시작될 수 있으며, 초기 약물 투여로도 이후 서서히 진행되는 섬유화 과정을 늦추거나 약화시킬 수 있다는 결론을 내리고 있다.
한편, du Bois 등도 Oku 등의 발표 이후 2년 후인 2010년 발표한 논문에서 유사한 결론을 내리고 있다(du Bois, R. M. Strategies for treating idiopathic pulmonary fibrosis. Nature Rev. Drug Discov. 2010,
9, 129-140).
본 발명자들은 이러한 문헌적 근거들을 통해 상기와 같은 TGFβ1 유도 섬유성 질환 세포모델 및 블레오마이신 유도 폐섬유증 마우스 모델(BIPF) 등을 이용하여 HAPLN1 단백질 조성물이 매우 낮은 농도에서도 다양한 조직의 섬유화증을 예방 및 치료하는 우수한 효능을 나타낸다는 점을 발견하여 본 발명을 완성하기에 이르렀다.
HAPLN1과 관련하여 예를 들어 미국 공개특허 US 2013/0052198에는 골수간질세포(MSC, Marrow stromal cells)에 의해 분비되는 광범위한 개별 인자 중 하나로 HAPLN1 폴리펩티드를 개시하면서 이것을 염증성 질환 개체에 투여 시 그 질환의 특징을 약화시킬 수 있음을 시사하고 있다. 그러나 각종 조직에 있어서 섬유화를 예방 또는 치료하는 작용에 관해서는 전혀 언급된 바가 없다.
생체 내의 세포에서 비정상적으로 과도하게 발생하는 섬유화를 직접적으로 예방 내지 억제할 수 있다면 섬유화 자체가 발병 원인으로 작용하거나 해당 섬유화작용이 이미 발병된 질환의 진행을 촉진하는 각종 질환에 대해 유효한 대비책이 될 것이며 이에 관한 요구는 항상 존재하고 있는 실정이다.
본 발명은 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1) 또는 이를 코딩하는 유전자를 유효성분으로 포함하는 섬유성 질환의 예방 및 치료용 조성물, 이를 이용한 섬유성 질환의 예방 및 치료 방법을 제공한다.
또한 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1) 또는 이를 코딩하는 유전자를 유효성분으로 포함하는 시약 조성물을 제공함으로써 상기 질환 연구시에 사용되어 해당 질환의 메커니즘을 규명하고 관련 질환의 예방 또는 치료 조성물을 개발하는 데에 이바지하고자 한다.
상기 과제를 해결하기 위하여 본 발명은 다음과 같은 발명의 양상을 제공한다.
[1] 본 발명의 일 양상은 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1) 또는 이를 코딩하는 유전자를 유효성분으로 포함하는, 섬유성 질환의 예방 또는 치료용 약학적 조성물에 관한 것이다.
[2] 또한 본 발명의 일 양상은 상기 조성물의 단백질이 서열번호 1의 아미노산 서열에 대해 80% 이상의 서열동일성을 갖는 것인 조성물에 관한 것이다.
[3] 또한 본 발명의 일 양상은 상기 조성물 중의 상기 유전자에 관한 핵산이 발현 벡터 내에 포함되어 있는 것인 조성물에 관한 것이다.
[4] 또한 본 발명의 일 양상은 상기 섬유성 질환의 병소가 피부, 간, 장, 심장, 폐, 및 신장으로 이루어지는 군에서 선택되는 것인 조성물에 관한 것이다.
[5] 또한 본 발명의 일 양상은 상기 섬유성 질환의 병소가 피부 섬유아세포, 간성상 세포, 결장 섬유아세포, 심장 미세혈관 내피세포, 폐 섬유아세포, 신장 신세관 세포, 및 신장 근위 세뇨관 상피 세포로 이루어지는 군에서 선택되는 것인 조성물에 관한 것이다.
[6] 또한 본 발명의 일 양상은 상기 섬유성 질환이 허혈성 섬유화증인 것인 조성물에 관한 것이다.
[7] 또한 본 발명의 일 양상은 상기 조성물의 1회 투여량이 0.1ng/ml 내지 500ng/ml인 것인 조성물에 관한 것이다.
[8] 또한 본 발명의 일 양상은 상기 상기 조성물이 in vivo로 투여 시 0.001 내지 5 mg/kg BW의 rhHAPLN1 단백질의 용량으로 투여되는 것인 조성물에 관한 것이다.
[9] 또한 본 발명의 일 양상은 상기 조성물이 세포의 섬유화증을 예방 또는 억제하기 위한 조성물의 주요 또는 보조 유효성분으로서 포함되는 것인 조성물에 관한 것이다.
[10] 한편으로 본 발명의 또 다른 양상은 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1) 또는 이를 코딩하는 유전자를 유효성분으로 포함하는 조성물을 세포에 처리함으로써 세포의 섬유화를 예방 또는 억제하는 방법에 관한 것이다.
[11] 나아가 본 발명의 추가적인 양상은 항목 [1] 내지 항목 [9] 중 어느 한 항목에 따른 조성물 및 항목 [10]의 방법에 따른 처리를 위한 지침을 포함하는 세포의 섬유화 예방 또는 억제용 키트에 관한 것이다.
[12] 나아가 본 발명의 추가적인 양상은 항목 [1] 내지 항목 [9] 중 어느 한 항목에 따른 조성물을 포함하는, 세포의 섬유화 예방 또는 억제와 관련된 실험용 시약 조성물에 관한 것이다.
상기한 바와 같이 본 발명의 조성물 및 방법에 의하면 세포의 섬유화를 예방 및 억제함으로써 세포의 섬유화가 개입하여 유발하는 각종 질환의 발생 또는 진행을 근본적으로 억제하게 되어 해당 질환을 예방 내지 치료할 수 있는 가능성을 획기적으로 높여준다. 즉 노화 및 흡연 등 환경적 요인에 의해 야기되는 조직 재생·수복 능력의 감소에 따라 발생되는 각 조직에서 발생하는 섬유화증을 예방 또는 치료할 수 있다.
상기 본 발명의 조성물은 기존의 섬유성 질환 치료 약물에 따른 부작용이 적어 세계적인 고령화 추세와 함께 매년 증가하고 있는 섬유성 질환에 안전하고 효과적으로 대처할 수 있다.
또한 본 발명에 의하면 상기 본 발명의 조성물을 이용함으로써 섬유화로 인한 질환을 예방 내지 치료하는 방법도 제공할 수 있다.
또한 본 발명의 시약 조성물은 세포의 섬유화에 관련된 각종 질환 연구 시에 사용되어 해당 질환의 메커니즘을 규명하고 해당 질환의 예방 또는 치료 조성물을 개발하는 데에 도움을 줄 수 있다.
도 1a는 정상 인간 피부 섬유아세포(Normal Human Dermal Fibroblast, NHDF)를 시료로 하여 피부 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 나타내는, Western blot의 단백질 밴드 사진이다. 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따른 αSMA 및 GAPDH 단백질의 발현량이 Western blot 밴드의 강도로 나타나 있다.
도 1b는 도 1a의 Western blot 밴드의 강도를 수치화하여 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따라 상대적인 αSMA의 수준을 나타내는 그래프이다.
도 2a는 인간 간성상세포(Human Hepatic Stellate Cell, HHSC)를 시료로 하여 간 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 평가하기 위한 실험 계획도이다.
도 2b는 도 2a의 실험 계획에 따라 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따른 αSMA 및 GAPDH 단백질의 발현량을 나타내는 Western blot 밴드 사진이다.
도 2c는 도 2a의 Western blot 밴드의 강도를 수치화하여 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따라 상대적인 αSMA의 수준을 나타내는 그래프이다.
도 3a는 인간 결장 섬유아세포주(Human Colon Fibroblast Cell Line, CCD-18Co)를 시료로 하여 장 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 평가하기 위한 실험 계획도이다.
도 3b는 도 3a의 실험 계획에 따라 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따른 αSMA 및 GAPDH 단백질의 발현량을 나타내는 Western blot 밴드 사진이다.
도 3c는 도 3b의 Western blot 밴드의 강도를 수치화하여 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따라 상대적인 αSMA의 수준을 나타내는 그래프이다.
도 4a는 인간 심장 미세혈관 내피세포(Human Cardiac Microvascular Endothelial Cell, HCMEC)를 시료로 하여 심장 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 평가하기 위한 실험 계획도이다.
도 4b는 도 4a의 실험 계획에 따라 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따른 αSMA 및 GAPDH 단백질의 발현량을 나타내는 Western blot 밴드 사진이다.
도 4c는 도 4b의 Western blot 밴드의 강도를 수치화하여 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따라 상대적인 αSMA의 수준을 나타내는 그래프이다.
도 5a는 정상 인간 폐 섬유아세포(Normal Human Lung Fibroblast, NHLF)를 시료로 하여 피부 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 나타내는 Western blot 밴드 사진이다. 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따른 αSMA 및 GAPDH 단백질의 발현량이 Western blot 밴드의 강도로 나타나 있다.
도 5b는 도 5a의 Western blot 밴드의 강도를 수치화하여 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따라 상대적인 αSMA의 수준을 나타내는 그래프이다.
도 6a는 인간 신장 신세관 세포(Human Kidney 2, HK-2)의 상피 세포주를 시료로 하여 신장 섬유화에 대한 본 발명의 조성물의 섬유화 예방 작용을 평가하기 위한 실험 계획도이다.
도 6b는 도 6a의 실험 계획에 따라 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따른 αSMA 및 GAPDH 단백질의 발현량을 나타내는 Western blot 밴드 사진이다.
도 6c는 도 6b의 Western blot 밴드의 강도를 수치화하여 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따라 상대적인 αSMA의 수준을 나타내는 그래프이다.
도 7a는 인간 신장 신세관 세포(Human Kidney 2, HK-2)의 상피 세포주를 시료로 하여 신장 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 평가하기 위한 실험 계획도이다.
도 7b는 도 7a의 실험 계획에 따라 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따른 αSMA 및 GAPDH 단백질의 발현량을 나타내는 Western blot 밴드 사진이다.
도 7c는 도 7b의 Western blot 밴드의 강도를 수치화하여 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따라 상대적인 αSMA의 수준을 나타내는 그래프이다.
도 8a는 인간 신장 신세관 세포(Human Kidney 2, HK-2)의 상피 세포주를 시료로 하여 TGFβ1 유도에 의한 HK-2 cell의 섬유화 형태 변화에 있어서 rhHAPLN1의 효능을 평가하기 위한 실험 계획도이다.
도 8b는 도 8a의 실험 계획에 따라 본 발명의 조성물 및 피르페니돈의 다양한 농도에 따른 세포의 모양 변화를 나타내는 현미경 사진이다.
도 9a는 신장 근위 세뇨관 상피 세포(Renal Proximal Tubule Epithelial Cells, RPTEC)를 시료로 하여 노화 유도에 의해 나타나는 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 나타내는 Western blot 밴드 사진이다. 11계대 배양 세포에 대해 본 발명의 조성물의 다양한 농도에 따른 αSMA 및 GAPDH 단백질의 발현량이 Western blot 밴드의 강도로 나타나 있다.
도 9b는 도 9a에서 제시하는 Western blot 밴드의 강도를 수치화하여 본 발명의 조성물의 다양한 농도에 따라 상대적인 αSMA의 수준을 나타내는 그래프이다.
도 10a는 4계대 배양 및 11계대 배양 시 DAPI (4',6-diamidino-2-phenylindole)로 염색하여 세포의 핵을 관찰하고 αSMA 항체 (abcam, ab7817)를 1:1000으로 1XPBST (1X PBS with 0.1% Triton X-100, 1% BSA)에 희석하여 세포 내 αSMA를 염색함으로써 그 발현 정도를 형광으로 나타내는 사진이다.
도 10b는 대조군으로서 4계대 배양 및 노화가 유도된 11계대 배양 시 본 발명의 조성물의 다양한 농도 및 피르페니돈 처리에 따라 상대적인 세포의 αSMA의 수준을 형광으로 나타내는 사진이다.
도 11a는 BioMAP Fibrosis panel을 이용하여 rhHAPLN1의 항섬유화 마커에 대한 영향을 확인한 실험으로서 폐 섬유증(lung fibrosis) 질환 모델인 SAEMyoF system에서 본 발명의 조성물(rhHAPLN1)이 농도 별로 αSMA 및 collagen I에 대한 유의적인 감소 효과를 vehicle 대조군에 대비하여 상대적 배수(fold change)로 나타낸 그래프이다.
도 11b는 BioMAP Fibrosis panel을 이용하여 rhHAPLN1의 항섬유화 마커에 대한 영향을 확인한 실험으로서 신장 섬유증(kidney fibrosis) 질환 모델인 REMyoF system에서 본 발명의 조성물(rhHAPLN1)이 농도 별로 collagen I에 대한 유의적인 감소 효과를 vehicle 대조군에 대비하여 상대적 배수로 나타낸 그래프이다.
도 11c는 BioMAP Fibrosis panel을 이용하여 rhHAPLN1의 항섬유화 마커에 대한 영향을 확인한 실험으로서 근섬유아세포(myofibroblast)에서 본 발명의 조성물(rhHAPLN1)이 농도 별로 collagen IV에 대한 유의적인 감소 효과를 vehicle 대조군에 대비하여 상대적 배수로 나타낸 그래프이다.
도 12a는 마우스 Bleomycin 유도 폐섬유화증(bleomycin-induced pulmonary fibrosis, BIPF) 모델을 이용한 본 발명의 조성물의 항섬유화 효능(섬유성 질환의 예방능)을 평가하기 위한 실험의 개요를 설명하는 그림이다.
도 12b는 도 12a의 마우스 Bleomycin 유도 폐섬유화증 모델을 이용한 실험에 있어서 마우스를 4개의 군(Mouse 1 내지 4)으로 나누어 정상(Normal) 군은 PBS를 처리하고, 대조군(Control)은 아무 처리도 하지 않고, 이에 대해 본 발명의 조성물(rhHAPLN1) 0.0005%(w/w), 본 발명의 조성물(rhHAPLN1) 0.0015%(w/w)을 각각 처리하고 군 당 4마리의 마우스의 폐조직을 적출한 다음 좌측 큰 엽을 가로로 반을 자르고 윗부분을 포르말린에 넣어서 고정하고 헤마톡신 및 에오신(H&E) 염색을 행한 사진이다.
도 12c는 마우스 왼쪽의 제일 큰 엽 폐조직의 중간부분을 잘라 한 마리 당 3장의 조직 슬라이드를 제작하고 한 슬라이드에서 임의로 각각 3군데를 사진 찍은 다음 총 9개의 부분에 대해 염색이 된 적색 부분과 그렇지 않은 흰색을 구분하고, 'Image J' 소프트웨어를 이용하여 염색된 적색 부분의 면적을 측정하여 얻은 각 수치를 평균하여 마리 당 평균치를 얻어 통계적 유의성을 확인한 그래프이다.
도 12d 및 도 12e는 각각 폐섬유화증의 중증도를 육안으로 간단히 측정할 수 있는 공식적인 지침으로 제공하는 Ashcroft score에 관한 사진 및 설명이다(Ashcroft et al 1988, J Clin Pathol 41:467-470).
도 12f는 도 13a 및 도 13b에 따라 폐섬유화증의 중증도를 Ashcroft score로 나타낸 실험 결과에 관한 그래프이다.
도 13a는 마우스 Bleomycin 유도 폐섬유화증(bleomycin-induced pulmonary fibrosis, BIPF) 모델을 이용한 본 발명의 조성물의 항섬유화 효능(섬유성 질환의 치료능)을 평가하기 위한 실험의 개요를 설명하는 그림이다.
도 13b는 도 13a의 마우스 Bleomycin 유도 폐섬유화증 모델을 이용한 실험에 있어서 마우스를 4개의 군(Normal, PBS Control, 0.00075%(w/w) rhHAPLN1, 0.0015%(w/w) rhHAPLN1, 0.003%(w/w) rhHAPLN1)으로 나누고 군당 4마리로 설정하여 실험 후 군 당 4마리의 마우스의 폐조직을 적출한 다음 좌측 큰 엽을 가로로 반을 자르고 윗부분을 포르말린에 넣어서 고정하고 헤마톡신 및 에오신(H&E) 염색을 행한 사진이다.
도 13c 및 13d는 마우스 왼쪽의 제일 큰 엽 폐조직의 중간부분을 잘라 한 마리 당 3장의 조직 슬라이드를 제작하고 한 슬라이드에서 임의로 각각 3군데를 사진 찍은 다음 총 9개의 부분에 대해 염색이 된 적색 부분과 그렇지 않은 흰색을 구분하고, 'Image J' 소프트웨어를 이용하여 염색된 적색 부분의 면적을 측정하여 얻은 각 수치를 평균하여 마리 당 평균치를 얻어 통계적 유의성을 확인한 그래프이다.
도 13e는 도 13c의 결과와 관련하여 폐섬유화증의 중증도를 Ashcroft score로 나타낸 실험 결과에 관한 그래프이다.
도 14a는 신장 섬유화 유발 동물 모델 실험으로서 허혈/재관류(ischemia/reperfusion)를 이용하여 신장 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 평가하기 위한 실험 계획도이다.
도 14b는 도 14a의 실험 계획에 따라 본 발명의 조성물 및 피르페니돈의 투여에 따른 αSMA 단백질의 발현 정도를 나타내는 Western blot의 단백질 밴드 사진이다(SV; sham-vehicle, SB; sham-rhHAPLN1-dissolving solution으로서 Sham-rhHAPLN1 dose B이며, Sham control에 rhHAPLN1을 처리했을 시 어떤 영향이 나타나는지 확인하기 위한 군, IRV; IR-vehicle, IRP; IR-pirfenidone, IRA; IR-rhHAPLN1 dose A, IRB; IR-rhHAPLN1 dose B, IRC; IR-rhHAPLN1 dose C).
도 14c는 도 14b의 Western blot 밴드의 강도를 수치화하여 피르페니돈 및 본 발명의 조성물의 다양한 농도에 따라 IRV에 대한 αSMA의 발현 수준을 배수(fold) 변화로 나타내는 그래프이다.
도 14d는 급성 신장 손상 유발 모델에 있어서 피르페니돈 및 본 발명의 조성물의 다양한 농도에 따라 Collagen의 발현 정도를 Sirus red 및 PAS 염색사진으로 나타낸 사진이다. Purple color는 collagen 발현을 보여주고 있다.
도 14e는 급성 신장 손상 유발 모델에 있어서 피르페니돈 및 본 발명의 조성물의 다양한 농도에 따라 Collagen의 발현 정도를 정량화하기 위해 조직염색에서 신장의 바깥수질부(outer medulla) 부위에서 2곳을 무작위적으로 이미징화한 후 collagen 양성부위만을 나타내는 사진이다.
도 14f는 도 14e에 있어서 collagen 양성부위를 마킹하고 콜라겐의 면적(%)을 i-solution software(IMT)를 활용함으로써 수치화하여 나타낸 그래프이다.
도 14g는 급성 신장 손상 유발 모델에 있어서 피르페니돈 및 본 발명의 조성물의 다양한 농도에 따라 크레아티닌 청소율(creatinine clearance)을 허혈/재관 후 21일째에 측정하여 그 수치를 나타낸 그래프이다.
먼저 본 명세서에서 나타나는 각종 용어를 다음과 같이 정의할 수 있다.
본 발명의 명세서에 있어서, "rhHAPLN1"는 recombinant human HAPLN1의 약자로서 재조합 인간 HAPLN1을 나타낸다.
본 발명의 명세서에 있어서 "섬유아세포(Fibroblast)"는 상피성, 혈관, 림프관, 염증 세포들이 아닌 콜라겐 섬유 등의 결합조직을 만들어 조직 구조의 유지에 관여하는 세포를 의미한다.
본 발명의 명세서에 있어서 "근섬유아세포(Myofibroblast)"는 물리적 상처나 염증 등에 의해 활성화되어 α-SMA (alpha-smooth muscle actin)을 발현하여 평활근세포처럼 수축기능을 가지게 된 섬유아세포를 의미한다.
본 발명의 명세서에 있어서 "αSMA" 또는 "α-SMA(alpha smooth muscle actin)"는 병적상태의 혈관 평활근 세포(Vascular smooth muscle cell), 기질 섬유아 세포(Stromal fibroblastic cell)에서 발현되는 단백질로서, 조직의 섬유화에서 나타나는 주요 마커이다. 신장 섬유화증의 소견을 보이는 신장에서 발현이 높게 나타나며 이와 같이 높게 나타나는 발현량 내지 활성은 간질섬유증 (interstitial fibrosis)의 정도와 밀접한 관련이 있는 근섬유아세포 (myofibroblast)의 활성이 높음을 의미한다. 또한, 환자에게서 αSMA의 발현은 신장의 크레아틴 청소율의 감소와 밀접한 연관성이 있으므로 체내 노폐물인 크레아틴이 소거되지 않음을 확인할 수 있는 마커로 기능한다.
본 발명의 명세서에 있어서 "전환 성장인자 베타 1(TGFβ1 또는 TGF-β1)"은 본 발명에 관한 다양한 실시예에서 섬유아세포를 근섬유아세포로 변화시키기 위해 사용되는 사이토카인을 의미하며, 세포별 전환용량은 상이하다. 일반적으로 섬유아세포가 근섬유아세포로 변화하는데는 사이토카인, 케모카인, 성장인자, 호르몬 등의 다양한 생리활성 물질이 관여한다.
본 발명의 명세서에 있어서 "피르페니돈(Pirfenidone)"은 폐섬유화증 치료제로 승인되어 신장섬유화증의 치료제로 임상을 진행 중인 항섬유화 약물이다. 본 발명의 실시예의 실험들에서는 대조물질로 사용되었다. 세포마다 유효 용량이 다를 수 있으나, 관련문헌상 100 μg/mL 이상부터 효력을 나타내는 것으로 보고되었다.
이하 본 발명에 대해 상세하게 기술한다.
본 발명의 일 양상은 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1) 또는 이를 코딩하는 유전자를 유효성분으로 포함하는, 항섬유화 조성물에 관한 것이다. 이는 섬유성 질환의 예방 또는 치료용 약학적 조성물로 기능할 수 있다.
또한 본 발명의 일 구체예에 따르면 상기 본 발명의 조성물에 있어서 서열번호 1로 나타나는 재조합 인간 HAPLN1 단백질일 수 있다. 이와 관련하여 본 발명의 HAPLN1 단백질은 항섬유화 기능을 유지하는 한 서열번호 1의 아미노산 서열에 대해 80%, 바람직하게는 85%, 더 바람직하게는 90%, 더더욱 바람직하게는 95%, 가장 바람직하게는 100%의 서열동일성을 갖는 단백질일 수 있다.
또한 본 발명의 일 구체예에 따르면 상기 본 발명의 조성물 중의 HAPLN1 단백질을 코딩하는 유전자에 관한 핵산은 발현 벡터 내에 포함되어 상기 조성물 중에 포함될 수 있다.
또한 본 발명에 있어서, 본 발명의 조성물이 작용하는 상기 세포는 특별히 한정되지 않으나 바람직하게는 각종 섬유아세포, 성상세포, 내피세포 및 상피세포 등을 들 수 있고, 보다 구체적으로는 피부 섬유아세포, 간성상세포, 인간 결장 세포, 미세혈관 내피세포, 폐 섬유아세포, 신장 신세관세포, 및 근위 세뇨관 상피 세포 등이며 in vivo, in vitro, ex vivo, in situ 등 다양한 상황에서의 세포를 포함한다. 또한 적용되는 기관으로서는 섬유화가 유발될 가능성이 있는 기관이라면 특별히 한정되지 않으나 바람직하게는 폐, 신장, 피부, 간, 장, 심장 등을 들 수 있다.
또한 본 발명의 일 구체예에 따르면 상기 본 발명의 조성물은 세포에 대한 1회 투여량이 0.1ng/ml 내지 500ng/ml, 바람직하게는 1ng/ml 내지 300ng/ml, 더 바람직하게는 3.0ng/ml 내지 50ng/ml, 더더욱 바람직하게는 10ng/ml 내지 13ng/ml이다. 다만 적용되는 부위에 따라 또는 경우에 따라 더욱 특정적으로는 3, 5, 11, 30, 50, 또는 100ng/ml일 수 있다.
또는 본 발명의 일 구체예에 따르면 상기 본 발명의 조성물은 세포에 대한 1회 투여량이 0.00001 내지 0.1%(w/w), 바람직하게는 0.0001 내지 0.05%(w/w), 더 바람직하게는 0.0003 내지 0.03%(w/w), 더더욱 바람직하게는 0.0005 내지 0.015%(w/w)이다.
한편으로 본 발명의 일 구체예에서는 상기 본 발명의 조성물이 세포의 섬유화 작용을 예방 또는 억제하기 위한 조성물의 주요 또는 보조 유효성분으로서 포함될 수 있다.
나아가 본 발명의 일 양상에 따르면 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1) 또는 이를 코딩하는 유전자를 유효성분으로 포함하는 조성물을 세포에 처리함으로써 세포의 섬유화를 예방 또는 억제하는 방법에 관한 것이다.
또한 본 발명의 일 양상에 따르면 상기 본 발명의 조성물 및 처리 지침을 포함하는 세포의 섬유화 예방 또는 억제용 키트에 관한 것이다.
또한 본 발명의 일 양상에 따르면 상기 본 발명의 조성물을 포함하는, 세포의 섬유화 예방 또는 억제와 관련된 실험용 시약 조성물에 관한 것이다.
나아가 본 발명은 세포의 섬유화가 유발하는 질환의 예방 또는 치료용 약학적 조성물의 제조에 사용하기 위한 상기 본 발명의 조성물의 사용에 관한 것이다.
특정 구체예에서, 상기 약학적 조성물은 일반적으로 분자 및 약제학적으로 허용되는 담체를 포함할 수 있다. 본 명세서에서 사용된 용어 "약제학적으로 허용되는 담체"는 약학적 투여와 양립 가능한 식염수, 용매, 분산 매질, 코팅, 항균 및 항진균제, 등장화제 및 흡수 지연제 등을 포함한다. 보충 활성 화합물도 또한 조성물에 포함될 수 있다. 다시 말하면 본 발명의 약학적 조성물은 약학적으로 허용가능한 담체, 희석제, 결합제, 붕해제, 활택제, 및 이들의 임의의 조합으로 이루어진 군에서 선택된 약학적 첨가제를 더 포함할 수 있다.
상기 약학적 조성물은 의도된 투여 경로와 양립할 수 있도록 제형화될 수 있다. 바람직하게는 본 발명의 조성물은 점안액, 연고, 정제, 알약, 캡슐, 트로키제, 흡입제, 주사제, 패치제, 좌약으로 이루어진 군에서 선택되는 제형일 수 있다.
투여 경로의 예는 비경구, 예를 들어 정맥 내, 피내, 피하, 경구 (예를 들어, 흡입), 경피 (국소), 경점막 및 직장 투여를 포함한다. 바람직하게는 비경구 투여용도이다.
비경구, 피내 또는 피하 적용에 사용되는 용액 또는 현탁액에는 다음 성분이 포함될 수 있다: 주사용수, 식염수, 고정 오일, 폴리에틸렌 글리콜, 글리세린, 프로필렌 글리콜 또는 기타 합성 용매와 같은 멸균 희석제; 벤질 알코올 또는 메틸 파라벤과 같은 항균제; 아스코르브산 또는 중아황산나트륨과 같은 항산화제; 에틸렌디아민테트라아세트산과 같은 킬레이트제; 아세테이트, 시트레이트 또는 포스페이트와 같은 완충액 및 염화나트륨 또는 덱스트로스와 같은 긴장성 조절 제제. pH는 염산 또는 수산화 나트륨과 같은 산 또는 염기로 조정할 수 있다. 비경구 제제는 앰플, 일회용 주사기 또는 유리 또는 플라스틱으로 만든 다회 용량 바이알에 넣을 수 있다.
주사용으로 적합한 상기 약학적 조성물은 멸균된 주사용 용액 또는 분산액의 즉석 제조(extemporaneous preparation)를 위한 멸균 수용액 (수용성인 경우) 또는 분산액 및 멸균 분말을 포함한다. 정맥 내 투여에 적합한 담체는 생리 식염수, 정균수, 또는 인산염 완충 식염수 (PBS)를 포함한다. 모든 경우에 조성물은 무균이어야 하고 주사가 용이할 정도로 유동적이어야 한다. 제조 및 보관 조건 하에서 안정적이어야 하며 박테리아 및 곰팡이와 같은 미생물의 오염 작용에 대해 보존되어야 한다. 담체는 예를 들어 물, 에탄올, 폴리올 (예를 들어, 글리세롤, 프로필렌 글리콜, 및 액체 폴리에틸렌 글리콜 등) 및 이들의 적합한 혼합물을 함유하는 용매 또는 분산 매질일 수 있다. 예를 들어, 레시틴과 같은 코팅의 사용, 분산의 경우 필요한 입자 크기의 유지 및 계면 활성제의 사용에 의해 적절한 유동성이 유지될 수 있다. 미생물 작용의 예방은 예를 들어 파라벤, 클로로부탄올, 페놀, 아스코르브산, 티메로살 등과 같은 다양한 항균 및 항진균제에 의해 달성될 수 있다. 많은 경우에 등장제, 예를 들어 당, 만니톨과 같은 폴리알콜, 소르비톨, 염화나트륨을 조성물에 포함시키는 것이 바람직할 것이다. 주사 가능한 조성물의 장기간 흡수는 흡수를 지연시키는 제제, 예를 들어 알루미늄 모노스테아레이트 및 젤라틴을 조성물에 포함시킴으로써 도모할 수 있다.
멸균 주사용 용액은 필요에 따라 상기 열거된 성분의 하나 또는 조합과 함께 적절한 용매에 필요한 양의 활성 화합물을 혼입시킨 다음 여과 멸균함으로써 제조할 수 있다. 일반적으로 분산액은 활성 화합물을 기본 분산 매질과 위에서 열거한 다른 필요 성분을 포함하는 멸균 비히클에 통합하여 제조한다. 멸균 주사 용액의 제조를 위한 멸균 분말의 경우, 바람직한 제조 방법은 진공 건조 및 동결 건조로서, 활성 성분의 분말과 이전에 멸균 여과된 용액으로부터 원하는 임의의 추가 성분을 생성한다.
경구 조성물은 일반적으로 불활성 희석제 또는 식용 담체를 포함한다. 경구 치료 투여의 목적을 위해, 활성 화합물은 부형제와 혼입될 수 있고 정제, 트로키 또는 캡슐, 예를 들어 젤라틴 캡슐의 형태로 사용될 수 있다. 구강용 조성물은 또한 구강 세정제로 사용하기 위한 유체 담체를 사용하여 제조할 수 있다. 약제학적으로 적합한 결합제 및/또는 보조제 물질이 조성물의 일부로 포함될 수 있다. 정제, 알약, 캡슐, 트로키 등은 다음 성분 또는 유사한 성질의 화합물 중 임의의 것을 함유할 수 있다: 바인더, 예컨대 미세결정질 셀룰로스, 트라가칸트 검 또는 젤라틴; 전분 또는 락토스와 같은 부형제, 알긴산, 프리모겔 또는 옥수수 전분과 같은 붕해제; 마그네슘 스테아레이트 또는 스테로테스와 같은 윤활제; 콜로이드성 이산화 규소와 같은 활택제; 수크로스 또는 사카린과 같은 감미제; 또는 페퍼민트, 메틸 살리실레이트, 또는 오렌지 향료와 같은 향료.
흡입에 의한 투여를 위해 화합물은 적절한 추진제, 예를 들어 이산화탄소와 같은 가스, 또는 네불라이저를 함유하는 압력 용기 또는 디스펜서로부터 에어로졸 스프레이의 형태로 전달된다.
전신 투여는 또한 경점막 또는 경피 수단에 의해 이루어질 수 있다. 경점막 또는 경피 투여의 경우, 침투할 장벽에 적합한 침투제가 제형에 사용된다. 이러한 침투제는 일반적으로 당해 기술분야에 공지되어 있으며, 예를 들어 경점막 투여용, 세제, 담즙 염, 및 푸시드산 유도체를 포함한다. 경점막 투여는 비강 스프레이 또는 좌약을 사용하여 수행할 수 있다. 경피 투여를 위해 활성 화합물은 당해 기술분야에 일반적으로 알려진 바와 같이 연고, 고약, 겔 또는 크림으로 제형화된다.
화합물은 또한 좌약 (예를 들어, 코코아 버터 및 기타 글리세리드와 같은 통상적 인 좌약베이스와 함께) 또는 직장 전달을 위한 체류 관장의 형태로 제조될 수 있다.
세포 배양 분석 및 동물 연구에서 얻은 데이터는 인간에게 사용하기 위한 다양한 용량을 제형화하는 데 사용할 수 있다. 이러한 화합물의 투여량은 바람직하게는 독성이 거의 또는 전혀없는 ED50을 포함하는 순환 농도 범위 내에 있다. 투여량은 사용되는 투여 형태 및 사용되는 투여 경로에 따라 이 범위 내에서 달라질 수 있다.
본 발명의 조성물의 치료적 유효량 (즉, 유효 투여량)은 선택된 환자의 상황에 따라 달라진다. 예를 들어, 약 1pg 내지 1000mg 범위의 단일 용량이 투여될 수 있다; 일부 구체예에서, 10, 30, 100, 또는 1000 pg, 또는 10, 30, 100, 또는 1000 ng, 또는 10, 30, 100, 또는 1000 μg, 또는 10, 30, 100 또는 1000 mg이 투여될 수 있다.
나아가 본 발명의 일 구체예에 따르면 상기 본 발명의 조성물을 생체에 대해 직접적으로 in vivo로 투여 시에 rhHAPLN1 단백질의 용량은 0.001 내지 10 mg/kg/BW, 바람직하게는 0.004 내지 5mg/kg/BW, 더 바람직하게는 0.1 내지 1.0mg/kg/BW, 더더욱 바람직하게는 0.15 내지 0.5mg/kg/BW이다.
또는 일부 구체예에서, 1ng/ml 내지 100μg/ml, 바람직하게는 3ng/ml 내지 50μg/ml, 더 바람직하게는 5ng/ml 내지 500ng/ml, 특히 바람직하게는 10ng/ml 내지 200ng/ml의 약학적 조성물이 투여할 수 있다. 상기 약학적 조성물은 1 일 1 회 이상부터 1 주일에 1 회 이상 투여할 수 있으며 격일로 한 번씩을 포함한다. 숙련된 기술자는 개체를 효과적으로 치료하기 위해 필요한 용량 및 시기에 특정 요인이 영향을 미칠 수 있음을 인식할 것인데 이에는 질병 또는 장애의 중증도, 이전의 치료, 개체의 일반적인 건강 및/또는 연령 및 기타 기존 질환을 포함하지만 이에 제한되지 않는다. 더욱이, 본 발명의 분자의 치료적 유효량으로 개체를 치료하는 것은 단일 치료를 포함할 수 있거나, 바람직하게는 일련의 치료를 포함할 수 있다.
본 발명의 조성물은 환자의 상황에 따라 그 투여량이 5 mg/kg/주 내지 500 mg/kg/주, 예를 들어 5 mg/kg/주, 10 mg/kg/주, 15 mg/kg/주, 20 mg/kg/주, 25 mg/kg/주, 30 mg/kg/주, 35 mg/kg/주, 40 mg/kg/주, 45 mg/kg/주, 50 mg/kg/주, 55mg/kg/주, 60mg/kg/주, 65mg/kg/주, 70mg/kg/주, 75mg/kg/주, 80mg/kg/주, 85mg/kg/주, 90mg/kg/주, 95mg/kg/주, 100mg/kg/주, 150mg/kg/주, 200mg/kg/주, 250mg/kg/주, 300mg/kg/주, 350mg/kg/주, 400mg/kg/주, 450mg/kg/주 및 500mg/kg/주의 범위 내에 있다. 특정 구체예에서, 본 발명에 따른 이중작용성 분자의 투여량은 10 mg/kg/주 내지 200 mg/kg/주, 20 mg/kg/주 내지 150 mg/kg/주 또는 25 mg/kg/주 내지 100 mg/kg/주의 범위 내에 있다. 특정 구체예에서, 본 발명의 조성물은 2 주 내지 6 개월, 예를 들어 2 주, 3 주, 4 주, 5 주, 6 주, 7 주, 8 주, 9 주, 10주, 11 주, 12 주, 13 주, 26 주, 6 개월, 8 개월, 10 개월 또는 1 년 이상 동안 주당 1x 회 투여된다. 특정 구체예에서, 본 발명의 조성물은 주당 2x 회 투여된다. 다른 구체예에서, 본 발명의 조성물은 격주로 투여된다.
본 발명의 조성물은 약리학적 유효량의 HAPLN1 단백질 분자 및 약제학적으로 허용되는 담체를 포함하는 약학적 조성물로도 제형화할 수 있다. 약리학적 또는 치료학적 유효량은 의도된 약리학적, 치료적 또는 예방적 결과를 생성하는 데 효과적인 함량을 의미한다. "약리학적 유효량" 및 "치료학적 유효량" 또는 간단히 "유효량"이라는 어구는 의도된 약리학적, 치료적 또는 예방적 결과를 생성하는 데 효과적인 이중작용성 분자의 양을 지칭한다. 예를 들어, 주어진 임상 치료가 질병 또는 장애와 관련된 측정 가능한 매개 변수가 20 % 이상 감소할 때 효과적인 것으로 간주된다면, 그 질병 또는 장애를 치료하기 위한 약물의 치료적 유효량은 해당 매개 변수를 최소 20 % 감소시키기에 필요한 양이다.
본 발명의 적절하게 제형화된 약학적 조성물은 정맥 내, 근육 내, 복강 내, 피하, 경피, 기도 (에어로졸), 직장, 질 및 국소 (협측 및 설하 포함) 투여를 포함하는 비경구 경로와 같은 당해 기술분야에 공지된 임의의 수단에 의해 투여할 수 있다. 일부 구체예에서, 약학적 조성물은 정맥 내 또는 비경구 주입 또는 주사에 의해 투여된다.
일반적으로 분자의 적절한 투여량 단위는 하루당 수용자의 체중 kg 당 0.001 내지 0.25mg의 범위, 또는 1 일당 체중 1kg 당 0.01 내지 20마이크로그램의 범위, 또는 1 일당 체중 kg 당 0.01 내지 10 마이크로그램의 범위, 또는 1 일 체중 1kg 당 0.10 내지 5 마이크로그램의 범위, 또는 1 일당 체중 kg 당 0.1 내지 2.5 마이크로그램의 범위이다. 분자를 포함하는 약학적 조성물은 1 일 1 회 투여할 수 있다. 그러나, 치료제는 또한 하루 종일 적절한 간격으로 투여되는 2, 3, 4, 5, 6 또는 그 이상의 하위 용량을 포함하는 투여 단위로 투여할 수 있다. 투여 단위는 또한, 예를 들어, 수일 기간에 걸쳐 분자의 지속적이고 일관된 방출을 제공하는 통상적인 지속 방출 제형을 사용하여 수일에 걸쳐 단일 용량으로 배합될 수 있다. 지속 방출 제형은 당해 기술분야에 잘 알려져 있다. 이 구체예에서, 투여량 단위는 일일 투여량에 상응하는 배수를 포함한다.
상기 약학적 조성물은 투여 지침과 함께 키트, 용기, 팩, 또는 디스펜서에 포함될 수 있다.
본 명세서에 사용된 "치료" 또는 "치료하는"은 질병 또는 장애, 질병 또는 장애의 증상, 또는 질병에 대한 소인을 치료, 치유, 완화, 경감, 변경, 구제, 개선, 개량 또는 영향을 주기 위한 목적으로 환자에게 치료제 (예를 들어, 본 발명의 분자)의 적용 또는 투여, 또는 단리된 조직 또는 세포주에 대한 치료제의 적용 또는 투여로 정의되는데, 상기 환자는 질병 또는 장애, 질병 또는 장애의 증상, 또는 질병 또는 장애에 대한 소인을 갖고 있는 것이다.
또한 나아가 본 발명의 일 양상은 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1)을 유효성분으로 포함하는 조성물을 세포의 섬유화작용을 예방 또는 억제에 이용하는 용도에 관한 것이다.
실 시 예
이하 실시예를 통하여 본 발명을 더욱 상세하게 설명하고자 하나, 하기의 실시예는 단지 설명의 목적을 위한 것이며 본원 발명의 범위를 한정하고자 하는 것은 아니다.
[제조예 1]
히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1)의 제조
아미노산 서열번호 1의 인간 HAPLN1 단백질을 코딩하는 폴리뉴클레오티드를 포함하는 벡터를 CHO-K1 세포에 삽입하여 재조합 인간 HAPLN1 단백질을 생산하는 CHO-K1 세포주를 제작하였다.
상기 아미노산 서열번호 1은 다음과 같다:
MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
단백질 생산량 및 품질이 우수한 세포주를 MCB(Master Cell Bank)로 선정하였다. 상기 MCB를 계대배양하여 0.40±0.05×106 cells/mL의 농도로 Thermo사의 Hyperforma SUB 250 L 바이오리액터에 접종하고 유가 배양(Fed-Batch Culture) 하였다. 기본 배지로는 22.36 g ActiPro™ 배지 + 0.5846 g 글루타민 + 10.00 g HT Supplement(Thermo Fisher Scientific사) + 4.29 g 10 N NaOH + 1.80 g NaHCO3를 사용하였다. 배양 온도는 36.5℃, 용존산소량(Dissolved oxygen, DO)은 40.0%, pH는 7.00±0.20로 설정하였다. pH 조절 용액으로 1 M 탄산나트륨 일수화물(Sodium Carbonate Monohydrate)을 사용하였다. 공급 배지(feeding medium, FM)로는 181.04 g HyClone™ Cell Boost 7a + 12.28 g 10 N NaOH의 FM020a 및 94.60 g HyClone™ Cell Boost 7b + 105.93 g 10 N NaOH의 FM020b를 사용하였다.
위와 같이 배양된 세포로부터 재조합 인간 HAPLN1 (rhHAPLN1) 단백질을 회수(Harvest and Clarification), 한외여과/투석여과 1 (Ultrafiltration/Diafiltration 1, UF/DF1), 음이온 교환 크로마토그래피, S/D (Solvent/Detergent) 바이러스 불활성화, 양이온 교환 크로마토그래피, 혼합 모드 크로마토그래피 (Mixed-mode Chromatography, MMC), 소수성 상호작용 크로마토그래피, 한외여과/투석여과 2 (Ultrafiltration/Diafiltration 2, UF/DF2) 및 중간 심층 여과 (Intermediate Depth Filtration, Int. DF) 등의 과정을 거쳐 분리 및 정제하였다. 이하의 실시예에서는 이와 같은 본 발명의 조성물을 이용하였다.
[제조예 2]
HAPLN1 단백질을 포함하는 본 발명 조성물의 제조
상기 제조예 1에서 정제한 HAPLN1 단백질을 20 mM 아세트산 완충액, 8% (w/v) 슈크로스, 0.04% (w/v) PS80, pH 5.0에서 안정화시켜 HAPLN1 단백질 자체를 주된 유효성분으로서 포함하는 본 발명의 조성물을 제조하였다.
[제조예 3]
HAPLN1 단백질을 코딩하는 유전자를 담고 있는 발현 벡터를 함유하는 본 발명 조성물의 제조
HAPLN1 단백질을 코딩하는 유전자를 담고 있는 발현 벡터를 함유하는 조성물을 jetPRIME Transfection Reagent Kit (PolyPlus사 114-15 제품)을 사용하여 제조하였다. 보다 구체적으로 OriGene사 RC209274 제품을 사용하여 Human HAPLN1을 발현하도록 설계된 플라스미드 벡터를 제조하였다(이하, "Human HAPLN1 ORF Clone"라 함). 이는 host 세포의 핵 내에서 자신이 수송하는 유전자를 발현시킬 수 있다.
참고로 jetPRIME Transfection Reagent Kit는 jetPRIME 완충액과 jetPRIME Transfection 시약으로 구성되며, jetPRIME 완충액은 host 세포로 수송할 플라스미드 벡터를 희석하는 용도이고, jetPRIME Transfection 시약은 플라스미드 벡터를 vesicle(liposome)형태로 포집하여 host 세포 내로 침투되도록 작용한다.
상기 Human HAPLN1 ORF Clone을 jetPRIME 완충액에 희석하여 HAPLN1 단백질을 코딩하는 유전자를 담고 있는 발현 벡터를 함유하는 본 발명 조성물을 제조하였다.
이에 대해 jetPRIME Transfection 시약을 첨가하여 10분간 방치하여 플라스미드 벡터가 vesicle(liposome)형태로 포집되도록 한 후 배양 중인 세포 위에 떨어뜨린다. 세포를 48시간 이상 배양한 후, Human HAPLN1 유전자 발현 증가를 Real-time qPCR로 확인하고, Human HAPLN1 단백질 발현 증가를 Western blot으로 확인하였다.
[실시예 1]
인간 피부 섬유아세포에 대한 본 발명의 조성물의 항섬유화 효능의 평가
정상 인간 피부 섬유아세포(Normal Human Dermal Fibroblast, NHDF)를 시료로 하여 피부 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 검증하였다.
1. 실험 방법
(1) 인간 피부 섬유아세포(Normal Human Dermal Fibroblast, NHDF)를 6 웰 플레이트에 분주(seeding)(1.0 X 105 cells/well)하고 FBM-2(Fibroblast Growth Medium-2, CC-3131, Lonza) 배지 중 37℃ 5% CO2 조건의 인큐베이터에서 24시간 동안 인큐베이트하였다.
(2) 무혈청 배지로 교체 후 24시간 동안 인큐베이트하였다.
(3) 이에 대해 TGFβ1(10 ng/ml)을 처리하여 섬유화를 유도한 조건에서 플레이트의 각 웰에 본 발명의 조성물을 제조예 2를 기반으로 하되 rhHAPLN1 단백질 함량 0, 3, 10, 30, 및 100 ng/ml와 시판되는 항섬유화제인 피르페니돈(Selleckchem) 100μg/mL, 및 200μg/mL로 각각 처리한 후 24시간 동안 인큐베이트하였다.
(4) 이후 각각의 샘플을 인산완충식염수(phosphate buffered saline ; PBS, pH 7.2)로 2회 세척한 후 Western blot으로 근섬유아세포의 마커인 αSMA의 발현 정도를 확인하였다.
2. 결과
도 1a에서는 정상 인간 피부 섬유아세포가 섬유화하는 정도에 대해 αSMA 단백질 밴드의 진하기와 굵기로 보아 본 발명의 조성물이 피르페니돈에 비해 훨씬 우수한 항섬유화 작용을 나타낸다는 것을 Western blot 밴드 사진으로부터 확인할 수 있었다.
또한 도 1b에서는 TGF1β(10 ng/ml)으로 섬유화를 유도한 후 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 처리한 경우 모든 rhHAPLN1 단백질 함량범위에서 유의하게 αSMA의 발현 수준이 낮게 나타나 항섬유화 효능을 보여주었다. 특히 본 발명의 조성물 중 rhHAPLN1 단백질 함량 100 ng/ml의 샘플에서 가장 우수한 항섬유화 효능을 나타내었는데 이는 피르페니돈 100μg/mL(100000 ng/ml)보다 1000분의 1 함량임에도 불구하고 항섬유화 효능은 25% 더 높은 결과를 나타내었다. 피르페니돈은 200μg/mL가 100μg/mL보다 αSMA의 발현 수준이 높게 나타나므로 고농도에서 항섬유화 효능이 오히려 더 떨어지며 100μg/mL이 최적 항섬유화 농도인 것으로 추측할 수 있다. 그렇다면 본 발명의 조성물은 시판되는 항섬유화제인 피르페니돈에 비해 항섬유화 효능이 훨씬 뛰어나다는 것을 알 수 있었다.
[실시예 2]
인간 간성상세포에 대한 본 발명의 조성물의 항섬유화 효능의 평가
인간 간성상세포(Human Hepatic Stellate Cell, HHSC)를 시료로 하여 간 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 검증하였다.
1. 실험 방법
(1) 도 2a의 실험 계획에 따라 인간 간성상세포(Primary Human Hepatic Stellate Cell (HHSC; iXCells Biotechnologies, 10HU-210))를 6 웰 플레이트에 분주(seeding)(1.5 X 105 cells/well)하고 Stellate Cell Growth Medium (iXCells Biotechnologies, MD-0014) 배지 중 37℃ 5% CO2 조건의 인큐베이터에서 24시간 동안 인큐베이트하였다.
(2) 무혈청 DMEM 배지로 교체 후 24시간 동안 인큐베이트하였다.
(3) 이에 대해 TGFβ1(2 ng/ml)을 처리하여 섬유화를 유도하고 24시간 동안 인큐베이트하였다.
(4) 이후 플레이트의 각 웰에 본 발명의 조성물을 rhHAPLN1 단백질 함량 0, 3, 10, 30, 및 100 ng/ml과 피르페니돈 100μg/mL, 및 200μg/mL로 각각 처리한 후 24시간 동안 인큐베이트하였다.
(5) 이후 각각의 샘플에 대해 세포 용해 완충액(cell lysis buffer)으로 처리한 후 회수(harvest)하였다.
(6) 이에 대해 Western blotting을 진행하였다. 여기서 1차 항체로는 anti-αSMA Ab (Abcam, ab7817), anti-GAPDH Ab (Santa Cruz, sc-32233)을, 2차 항체로는 HRP-conjugated anti-mouse IgG Ab (CST, #7076))을 사용하여 αSMA 및 GAPDH의 단백질 발현 수준을 확인하였다.
2. 결과
도 2b에서는 인간 간성상세포가 섬유화하는 정도에 대해 αSMA 단백질 밴드의 진하기와 굵기로 보아 본 발명의 조성물이 모든 rhHAPLN1 단백질 함량범위에서 피르페니돈에 비해 훨씬 우수한 항섬유화 작용을 나타낸다는 것을 Western blot 밴드 사진으로부터 확인할 수 있었다.
또한 도 2c에서는 TGFβ1(2 ng/ml)으로 섬유화를 유도한 후 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 처리한 경우 모든 rhHAPLN1 단백질 함량범위에서 유의하게 간 성상세포 활성 마커로서 αSMA의 발현 수준이 낮게 나타나 항섬유화 효능을 보여주었다. 특히 본 발명의 조성물 중 rhHAPLN1 단백질 함량 3 ng/ml의 샘플에서 가장 우수한 항섬유화 효능을 나타내었는데 이는 피르페니돈 100μg/mL(100000 ng/ml)은 물론 그보다 고용량인 피르페니돈 200μg/mL(200000 ng/ml)보다 200000분의 3 함량임에도 불구하고 항섬유화 효능은 훨씬 더 높은 결과를 나타내었다.
[실시예 3]
인간 결장 섬유아세포주에 대한 본 발명의 조성물의 항섬유화 효능의 평가
인간 결장 섬유아세포주(Human Colon Fibroblast Cell Line, CCD-18Co)를 시료로 하여 장 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 검증하였다.
1. 실험 방법
(1) 도 3a의 실험 계획에 따라 인간 결장 섬유아세포주(CCD-18Co (human colon fibroblast cell line; ATCC, CRL-1459))를 6 웰 플레이트에 분주(seeding)(1.5 X 105 cells/well)하고 10% 소태아혈청(FBS)가 포함된 EMEM(Eagle's minimum essential medium, ATCC) 배지 중 37℃ 5% CO2 조건의 인큐베이터에서 24시간 동안 인큐베이트하였다.
(2) 무혈청 EMEM 배지로 교체 후 24시간 동안 인큐베이트하였다.
(3) 이에 대해 TGF-β(10 ng/ml)을 처리하여 섬유화를 유도하고 24시간 동안 인큐베이트하였다.
(4) 이후 플레이트의 각 웰에 본 발명의 조성물을 rhHAPLN1 단백질 함량 0, 3, 10, 30, 및 100 ng/ml과 피르페니돈 100μg/mL, 및 200μg/mL으로 각각 처리한 후 24시간 동안 인큐베이트하였다.
(5) 이후 각각의 샘플에 대해 세포 용해 완충액으로 처리한 후 회수하였다.
(6) 이에 대해 Western blot을 진행하였다. 여기서 1차 항체로는 anti-αSMA Ab (Abcam, ab7817), anti-GAPDH Ab (Santa Cruz, sc-32233)을, 2차 항체로는 HRP-conjugated anti-mouse IgG Ab (CST, #7076))을 사용하여 αSMA 및 GAPDH의 단백질 발현 수준을 확인하였다.
2. 결과
도 3b에서는 인간 결장 섬유아세포가 섬유화하는 정도에 대해 αSMA 단백질 밴드의 진하기와 굵기로 보아 본 발명의 조성물이 모든 rhHAPLN1 단백질 함량범위에서 피르페니돈에 비해 훨씬 우수한 항섬유화 작용을 나타낸다는 것을 Western blot 밴드 사진으로부터 확인할 수 있었다.
또한 도 3c에서는 TGFβ1(10 ng/ml)으로 섬유화를 유도한 후 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 처리한 경우 모든 rhHAPLN1 단백질 함량범위에서 유의하게 근섬유아세포(myofibroblast) 마커로서의 αSMA의 발현 수준이 낮게 나타나 항섬유화 효능을 보여주었다. 참고로 장 섬유화(Intestinal fibrosis)에서 섬유아세포(myofibroblast)는 근섬유아세포로 변이(transition)되어 섬유조직을 과도하게 만들어 낸다.
특히 본 발명의 조성물 중 rhHAPLN1 단백질 함량 10 ng/ml의 샘플에서 가장 우수한 항섬유화 효능을 나타내었는데 이는 피르페니돈 100μg/mL(100000 ng/ml)보다 10000분의 1 함량임에도 불구하고 TGFβ1에 의해 유도된 αSMA의 정도를 rhHAPLN1은 71.6% 저해((3.82-1.8)/(3.82-1)*100), 피르페니돈은 10.6% 저해된 것 ((3.82-3.52)/(3.82-1)*100)으로 계산되어 약물끼리 효능 비교시 항섬유화 효능은 약 7배 높으며, 피르페니돈 200μg/mL(200000 ng/ml)보다는 20000분의 1 함량임에도 불구하고 항섬유화 효능이 2배보다 훨씬 높은 것을 나타내었다.
피르페니돈은 200μg/mL가 100μg/mL보다 αSMA의 발현 수준이 높게 나타나므로 고농도에서 항섬유화 효능이 오히려 더 떨어지며 100μg/mL가 피르페니돈의 최적 항섬유화 농도인 것으로 추측할 수 있다. 그렇다면 본 발명의 조성물은 시판되는 항섬유화제인 피르페니돈에 비해 항섬유화 효능이 탁월하게 뛰어나다는 것을 알 수 있다.
[실시예 4]
인간 미세혈관 내피세포에 대한 본 발명의 조성물의 항섬유화 효능의 평가
인간 심장 미세혈관 내피세포(Human Cardiac Microvascular Endothelial Cell, HCMEC)를 시료로 하여 심장 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 검증하였다.
1. 실험 방법
(1) 도 4a의 실험 계획에 따라 일차 인간 심장 미세혈관 내피세포(Primary Human Cardiac Microvascular Endothelial Cell (HCMEC; ScienCell, #6000))를 6 웰 플레이트에 분주(seeding)(5.7 X 104 cells/well)하고 내피 세포 배지(Endothelial cell medium) (ScienCell)상에서 37℃ 5% CO2 조건의 인큐베이터에서 24시간 동안 인큐베이트하였다.
(2) 이에 대해 TGFβ1(5 ng/ml)을 처리하여 섬유화를 유도하고 3일 동안 인큐베이트하였다.
(3) 이후 플레이트의 각 웰에 본 발명의 조성물을 rhHAPLN1 단백질 함량 0, 3, 10, 30, 및 100 ng/ml과 피르페니돈 100μg/mL, 및 200μg/mL으로 각각 처리한 후 2일 동안 인큐베이트하였다.
(4) 이후 각각의 샘플에 대해 세포 용해 완충액(cell lysis buffer)으로 처리한 후 회수(harvest)하였다.
(5) 이에 대해 Western blotting을 진행하였다. 여기서 1차 항체로는 anti-αSMA Ab (Abcam, ab7817), anti-GAPDH Ab (Santa Cruz, sc-32233)을, 2차 항체로는 HRP-conjugated anti-mouse IgG Ab (CST, #7076))을 사용하여 αSMA 및 GAPDH의 단백질 발현 수준을 확인하였다.
2. 결과
도 4b에서는 인간 심장 미세혈관 내피세포가 섬유화하는 정도에 대해 αSMA 단백질 밴드의 진하기와 굵기로 보아 본 발명의 조성물이 모든 rhHAPLN1 단백질 함량범위에서 피르페니돈에 비해 훨씬 우수한 항섬유화 작용을 나타낸다는 것을 Western blot 밴드 사진으로부터 확인할 수 있었다.
또한 도 4c에서는 TGFβ1(5 ng/ml)으로 섬유화를 유도한 후 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 처리한 경우 모든 rhHAPLN1 단백질 함량범위에서 유의하게 근섬유아세포(myofibroblast) 마커로서의 αSMA의 발현 수준이 낮게 나타나 항섬유화 효능을 보여주었다. 참고로 심장 섬유화(Cardiac fibrosis)에서 내피세포는 근섬유아세포로 변이되어 섬유조직을 과도하게 만들어 낸다.
특히 본 발명의 조성물 중 rhHAPLN1 단백질 함량 3 ng/ml의 샘플에서 가장 우수한 항섬유화 효능을 나타내었는데 이는 피르페니돈 100μg/mL(100000 ng/ml)보다 100000분의 3 함량임에도 불구하고 피르페니돈에서 나타나지 않은 항섬유화 효능이 나타났으며, 피르페니돈 200μg/mL(200000 ng/ml)보다는 200000분의 3 함량임에도 불구하고 피르페니돈에서 나타나지 않은 항섬유화 효능이 나타났다.
피르페니돈은 그 어떠한 농도로 처리하더라도 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 αSMA의 발현 수준이 높게 나타나므로 심장 미세혈관 내피세포에서는 항섬유화 효능이 오히려 더 떨어진다는 것을 알 수 있다. 그렇다면 본 발명의 조성물은 적어도 심장 미세혈관 내피세포에 있어서는 거의 유일한 항섬유화 제제가 될 수 있다는 것을 시사한다.
[실시예 5]
정상 인간 폐 섬유아세포에 대한 본 발명의 조성물의 항섬유화 효능의 평가
정상 인간 폐 섬유아세포(Normal Human Lung Fibroblast, NHLF)를 시료로 하여 폐 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 검증하였다.
1. 실험 방법
(1) 9계대 배양한 정상 인간 폐 섬유아세포(NHLF)를 6 웰 플레이트에 분주(seeding)(1.0 X 105 cells/well)하고 FBM-2(Fibroblast Growth Medium-2, CC-3131, Lonza) 배지 중 37℃ 5% CO2 조건의 인큐베이터에서 24시간 동안 인큐베이트하였다.
(2) 무혈청 배지로 교체 후 24시간 동안 인큐베이트하였다.
(3) 이에 대해 TGFβ1(10 ng/ml)을 처리하여 섬유화를 유도한 조건에서 플레이트의 각 웰에 본 발명의 조성물을 rhHAPLN1 단백질 함량 0, 3.1, 12.5, 25, 및 100 ng/ml과 피르페니돈(Selleckchem) 100μg/mL, 및 200μg/mL으로 각각 처리한 후 24시간 동안 인큐베이트하였다.
(4) 이후 각각의 샘플을 인산완충식염수(phosphate buffered saline ; PBS, pH 7.2)로 2회 세척한 후 Western blot으로 근섬유아세포의 마커인 αSMA의 발현 정도를 확인하였다.
2. 결과
도 5a에서는 정상 인간 폐 섬유아세포가 섬유화하는 정도에 대해 αSMA 단백질 밴드의 진하기와 굵기로 보아 본 발명의 조성물이 모든 rhHAPLN1 단백질 함량범위에서 피르페니돈에 비해 훨씬 우수한 항섬유화 작용을 나타낸다는 것을 Western blot 밴드 사진으로부터 확인할 수 있었다.
또한 도 5b에서는 TGFβ1(10 ng/ml)으로 섬유화를 유도한 후 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 처리한 경우 모든 rhHAPLN1 단백질 함량범위에서 유의하게 근섬유아세포(myofibroblast) 마커로서의 αSMA의 발현 수준이 낮게 나타나 항섬유화 효능을 보여주었다.
특히 본 발명의 조성물 중 rhHAPLN1 단백질 함량 12.5 ng/ml의 샘플에서 가장 우수한 항섬유화 효능을 나타내었는데 이는 피르페니돈 100μg/mL(100000 ng/ml)보다 10000분의 1 함량임에도 불구하고 항섬유화 효능은 약 2배 높으며, 피르페니돈 200μg/mL(200000 ng/ml)에 대해서도 마찬가지로 약 2배보다 높은 것을 나타내었다.
피르페니돈은 그 어떠한 농도로 처리하더라도 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 αSMA의 발현 수준이 거의 차이가 없으므로 적어도 폐 섬유아세포에서는 항섬유화 효능이 없다는 것을 알 수 있다. 그렇다면 본 발명의 조성물은 폐 섬유아세포에 있어서는 거의 유일한 항섬유화 제제가 될 수 있다는 것을 시사한다.
[실시예 6]
인간 신장 신세관세포에 대한 본 발명의 조성물의 섬유화 예방 효능의 평가
인간 신장 신세관 세포(Human Kidney 2, HK-2)의 상피 세포주를 시료로 하여 신장 섬유화에 대한 본 발명의 조성물의 섬유화 예방 작용을 검증하였다.
1. 실험 방법
(1) 도 6a의 실험 계획에 따라 인간 신장 신세관 세포(HK-2)를 6 웰 플레이트에 분주(seeding)(1.0 X 105 cells/well)하고 10% FBS가 포함된 RPMI 1640 Medium (11875-093, Gibco) 배지 중 37℃ 5% CO2 조건의 인큐베이터에서 24시간 동안 인큐베이트하였다.
(2) 이후 PBS로 여러 번 세척하고 플레이트의 각 웰에 TGFβ1(5 ng/ml) 및 본 발명의 조성물(rhHAPLN1 단백질 함량 0, 5, 10, 20, 및 50 ng/ml)과 피르페니돈 0.2mg/mL(200μg/mL)로 각각 동시에 처리한 후 24시간 동안 인큐베이트하였다.
(3) 이후 각각의 샘플에 대해 빙냉(ice-cold) PBS로 여러 번 세척 후, 프로테아제, 포스파타아제 억제제를 포함한 RIPA(Radioimmunoprecipitation assay) Lysis and Extraction Buffer (Thermo Scientific)를 처리 후, 스크레이퍼로 긁어 prep 후, E-tube로 옮겼다.
(4) 원심분리(12000rpm, 20분, 4℃)하여 상층액만 취하여 BCA(Bicinchoninic Acid) 어세이를 실시하고 단백질 정량값을 얻었다.
(5) 얻은 정량값으로 정량 후, 100℃에서 cooking을 3분 실시하고 나서 -20℃ 냉장고에 보관하였다.
(6) 4-15% precast acrylamide PAGE gel을 사용하여 단백질을 레인당 10μg씩 로딩하고 주행시켰다(80V-20분, 120V-1h 30분).
(7) 100V- 1시간30분으로 바꾸고 smart blocker로 약 5분정도 블로킹하였다.
(8) 1차 항체를 1% BSA- TBST에 1:1000으로 희석하여 분주해주고 4℃에서 밤새(overnight) 반응시켰다.
(9) 다음 날 TBST로 10분씩 3회 세척하였다.
(10) 2차항체를 1% BSA-TBST(Bovine Serum Albumin-Tris-Buffered Saline & Polysorbate 20)에 1:2000으로 희석하여 분주해주고 실온(Room Temperature)에서 약 1시간동안 진탕(shaking)시켰다.
(11) 다시 TBST로 10분씩 3회 세척 후, Chemidoc으로 검출하였다.
2. 결과
도 6b에서는 인간 신장 신세관세포가 섬유화하는 정도에 대해 αSMA 단백질 밴드의 진하기와 굵기로 보아 본 발명의 조성물이 특정 rhHAPLN1 단백질 함량범위(rhHAPLN1 단백질 함량 50 ng/ml)에서 피르페니돈에 비해 우수한 섬유화 예방 작용을 나타낸다는 것을 Western blot 밴드 사진으로부터 확인할 수 있었다.
또한 도 6c에서는 TGF-β(5 ng/ml)로 섬유화를 유도한 후 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 rhHAPLN1 단백질 함량 50 ng/ml으로 처리한 경우 우수한 섬유화 예방 효능을 나타내었는데 이는 피르페니돈 200μg/mL(200000 ng/ml)보다 4000분의 1 함량임에도 불구하고 섬유화 예방 효능은 훨씬 더 높은 결과를 보여주는 것이었다.
[실시예 7]
인간 신장 신세관세포에 대한 본 발명의 조성물의 항섬유화 효능의 평가
인간 신장 신세관 세포(Human Kidney 2, HK-2)의 상피 세포주를 시료로 하여 신장 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 검증하였다.
1. 실험 방법
(1) 도 7a의 실험 계획에 따라 인간 신장 신세관 세포(HK-2)를 60 웰 플레이트에 분주(seeding)(2.8 X 105 cells/well)하고 10% FBS가 포함된 RPMI 1640 Medium (11875-093, Gibco) 중 37℃ 5% CO2 조건의 인큐베이터에서 24시간 동안 인큐베이트하였다.
(2) 이후 PBS로 여러 번 세척하고 플레이트의 각 웰에 TGFβ1(5 ng/ml)으로 처리하여 24시간 동안 인큐베이트하였다.
(3) 이어서 본 발명의 조성물(rhHAPLN1 단백질 함량 0, 5, 10, 20, 및 50ng/ml)과 피르페니돈 0.2mg/mL(200μg/mL)로 각각 처리한 후 48시간 동안 인큐베이트하였다.
(4) 이후 각각의 샘플에 대해 빙냉(ice-cold) PBS로 여러 번 세척 후, 프로테아제, 포스파타아제 억제제를 포함한 RIPA(Radioimmunoprecipitation assay) Lysis and Extraction Buffer (Thermo Scientific)를 처리 후, 스크레이퍼로 긁어 prep 후, E-tube로 옮겼다.
(5) 원심분리(12000rpm, 20분, 4℃)하여 상층액만 취하여 BCA 어세이를 실시하고 단백질 정량값을 얻었다.
(6) 얻은 정량값으로 정량 후, 100℃에서 cooking을 3분 실시하고 나서 -20℃ 냉장고에 보관하였다.
(7) 8% precast acrylamide PAGE gel을 사용하여 단백질을 레인당 10μg씩 로딩하고 주행시켰다(80V-20분, 120V-1h 30분).
(8) 100V- 1시간30분으로 바꾸고 smart blocker로 약 5분정도 블로킹하였다.
(9) 1차 항체를 1% BSA- TBST에 1:1000으로 희석하여 분주해주고 4℃에서 밤새 반응시켰다.
(10) 다음 날 TBST로 10분 씩 3회 세정하였다.
(10) 2차항체를 1% BSA- TBST에 1:2000으로 희석하여 분주해주고 실온에서 약 1시간동안 진탕시켰다.
(11) 다시 TBST로 10분 씩 3회 세척 후, Chemidoc으로 검출하였다.
2. 결과
도 7b에서는 인간 신장 신세관세포가 섬유화하는 정도에 대해 αSMA 단백질 밴드의 진하기와 굵기로 보아 본 발명의 조성물이 특정 rhHAPLN1 단백질 함량범위(rhHAPLN1 단백질 함량 10 내지 50 ng/ml)에서 항섬유화 작용을 나타낸다는 것을 Western blot 밴드 사진으로부터 확인할 수 있었다.
또한 도 7c에서는 TGF-β(10 ng/ml)로 섬유화를 유도한 후 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 rhHAPLN1 단백질 함량 10 내지 50 ng/ml으로 처리한 경우, 특히 rhHAPLN1 단백질 함량 50 ng/ml으로 처리한 경우에 탁월한 항섬유화 효능을 나타내었음을 보여주었다. 본 발명의 조성물 50 ng/ml으로 처리한 경우는 피르페니돈 0.2mg/ml, 즉 200ng/ml에 비해 1/4의 소량임에도 불구하고 피르페니돈과 거의 동등한 항섬유화 효능을 나타낸 것은 상당히 주목할 만하다.
[실시예 8]
인간 신장 신세관세포에 대한 본 발명의 조성물의 항섬유화 효능에 따른 세포 형태학적 변화의 관찰
인간 신장 신세관 세포(Human Kidney 2, HK-2)의 상피 세포주를 시료로 하여 신장 섬유화에 대한 본 발명의 조성물의 항섬유화 작용을 세포의 형태 변화 관찰을 통해 검증하였다.
1. 실험 방법
(1) 도 8a의 실험 계획에 따라 인간 신장 신세관 세포(HK-2)를 6 웰 플레이트에 분주(seeding)(3.0 X 105 cells/well)하고 10% FBS가 포함된 RPMI 1640 Medium (11875-093, Gibco) 중 37℃ 5% CO2 조건의 인큐베이터에서 24시간 동안 인큐베이트하였다.
(2) 이후 PBS로 여러 번 세척하고 플레이트의 각 웰에 TGFβ1(10 ng/ml)으로 처리하여 24시간 동안 인큐베이트하였다.
(3) 이어서 본 발명의 조성물(rhHAPLN1 단백질 함량 0, 5, 10, 20, 50 및 100ng/ml)과 피르페니돈 0.2mg/mL(200μg/mL)으로 각각 처리한 후 24시간 동안 인큐베이트하였다.
(4) 이후 각각의 샘플을 담고 있는 웰에 대해 1X PBS로 2회 세척 후, 4% 파라포름알데히드를 처리하고 1시간 동안 고정하였다.
(5) 1X PBS로 2회 세척 후, 현미경 하에서 세포의 모양 내지 형태를 관찰하였다.
2. 결과
도 8b에서는 세포의 형태가 처리한 물질에 따라 다양하게 나타나 있다. 아무런 처리를 하지 않은 정상 세포인 대조군(control)에서는 세포의 형태가 둥글게 나타나 있으나, 10ng/ml TGFβ1 처리에 의해 둥글었던 세포 모양이 섬유화 형태로 뾰족하게 변하는 모습이 확인되었다.
그러나 이에 대해 다양한 rhHAPLN1 단백질 함량을 갖는 본 발명의 조성물을 가함에 따라 세포의 모양이 피르페니돈에서의 경우와 마찬가지로 둥글게 바뀌는 결과를 볼 수 있었다.
이에 따라 본 발명의 조성물은 확실히 세포에 대한 우수한 항섬유화 효능을 나타내었음을 알 수 있다.
[실시예 9]
신장 근위 세뇨관 상피세포에 대한 본 발명의 조성물의 항섬유화 효능의 평가 1
신장 근위 세뇨관 상피 세포(Renal Proximal Tubule Epithelial Cells, RPTEC)의 일차 상피세포(primary epithelial cell)를 시료로 하여 노화 유도로 인한 신장 섬유화에 대해 본 발명의 조성물이 갖는 항섬유화 작용을 검증하였다.
1. 실험 방법
(1) 3 계대배양과 10 계대배양의 신장 근위 세뇨관 상피 세포(RPTEC)를 60Φ 배양접시에 분주(seeding)(5.0 X 105 cells)하고 완전한 Renal Epithelial Cell Medium (ATCC PCS-400-030+ATCC PCS-400-040) 중 37℃ 5% CO2 조건의 인큐베이터에서 24시간 동안 배양하였다.
(2) 이어서 본 발명의 조성물(rhHAPLN1 단백질 함량 0, 10, 및 100ng/ml)을 각각 처리한 후 72시간 동안 추가로 배양하였다.
(4) 이후 빙냉 PBS로 3번 세척한 후, 각 웰 당 프로테아제 억제제, 및 포스페이타제 억제제를 포함한 RIPA Lysis and Extraction Buffer 300μl을 처리하여 스크레이퍼로 긁어서 세포를 회수한 후 E-tube로 옮겼다.
(5) 원심분리(12000rpm, 20분, 4℃)하여 상층액만 취하여 BCA 어세이를 실시하고 단백질 정량값을 얻었다.
(6) 4-15% precast acrylamide PAGE 겔을 사용하여 단백질을 레인당 20μg씩 로딩하고 주행시켰다(80V-20분, 120V-1h 30분).
(7) 이에 대해 Western blot을 진행하였다. 여기서 1차 항체로는 anti-αSMA Ab (Abcam, ab7817), anti-GAPDH Ab (Santa Cruz, sc-32233)을, 2차 항체로는 HRP-conjugated anti-mouse IgG Ab (CST, #7076))을 사용하였다.
2. 결과
도 9a에서 보는 바와 같이 세포의 노화가 진행됨에 따라 즉 계대배양의 횟수가 4에서 11로 증가함에 따라 αSMA 단백질의 발현량이 증가한 것을 Western blot 밴드 사진에 있어서 단백질 밴드의 진하기와 굵기가 강해진 것으로부터 알 수 있다.
또한 도 9b에서는 노화된 세포(P11)에 있어서, rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 rhHAPLN1 단백질 함량 100ng/ml으로 처리한 경우, αSMA 단백질의 발현량이 약 3분의 1 정도나 감소한 것으로 나타났다. 즉 탁월한 항섬유화 효능을 나타내었음을 보여주었다.
[실시예 10]
신장 근위 세뇨관 상피세포에 대한 본 발명의 조성물의 항섬유화 효능의 평가 2
신장 근위 세뇨관 상피 세포(Renal Proximal Tubule Epithelial Cells, RPTEC)의 일차 상피세포(primary epithelial cell)를 시료로 하여 노화 유도로 인한 신장 섬유화에 대해 본 발명의 조성물이 갖는 항섬유화 작용을 검증하였다.
1. 실험 방법
(1) 3 계대배양과 10 계대배양의 신장 근위 세뇨관 상피 세포(RPTEC)를 12 웰 플레이트에 분주(seeding)(1.5 X 105 cells)하고 완전한 Renal Epithelial Cell Medium (ATCC PCS-400-030+ATCC PCS-400-040) 중 37℃ 5% CO2 조건의 인큐베이터에서 24시간 동안 배양하였다.
(2) 이어서 본 발명의 조성물(rhHAPLN1 단백질 함량 0, 10, 20, 50 및 100ng/ml)과 피르페니돈 0.2mg/mL(200μg/mL)으로 각각 처리한 후 72시간 동안 배양하였다.
(3) 이후 각 웰을 PBS로 2회 세척한 후, 4% 파라포름알데히드를 처리하고 1시간 동안 고정하였다.
(4) 1X PBS로 4회 세척 후, 1% BSA를 포함한 1x PBST (1x PBS + 0.1% Triton X-100)를 처리하고 2시간 블로킹하였다.
(5) αSMA에 대한 1차 항체 (Abcam ab7817)를 1XPBSTdp 1:200으로 희석하여 처리해주고 4℃에서 밤새 인큐베이트하였다.
(6) 다음 날 1X PBST를 이용하여 4회 세척하였다.
(7) 2차 항체(anti-mouse IgG Alexa FluorTM 488 1:500 (Invitrogen, A28175))와 DAPI 1:2000 (Invitrogen, D1306) 처리 후 상온에서 1시간 인큐베이트했다.
(8) 이후 Vectashield (Vectorlabs, H-1000)를 50ul 떨어뜨려준 후 커버슬립을 덮고 형광현미경으로 촬영하였다.
2. 결과
도 10a에서 보는 바와 같이 세포의 노화가 진행됨에 따라 즉 계대배양의 횟수가 4에서 11로 증가함에 따라 αSMA 단백질의 발현량이 증가한 것, 즉 섬유화가 진행된 것을 계대배양 11의 우측사진에서 밝은 형광 부위가 증가된 것으로부터 확인할 수 있다.
또한 도 10b에서는 노화된 세포(11 계대배양)에 있어서, rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물로 처리할 경우 rhHAPLN1 단백질 함량이 증가함에 따라, 특히 rhHAPLN1 단백질 함량 50 및 100ng/ml의 경우 피르페니돈을 처리한 경우와 마찬가지로 염색된 형광 부위가 적게 나타나는 것으로 확인되었다. 그런데 피르페니돈의 함량이 0.2mg/mL(200000ng/mL)이므로 본 발명의 조성물 중 rhHAPLN1 단백질 함량이 피르페니돈의 4000분의 1 내지 2000분의 1에 지나지 않는다는 것을 감안한다면 본 발명의 조성물은 종래의 항섬유화 제제에 비해 탁월한 항섬유화 효능을 나타내었음을 알 수 있다.
[실시예 11]
각종 항섬유화 마커를 이용한 본 발명의 조성물의 항섬유화 효능의 평가
BioMAP Fibrosis Panel(Eurofins discovery 제공)을 이용하여 각종 섬유화 마커의 발현 정도를 살펴봄으로써 폐 섬유화 및 신장 섬유화에 대해 본 발명의 조성물이 갖는 항섬유화 작용을 검증하였다.
BioMAP Fibrosis panel은 SAEMyoF 시스템(co-culturing small airway epithelial cells and adult fibroblasts), REMyoF 시스템(co-culture of renal proximal tubule epithelial cells and adult fibroblasts), 및 MyoF 시스템(differentiated lung myofibroblasts)의 세가지 모델로 구성되어 있다. 여기서 SAEMyoF 시스템은 특발성 폐섬유증(idiopathic pulmonary fibrosis, IPF)과 같은 폐 섬유성 질환(pulmonary fibrotic diseases)를 포함한 간질성 폐질환(interstitial lung diseases, IDL)을 대표하며, REMyoF 시스템은 말기 신부전(end-stage renal failure)과 관련되어 있는 신장 섬유증(kidney fibrosis) 질환을 대표한다. 다만 MyoF 시스템은 근섬유아세포에만 미치는 영향을 파악하기 위해 실험을 수행하였다.
1. 실험 방법
(1) 각각의 일차세포는 여러 donor (n=3-6) 유래 세포를 풀화(pooling)하여 사용하였으며, 먼저 96-웰 플레이트에 세포를 컨플루언트해지도록 배양한 후 말초 혈액 단핵 세포(peripheral blood mononuclear cell, PBMC) 첨가하였다.
(2) 이어서 본 발명의 조성물(rhHAPLN1 단백질 함량 0, 3.7, 11, 및 33ng/ml)을 농도별로 각각 처리하고 1시간 동안 배양하였다.
(3) 이후 TNFα 및 TGFβ1으로 처리하고 48시간 동안 인큐베이트하였다.
(4) 각종 바이오마커의 발현 수준에 대해 direct ELISA(Enzyme-Linked Immunosorbent Assay)를 진행하였다.
2. 결과
각각의 정량값은 vehicle 대조군(control)에 대비하여 상대적 배수변화 수치(fold change)로 비교하였다. 통계처리는 unpaired t-test, significant differences vs vehicle control, *p<0.05,**p<0.01 및 ***p<0.001로 진행하였다.
실험 결과에 따르면 폐 섬유증 질환 모델인 SAEMyoF 시스템에서 본 발명의 조성물(rhHAPLN1)의 αSMA 및 collagen I에 대한 유의적인 감소 효과를 확인하였다(도 11a). 즉 αSMA의 경우 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 처리하면 조성물 중의 rhHAPLN1 단백질의 함량에 무관하게 일관되게 0.9배 이하로 αSMA의 발현량이 줄어든 것을 확인할 수 있었다. 또한 collagen I의 경우 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 처리하면 조성물 중의 rhHAPLN1 단백질의 함량에 무관하게 일관되게 collagen I의 발현량이 탁월하게 줄어든 것을 확인할 수 있었다. 특히 조성물 중의 rhHAPLN1 단백질의 함량이 11ng/ml의 경우 0.8배 이하로 collagen I의 발현량이 줄어들었다.
나아가 신장 섬유증 질환 모델인 REMyoF 시스템에서는 본 발명의 조성물(rhHAPLN1)의 collagen I에 대한 유의적인 감소 효과를 확인하였다(도 11b). 즉 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 처리하면 조성물 중의 rhHAPLN1 단백질의 함량에 관계없이 collagen I의 발현량이 0.9배 이하로 줄어든 것을 확인할 수 있었다. 특히 조성물 중의 rhHAPLN1 단백질의 함량이 11ng/ml의 경우 거의 0.7배로 collagen I의 발현량이 줄어든 것을 보면 이 농도가 신장에서의 항섬유화 효능을 나타내기 위한 최적의 농도인 것으로 추측할 수 있었다.
한편 근섬유아세포와 관련된 MyoF 시스템에서는 본 발명의 조성물(rhHAPLN1)의 collagen IV에 대한 유의적인 감소 효과를 확인하였다(도 11c). 즉 rhHAPLN1 단백질이 포함되지 않은 조성물로 처리한 경우에 비하여 본 발명의 조성물을 처리하면 조성물 중의 rhHAPLN1 단백질의 함량에 비례하여 collagen I의 발현량이 0.8배 이하로 줄어든 것을 확인할 수 있었다. 따라서 조성물 중의 rhHAPLN1 단백질의 함량이 33ng/ml의 경우 0.7배로 collagen IV의 발현량이 줄어들었다.
[실시예 12]
폐 섬유화 유발 동물 모델을 이용한 본 발명의 조성물의 항섬유화 효능(섬유성 질환의 예방능)의 평가
본 발명의 조성물을 폐 섬유화를 유발한 동물에 반복 흡입투여하여 블레오마이신 유도 폐섬유화증(BILP)을 예방하는 효과를 검증한 실험을 수행하였다.
1. 실험동물의 준비 및 사육
실험동물은 C57BL/6N(KBSI, 대전시, 대한민국) 마우스 8주 령 암컷을 사용하고 정상 대조군(Normal, PBS)과 2개 용량의 투여군(rhHAPLN1 단백질을 포함하는 본 발명의 조성물)으로 설정했다. 물은 이틀에 한 번씩 교환하고 자유롭게 먹도록 하였고 마우스는 4마리씩 1 케이지로 놓고 사육실 내의 온도는 21~24℃, 습도는 40%~60%로 유지하였고 낮과 밤의 주기는 각각 12시간으로 하였다.
2. 폐조직의 염색 및 현미경 관찰
블레오마이신(bleomycin) 유도 폐 섬유증(Pulmonary fibrosis, PF) 모델을 구축하기 위해 C57BL/6N mice 8주령 암컷을 사용하고, 4개의 군(Normal, Control, 0.0005%(w/w) rhHAPLN1, 0.0015%(w/w) rhHAPLN1)으로 나누고 군당 4마리로 설정하였으며 IPF 질병 유발 방법은 Liu 등의 논문(Methods in Molecular Biology 2017, DOI: 10.1007/978-1-4939-7113-8_2)을 참조하였다(도 12a 참조). 특발성 폐 섬유증(IPF)을 유도하기 위한 블레오마이신(Bleomycin sulfate from Streptomyces verticillus. B8416; Sigma-Aldrich Co.)의 투여는 1ml-시린지와 경구투여용 니들(Oral Zonde Needle 0.9x50mm; 20Guage)을 사용하여 마취를 행한 후 2U/kg의 농도로 25 μl 1회 경구 기관내(Orally intratracheal)로 조심스럽게 투여한 후(instillation), 신선한 10 ml 인산완충식염수(phosphate-buffered saline) (1X PBS, pH 7.4, Gibco Co.)을 연무기(nebulizer)에 점적 첨가하여 연무를 발생(nebulization)시켜 자유롭게 흡입하도록 하였다.
블레오마이신 투여 1일 후부터 대조군(Control)은 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% 글리세롤(glycerol)로 조성된 스톡 용액 50 μl과 10 ml PBS (1X, pH 7.4, Gibco Co.) 용액의 혼합액으로, 본 발명의 조성물에 관한 2개 군에 대해서는 rhHAPLN1 스톡 용액 50 μl 중 rhHAPLN1 중량비 농도 0.0005%(w/w), 즉 5000ng/mL, 및 0.0015%(w/w), 즉 15000ng/mL으로 조정한 후, 10 ml PBS(1X, pH 7.4, Gibco Co.)에 각각 혼합하고, 상기의 연무기(nebulizer)을 통해 연무(nebulization) 방식으로 1일 1회 1시간씩 군별로 투여하였다. 실험동물 각각의 무게는 2일마다 측정하여 무게 변화가 없음을 확인하고, 연무발생을 위해 Mass Dosing System과 Aerosol Chamber (Data Science International Co.)을 사용하였다.
총 실험 기간은 12일간이고 실제 각 농도의 재조합 HAPLN1 단백질 투여는 매일 1회 1시간씩 10일간 10회 투여한 후 11일째 마취 후 해부를 진행하였다.
3. 결과
가. 폐 조직의 사진상의 비교
도 12b는 폐조직을 적출한 다음 좌측 큰 엽을 가로로 반을 자르고 윗부분을 포르말린에 넣어서 고정하고 헤마톡신 및 에오신(H&E) 염색을 행한 사진이다. 사진 상으로 볼 때에 대조군에 비하여 본 발명의 조성물을 투여 시, 특히 rhHAPLN1 중량비 농도 0.0015%(w/w)의 경우 정상군에 상당히 유사한 형태를 나타낸다는 것을 알 수 있었다.
나. 수치로 나타낸 본 발명 조성물의 예방 효능
다음으로 마우스 왼쪽 큰엽의 중간부분을 잘라 한 마리 당 3장의 조직 슬라이드를 제작하고 한 슬라이드에서 임의로 각각 3군데를 사진 찍은 다음 총 9개의 부분에 대해 염색이 된 적색 부분과 그렇지 않은 흰색을 구분하고, Image J 소프트웨어를 이용하여 염색된 적색 부분의 면적을 측정하여 얻은 각 수치를 평균하여 마리 당 평균값을 얻었다. 적색 부분은 섬유화가 진행된 부분을 나타낸다.
또한, 나머지 3마리에 대해서도 같은 방법으로 반복하여 평균값을 얻은 후 이를 다시 재평균하여 최종적으로 섬유화를 반영한 면적의 평균 수치와 편차를 얻었다. 블레오마이신을 처리하지 않은 정상군과 이를 처리한 대조군 간의 유의성 P값은 0.00038(*** P <0.001)이며, 본 발명의 조성물(rhHAPLN1)을 처리하지 않은 군과 0.0015%(w/w) rhHAPLN1 처리군 간의 유의성 P값은 0.00355(** P <0.01)으로 나타나 통계적 유의성을 확인하였다.
이러한 평균값을 그래프로 나타낸 도 12c에 따르면 대조군에 비하여 본 발명의 조성물을 투여 시, 특히 rhHAPLN1 중량비 농도 0.0015%(w/w)의 경우 정상군에 상당히 근접하도록 적색부분의 면적 평균값이 감소되어 있는 것을 알 수 있다. 즉 본 발명의 조성물은 in vivo에서 폐 섬유화에 대해 예방 효과를 나타낸다는 점을 확인한 것이다.
다. Ashcroft 점수(score)에 따른 본 발명 조성물의 예방 효능
도 12d 및 12e는 폐 섬유화증의 중증도를 육안으로 간단히 측정할 수 있는 공식적인 지침을 설명하는 사진 및 설명(Ashcroft et al 1988, J Clin Pathol 41:467-470)이다.
섬유증의 등급은 다음과 같이 Ashcroft 점수(score)로 나눌 수 있다.
Score 0 : 일부 폐포벽에 대부분 얇고 작은 섬유가 관찰되기는 하나 뚜렷한 섬유성 형태나 부담이 보이지 않는다(정상 폐).
Score 1 : 고립된 부드러운 섬유화의 변화(격막두께가 정상의 3배보다 작거나 같음), 폐포가 부분적으로 확대되고 희박하지만 섬유성 종괴(덩어리)는 존재하지 않는다.
Score 2 : 명확한 섬유화 변화(격막두께가 정상의 3배보다 크다), 폐포가 부분적으로 확대되고 희박하지만 섬유성 종괴는 관찰되지 않다.
Score 3 : 전체 현미경 영역에서 주로 연속적인 섬유성 격벽이 확인되고(격막두께가 정상의 3배보다 크다), 폐포가 부분적으로 확대되고 희박하지만 섬유성 종괴는 존재하지 않는다.
Score 4 : 구조의 변화, 단일 섬유성 종괴는 현미경 영역의 10 %보다 작거나 같다.
Score 5 : 구조의 변화, 합쳐진 섬유성 종괴(현미경 영역의 10%보다 크고 50%보다 작거나 같다), 폐 구조가 심하게 손상되었지만 여전히 형태를 보존하고 있다.
Score 6 : 구조의 변화, 대부분 형태가 존재하지 않는다. 연속적인 섬유성 종괴(현미경 영역의 50%보다 크다) 대부분 보존되지 않은 폐 구조.
Score 7 : 폐포구조가 존재하지 않는다. 폐포는 섬유성 덩어리로 거의 없어졌지만 여전히 최대 5개의 기포가 존재한다.
Score 8 : 폐포구조가 존재하지 않는다. 현미경 영역에서 섬유성 종괴는 완전히 제거되었다.
위의 평가 기준에 근거하여 3명의 관찰자가 각각 같은 데이터로 다른 사람의 평가에 영향을 받지 않는 조건 하에 개인적으로 각각 판단하여 스코어를 매긴 후 각 결과를 종합하여 최종 평균 스코어를 결정한 결과 각 평가자의 결과는 매우 유사하였고 이중 대표 관찰자의 결과를 도 12f에 나타내었다.
결론적으로 정상군(Normal)은 Ashcroft score = 0, 대조군(Control)은 Ashcroft score = 6.25, 본 발명의 조성물 1(rhHAPLN1 0.0005%) 투여군은 Ashcroft score = 5.25, 본 발명의 조성물 2(rhHAPLN1 0.0015%) 투여군은 Ashcroft score = 0.5이었으며 정상군과 대조군, 대조군과 본 발명의 조성물 2 투여군 간에 통계적 유의성을 보였다.
[실시예 13]
폐 섬유화 유발 동물 모델을 이용한 본 발명의 조성물의 항섬유화 효능(섬유성 질환의 치료능)의 평가
본 발명의 조성물을 폐 섬유화를 유발한 동물에 반복 흡입투여하여 이미 발생된 블레오마이신 유도 폐섬유화증(BILP)을 개선하는 효과를 검증한 실험을 수행하였다. 여기서는 기본적으로 상기 실시예 12와 유사하나 블레오마이신 처리 후 7일을 경과시켜 블레오마이신 유도 폐섬유화증(BILP)을 충분히 발생시키고 이에 대해 본 발명의 조성물이 섬유성 질환의 치료능을 갖는다는 실험결과를 제시한다.
1. 실험동물의 준비 및 사육
상기 실시예 12의 경우와 동일하다.
2. 폐조직의 염색 및 현미경 관찰
블로오마이신(bleomycin) 유도 폐 섬유증(Pulmonary fibrosis, PF) 모델을 구축하기 위해 C57BL/6N mice 8주 내지 10주 령 암컷을 사용하고, 4개의 군(Normal, PBS Control, 0.00075%(w/w) rhHAPLN1, 0.0015%(w/w) rhHAPLN1)으로 나누고 군당 4마리로 설정하였으며 IPF 질병 유발 방법은 Liu 등의 논문(Methods in Molecular Biology 2017, DOI: 10.1007/978-1-4939-7113-8_2)을 참조하였다(도 13a 참조). 특발성폐섬유증(IPF)을 유도하기 위한 블레오마이신(Bleomycin sulfate from Streptomyces verticillus. B8416; Sigma-Aldrich Co.)의 투여는 1ml-시린지와 경구투여용 니들(Oral Zonde Needle 0.9x50mm; 20Guage)을 사용하여 마취를 행한 후 50U/kg의 농도로 마우스당 20 μl 1회 경구 기관내(Orally intratracheal)로 조심스럽게 투여한 후(instillation), 신선한 10 ml 인산완충식염수(phosphate-buffered saline) (1X PBS, pH 7.4, Gibco Co.)을 연무기(nebulizer)에 점적 첨가하여 연무를 발생(nebulization)시켜 자유롭게 흡입하도록 하였다.
블레오마이신 투여 8일 후부터 대조군(Control)은 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% 글리세롤(glycerol)로 조성된 스톡 용액 50 μl과 10 ml PBS (1X, pH 7.4, Gibco Co.) 용액의 혼합액으로 하였다. 본 발명의 조성물에 관한 2개 군에 대해서는 rhHAPLN1 스톡 용액(20 mM acetate, pH 5.0, 8.0 M sucrose, 0.04% PS80)을 인산 완충 염수(PBS)로 희석하여 50 μl 중 rhHAPLN1 중량비 농도 0.00075%(w/w), 즉 7500ng/mL, 0.0015%(w/w), 즉 15000ng/mL으로 조정하였다. 이 후, 10 ml PBS(1X, pH 7.4, Gibco Co.)에 각각 혼합하고, 상기의 연무기(nebulizer)을 통해 연무(nebulization) 방식으로 1일 1회 1시간씩 군별로 투여하였다(10ml/시간/14회/1일). 실험동물 각각의 무게는 2일마다 측정하여 무게 변화가 없음을 확인하고, 연무발생을 위해 Mass Dosing System과 Aerosol Chamber (Data Science International Co.)을 사용하였다.
총 실험 기간은 23일간이고 실제 각 농도의 재조합 인간 HAPLN1 단백질 투여는 매일 10ml을 1회 1시간씩 14일간 총14회 투여하고 최종 노출의 다음날 마취 후 해부를 진행하였다.
3. 결과
가. 폐 조직의 사진상의 비교
도 13b는 폐조직을 적출한 다음 좌측 큰 엽을 가로로 반을 자르고 윗부분을 포르말린에 넣어서 고정하고 헤마톡신 및 에오신(H&E) 염색을 행한 사진이다. 사진 상으로 볼 때에 대조군에 비하여 본 발명의 조성물을 투여시, 특히 rhHAPLN1 중량비 농도 0.0015%(w/w)의 경우 역시 정상군에 상당히 유사한 형태를 나타낸다는 것을 알 수 있었다.
나. 수치로 나타낸 본 발명 조성물의 치료 효능
다음으로 마우스 왼쪽 큰엽의 중간부분을 잘라 한마리 당 3장의 조직 슬라이드를 제작하고 한 슬라이드에서 임의로 각각 3군데를 사진 찍은 다음 총 9개의 부분에 대해 염색이 된 적색 부분과 그렇지 않은 흰색을 구분하고, Image J 소프트웨어를 이용하여 염색된 적색 부분의 면적을 측정하여 얻은 각 수치를 평균하여 마리 당 평균값을 얻었다. 적색 부분은 섬유화가 진행된 부분을 나타낸다.
또한, 나머지 3마리에 대해서도 같은 방법으로 반복하여 평균값을 얻은 후 이를 다시 재평균하여 최종적으로 섬유화를 반영한 면적의 평균 수치와 편차를 얻었다. 블레오마이신을 처리하지 않은 정상군과 이를 처리한 대조군 간의 유의성 P값은 0.00038(*** P <0.001)이며, 본 발명의 조성물(rhHAPLN1)을 처리하지 않은 군과 0.0015%(w/w) rhHAPLN1 처리군 간의 유의성 P값은 0.00355(** P <0.01)으로 나타나 통계적 유의성을 확인하였다.
이러한 평균값을 그래프로 나타낸 도 13c에 따르면 대조군에 비하여 본 발명의 조성물을 투여 시, 특히 rhHAPLN1 중량비 농도 0.0015%(w/w)의 경우 아무런 처리를 하지 않은 폐 섬유화증의 경우에 비하여 적색부분의 면적 평균값이 51%나 감소되어 있는 것을 알 수 있다. 즉 본 발명의 조성물은 in vivo에서 폐 섬유화에 대해 탁월한 치료 효과를 나타낸다는 점을 확인한 것이다. 이는 도 13d에서 또한 그래프화하였다. ***p<0.001, 스튜던트의 t-테스트로 계산하였다.
다. Ashcroft 점수(score)에 따른 본 발명 조성물의 치료 효능
실시예 12에서 설명한 바와 같은 평가 기준에 근거하여 3명의 관찰자가 각각 같은 데이터로 다른 사람의 평가에 영향을 받지 않는 조건하에 개인적으로 각각 판단하여 스코어를 매긴 후 각 결과를 종합하여 최종 평균 스코어를 결정한 결과 각 평가자의 결과는 매우 유사하였고 이중 대표 관찰자의 결과를 도 13e에 나타내었으며, 여기서도 본 발명의 조성물은 in vivo에서 폐 섬유화에 대해 예방효과는 물론 탁월한 치료 효과를 나타낸다는 점을 재차 확인할 수 있었다.
[실시예 14]
신장 섬유화 유발 동물 모델을 이용한 본 발명의 조성물의 항섬유화 효능의 평가
본 발명의 조성물을 급성 신장 섬유화를 유발한 동물에 반복 투여하여 치료하는 효과를 검증한 실험을 수행하였다.
1. 급성 신장 손상 유발 모델의 구축
도 14a의 실험 계획에 따라 8주령 C57BL/6 수컷 생쥐를 pentobarbital (50 mg/kg BW, i.p.) 마취 하에서 허혈을 유도하기 위해 옆구리를 절개하고, 신장을 노출시킨 후 비외상성 미세동맥류 클램프(non-traumatic microaneurysm clamp; Roboz Surgical Instruments)를 사용하여 양측 신장 pedicle을 막아 혈류를 25분 동안 차단하였다. 이어서 클램프를 제거 후 절개부위를 봉합하였다. 대조수술(sham-operation)은 혈류의 차단을 제외하고는 허혈/재관류(ischemia/reperfusion) 실험과 동일하게 수행하였다.
허혈 1일 후에 혈액요소질소(blood urea nitrogen, BUN)를 측정하여 그 값이 약 98 mg/dL(향후 100 mg/dL로 명기) 이상으로 올라간 생쥐들만을 실험군들로 grouping하여 실험을 진행하였다. 실험군들에게는 수술 후 7일째부터 본 발명의 조성물을 비롯한 각종 약물을 매일 투여하고 14일째에 신장을 취하여 조직학적 및 생화학적 분석에 사용하였다. 약물 농도는 표 1에, 실험군의 상세는 표 2에 나타낸다.
| 구성 성분 | |||
| rhHAPLN1 (0.2μg/μl) |
rhHAPLN1 buffer | PBS | |
| rhHAPLN1 dose A (0.1mg/kg B.W) | 12.5μl | 0μl | 187.5μl |
| rhHAPLN1 dose B (0.02mg/kg B.W) | 2.5μl | 10μl | 187.5μl |
| rhHAPLN1 dose C (0.004mg/kg B.W) | 0.5μl | 12μl | 187.5μl |
| rhHAPLN1 buffer (Vehicle) | 0μl | 12.5μl | 187.5μl |
| Pirfenidone (300mg/kg B.W) | |||
| 실험군(8 weeks C57BL/6 male mouse) | 총동물수(n) | 투여방법 | |
| Sham-rhHAPLN1 buffer (Vehicle) | (SV) | n=5 | Intraperitoneal injection |
| Sham-rhHAPLN1 dose B (0.02mg/kg B.W) | (SB) | n=5 | Intraperitoneal injection |
| IR-rhHAPLN1 buffer (Vehicle) | (IRV) | n=10 | Intraperitoneal injection |
| IR-pirfenidone (300mg/kg B.W) | (IRP) | n=10 | Oral administration |
| IR-rhHAPLN1 dose A (0.1mg/kg B.W) | (IRA) | n=10 | Intraperitoneal injection |
| IR-rhHAPLN1 dose B (0.02mg/kg B.W) | (IRB) | n=10 | Intraperitoneal injection |
| IR-rhHAPLN1 dose C (0.004mg/kg B.W) | (IRC) | n=10 | Intraperitoneal injection |
또한 약물투여 후 7일째에 혈액을 취하여 BUN농도를 측정하였고, 14일 후에는 혈액과 소변을 취하여, 혈액과 소변에서 크레아티닌(creatinine)농도, 혈액에서 BUN 농도를 측정하였다. 또한 크레아티닌 청소율을 산출하였다.
2. 결과 도출 실험
A.αSMA 감소에 대한 본 발명 조성물의 효능 평가
(1) 실험 방법
생화학적 분석(섬유화지표 발현평가): 신장조직에서 αSMA의 발현량을 알아보기 위하여 이들에 대한 항체를 활용하여 Western blot을 시행하였다.
대조수술(sham operation, Sham)과 허혈/재관류(Ischemia/Reperfusion, IR) 생쥐 신장조직에서 αSMA의 발현을 확인하기 위하여 각 실험군의 시료들을 한 gel에 로딩하여 Western blot을 시행하고 각 밴드의 밀도를 측정하였다. Ponceau와 GADPH는 equal loading 마커로 활용하였다(도 14b). 여기서 SV; sham-vehicle, SB; sham-rhHAPLN1-dissolving solution, IRV; IR-vehicle, IRP; IR-pirfenidone, IRA; IR-본 발명의 조성물(rhHAPLN1) A, IRB; IR-본 발명의 조성물(rhHAPLN1) B, IRC; IR-본 발명의 조성물(rhHAPLN1) C를 각각 나타내며 보다 상세한 사항은 상기 표 1 및 표 2에 나타낸 바와 같다. 보다 구체적으로는 Sham-vehicle은 Sham control군에 rhHAPLNB1이 없는 완충액만 PBS에 희석하여 IP injection한 군이다. Sham-rhHAPLN1-dissolving solution은 rhHAPLN1이 정상조건에 미치는 영향을 확인하기 위해 rhHAPLN1 농도 B (0.02mg/kg)을 희석하여 IP injection한 군이다. IR-vehicle은 I/R fibrosis 유도 모델에 rhHAPLN1이 없는 완충액 처리군이다. IR-pirfenidone은 I/R fibrosis 유도 후 300mg/kg의 pirfenidone을 경구 투여한 군이다.
또한 αSMA 발현과 관련하여 IRV에 대한 발현량의 배수(fold) 변화를 그래프로 나타내었다(도 14c).
(2) 결과
신장에 있어서 섬유화의 지표인 αSMA의 발현은 대조수술(sham-operation, SV과 SB)에 비해 허혈/재관류를 유발한 경우에 유의하게 높았다.
그러나 본 발명의 조성물(rhHAPLN1)을 투여한 군(IRA와 IRB)에서의 αSMA의 발현은 대조약물 투여군(IRV)에 비해 피르페니돈과 유사한 수준으로 낮은 양상을 보여주었다. 여기서 IRC는 극히 낮은 농도라서 IRV와 동등한 정도로 높게 나타난 것으로 생각된다.
B. Collagen 감소에 대한 본 발명 조성물의 효능 평가
(1) 실험 방법
섬유화의 조직학적 분석의 일환으로서 파라핀(Paraffin) 고정된 신장을 3μm로 절단한 후 이 슬라이드 절편에 대해 각각 Sirus red와 PAS 염색을 실시하여 collagen 발현과 조직의 섬유화 병변을 평가하였다(도 14d). 여기서 SV; sham-vehicle, SB; sham-rhHAPLN1-dissolving solution, IRV; IR-vehicle, IRP; IR-pirfenidone, IRA; IR-본 발명의 조성물(rhHAPLN1) 농도 0.1mg/kg, IRB; IR-본 발명의 조성물(rhHAPLN1) 농도 0.02mg/kg, IRC; IR-본 발명의 조성물(rhHAPLN1) 농도 0.004mg/kg를 각각 나타낸다.
(2) 결과
도 14d에서 보는 바와 같이 허혈/재관류에 노출된 신장의 군(IRV)에서는 신장의 간질(세뇨관들의 사이)에서 collagen 양성부위(붉은색)가 대조수술군(SV 및 SB)에 비해 현저하게 많이 나타났다. 이와 관련하여 collagen의 감소와 관련된 본 발명의 항섬유화 효능을 보다 객관적으로 확인하기 위해 도 14d의 조직 염색사진에 대해 총 3인의 연구자를 통해 암맹검사를 실시하였다. 그 결과 collagen의 발현이 IRV군에 비해 피르페니돈을 처리한 실험군인 IRP, 본 발명의 조성물을 처리한 군(IRA 및 IRB)에서 약하게 나타난 것을 3인 모두가 확인하였다.
또한 상기한 조직 내에서 collagen의 발현을 정량화하기 위해 도 14d의 조직염색 사진에서 신장의 바깥수질부(outer medulla) 부위 중 2곳을 무작위적으로 이미징화한 후 collagen 양성부위를 마킹하였다. 여기서 붉은 색은 sirus red positive 신호이다(도 14e).
이를 기초로 i-Solution software(IMT)를 활용하여 이를 수치화하였는데, 도 14d의 현미경하에서 관찰한 것과 마찬가지로 IRV군에 비해 IRP, IRA와 IRB군에서 collagen 양성부위가 약하게 나타났다(도 14f). 이는 본 발명의 조성물(rhHAPLN1)이 피르페니돈과 동등한 정도로 collagen의 발현을 감소시켰다는 것을 나타내며 그 만큼 in vivo에서의 항섬유화 효능을 갖는다는 것을 의미한다.
C. 크레아티닌 청소율에 대한 본 발명 조성물의 효능 평가
(1) 실험 방법
신장기능을 분석하기 위한 실험으로서 이에 이용하기 위한 혈액은 안구후정맥총(retroorbital vein plexus)을 통해 헤파린이 첨가된 유리모세관으로 취하였고, 소변은 대사케이지를 활용하여 얻었다. 혈액요소질소와 크레아티닌(plasma creatinine, PCr) 농도는 Vitros250 (Johnson & Johnson)를 이용하여 측정하였다.
크레아티닌청소율(Creatinine clearance)은 신장에서 제거되는 크레아티닌의 양을 이용하여 사구체여과율을 추정하는 방법으로서, Urine Creatinine concentration X Urine volume/Plasma creatinine concentration로 산출하였는데 본 실험에서는 허혈/재관 후 21일째에 측정하였다. *p<0.05. N=4-6. * IR 실험군은 수술 후 1일차가 BUN 농도가 100 mg/dL이상으로 올라가 유사한 수준의 손상이 유발된 동물만을 사용하였다.
(2) 결과
도 14g에서 보는 바와 같이 허혈/재관류에 노출된 신장의 군(IRV)은 허혈/재관류가 없었던 대조군에 해당하는 군(SV 및 SB)에 비해 크레아티닌 청소율, 즉 신장이 제대로 기능하여 혈액에서 제거되는 크레아티닌의 양이 현저하게 감소된 것을 나타내었다.
그러나 본 발명의 조성물을 처리한 군(IRA, IRB 및 IRC)에서는 크레아티닌 청소율이 상승하였고, 그 중 특히 IRA군(0.1 mg/kg/BW의 rhHAPLN1으로 투여되는 본 발명의 조성물)의 경우 크레아티닌 청소율이, 본 발명의 조성물 중 rhHAPLN1 단백질은 없고 buffer(PBS)만 있는 rhHAPLN1 buffer (IRV)와 피르페니돈 투여군(IRP)에 비해 상당히 높은 양상을 보였다. 특히 IRA의 CrCl은 IRV에 비해 통계적으로 유의하게 높았다. 이는 본 발명의 조성물의 투여가 허혈/재관류 손상에 의해서 유발된 신장의 기능감소를 실제적으로 완화시킨다는 것을 의미한다.
서열번호 1:
MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Claims (12)
- 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1) 또는 이를 코딩하는 유전자를 유효성분으로 포함하는, 섬유성 질환의 예방 또는 치료용 약학적 조성물.
- 청구항 1에 있어서, 상기 단백질이 서열번호 1의 아미노산 서열에 대해 80% 이상의 서열동일성을 갖는 것인 조성물.
- 청구항 1에 있어서, 상기 유전자에 관한 핵산이 발현 벡터 내에 포함되어 있는 것인 조성물.
- 청구항 1에 있어서, 상기 섬유성 질환의 병소가 피부, 간, 장, 심장, 폐, 및 신장으로 이루어지는 군에서 선택되는 것인 조성물.
- 청구항 1에 있어서, 상기 섬유성 질환의 병소가 피부 섬유아세포, 간성상 세포, 결장 섬유아세포, 심장 미세혈관 내피세포, 폐 섬유아세포, 신장 신세관 세포, 및 신장 근위 세뇨관 상피 세포로 이루어지는 군에서 선택되는 것인 조성물.
- 청구항 1에 있어서, 상기 섬유성 질환이 허혈성 섬유화증인 것인 조성물.
- 청구항 1에 있어서, 상기 조성물의 1회 투여량이 0.1ng/ml 내지 500ng/ml인 것인 조성물.
- 청구항 1에 있어서, 상기 조성물을 in vivo로 투여 시 0.001 내지 5 mg/kg BK의 rhHAPLN1 단백질의 용량으로 투여되는 것인 조성물.
- 청구항 1에 있어서, 상기 조성물이 세포의 섬유화증을 예방 또는 억제하기 위한 조성물의 주요 또는 보조 유효성분으로서 포함되는 것인 조성물.
- 히알루론산과 프로테오글리칸 연결 단백질 1(hyaluronan and proteoglycan link protein 1; HAPLN1) 또는 이를 코딩하는 유전자를 유효성분으로 포함하는 조성물을 세포에 처리함으로써 세포의 섬유화를 예방 또는 억제하는 방법.
- 청구항 1 내지 청구항 9 중 어느 한 항에 따른 조성물 및 청구항 10의 방법에 따른 처리를 위한 지침을 포함하는 세포의 섬유화 예방 또는 억제용 키트.
- 청구항 1 내지 청구항 9 중 어느 한 항에 따른 조성물을 포함하는, 세포의 섬유화 예방 또는 억제와 관련된 실험용 시약 조성물.
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3228288A CA3228288A1 (en) | 2021-08-03 | 2022-08-02 | Composition for preventing or treating fibrotic diseases, comprising hapln1 |
| KR1020237016789A KR102646367B1 (ko) | 2021-08-03 | 2022-08-02 | Hapln1을 포함하는 섬유성 질환의 예방 또는 치료용 조성물 |
| AU2022322679A AU2022322679A1 (en) | 2021-08-03 | 2022-08-02 | Composition for preventing or treating fibrotic diseases, comprising hapln1 |
| CN202280054108.1A CN117881412A (zh) | 2021-08-03 | 2022-08-02 | 包括hapln1的用于预防或治疗纤维性疾病的组合物 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR20210101726 | 2021-08-03 | ||
| KR10-2021-0101726 | 2021-08-03 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023014062A1 true WO2023014062A1 (ko) | 2023-02-09 |
Family
ID=85156219
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2022/011419 WO2023014062A1 (ko) | 2021-08-03 | 2022-08-02 | Hapln1을 포함하는 섬유성 질환의 예방 또는 치료용 조성물 |
Country Status (5)
| Country | Link |
|---|---|
| KR (1) | KR102646367B1 (ko) |
| CN (1) | CN117881412A (ko) |
| AU (1) | AU2022322679A1 (ko) |
| CA (1) | CA3228288A1 (ko) |
| WO (1) | WO2023014062A1 (ko) |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130052198A1 (en) | 2010-03-29 | 2013-02-28 | The General Hospital Corporation | Anti-inflammatory factors |
| WO2013144349A1 (en) * | 2012-03-30 | 2013-10-03 | Societe De Developpement Et De Recherche Industrielle | Method and kit for the classification and prognosis of tissue or organ fibrosis in a reparative or reactive process |
| KR20170031060A (ko) * | 2015-09-09 | 2017-03-20 | 중앙대학교 산학협력단 | Hapln1을 이용한 피부 노화 측정 또는 예방 또는 개선용 조성물 |
| KR20200104831A (ko) * | 2019-02-27 | 2020-09-04 | 주식회사 하플사이언스 | Hapln1을 포함하는 연골 관련 질환 또는 증상의 예방, 개선 또는 치료용 조성물 |
-
2022
- 2022-08-02 WO PCT/KR2022/011419 patent/WO2023014062A1/ko active Application Filing
- 2022-08-02 KR KR1020237016789A patent/KR102646367B1/ko active IP Right Grant
- 2022-08-02 AU AU2022322679A patent/AU2022322679A1/en active Pending
- 2022-08-02 CA CA3228288A patent/CA3228288A1/en active Pending
- 2022-08-02 CN CN202280054108.1A patent/CN117881412A/zh active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20130052198A1 (en) | 2010-03-29 | 2013-02-28 | The General Hospital Corporation | Anti-inflammatory factors |
| WO2013144349A1 (en) * | 2012-03-30 | 2013-10-03 | Societe De Developpement Et De Recherche Industrielle | Method and kit for the classification and prognosis of tissue or organ fibrosis in a reparative or reactive process |
| KR20170031060A (ko) * | 2015-09-09 | 2017-03-20 | 중앙대학교 산학협력단 | Hapln1을 이용한 피부 노화 측정 또는 예방 또는 개선용 조성물 |
| KR20200104831A (ko) * | 2019-02-27 | 2020-09-04 | 주식회사 하플사이언스 | Hapln1을 포함하는 연골 관련 질환 또는 증상의 예방, 개선 또는 치료용 조성물 |
Non-Patent Citations (11)
| Title |
|---|
| ASHCROFT ET AL., J CLIN PATHOL, vol. 41, 1988, pages 467 - 470 |
| BOIS, R. M.: "Strategies for treating idiopathic pulmonary fibrosis", NATURE REV. DRUG DISCOV., vol. 9, 2010, pages 129 - 140 |
| CELLS, vol. 8, no. 11, 2019, pages 1419 |
| DATABASE PROTEIN ANONYMOUS : "hyaluronan and proteoglycan link protein 1 precursor [Homo sapiens]", XP093032997, retrieved from NCBI * |
| EVANKO STEPHEN P., GOODEN MICHEL D., KANG INKYUNG, CHAN CHRISTINA K., VERNON ROBERT B., WIGHT THOMAS N.: "A Role for HAPLN1 During Phenotypic Modulation of Human Lung Fibroblasts In Vitro", JOURNAL OF HISTOCHEMISTRY AND CYTOCHEMISTRY, HISTOCHEMICAL SOCIETY, NEW YORK, NY, US, vol. 68, no. 11, 1 November 2020 (2020-11-01), US , pages 797 - 811, XP093032991, ISSN: 0022-1554, DOI: 10.1369/0022155420966663 * |
| LIU ET AL., METHODS IN MOLECULAR BIOLOGY, 2017 |
| MOLECULAR MEDICINE, vol. 27, 2021, pages 22 |
| OKU, EUROPEAN JOURNAL OF PHARMACOLOGY, vol. 590, 2008, pages 400 - 408 |
| SONG ET AL., EXPERIMENTAL AND THERAPEUTIC MEDICINE, vol. 16, 2018, pages 1800 - 1806 |
| THE AMERICAN JOURNAL OF PATHOLOGY, vol. 170, no. 6, 2007, pages 1807 - 1816 |
| YANAGI, INT. J. MOL. SCI, vol. 18, 2017, pages 503 |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3228288A1 (en) | 2023-02-09 |
| CN117881412A (zh) | 2024-04-12 |
| KR102646367B1 (ko) | 2024-03-14 |
| KR20230097071A (ko) | 2023-06-30 |
| AU2022322679A1 (en) | 2024-03-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2015002513A2 (ko) | 호흡기 질환 연관 유전자 특이적 siRNA, 그러한 siRNA를 포함하는 이중나선 올리고 RNA 구조체 및 이를 포함하는 호흡기 질환 예방 또는 치료용 조성물 | |
| CN101242817A (zh) | HIF1α调节剂在治疗癌症中的用途 | |
| WO2021246797A1 (ko) | 항바이러스제 및 항우울제를 유효성분으로 함유하는 암 예방 또는 치료용 약학적 조성물 | |
| WO2017082701A1 (ko) | 심장 섬유증 치료용 약제학적 조성물 | |
| WO2014171801A1 (ko) | 아미도피리딘올 유도체 또는 이의 약제학적 허용가능한 염 및 이를 유효성분으로 함유하는 약학조성물 | |
| WO2018208011A2 (ko) | β-아밀로이드 단백질의 응집을 억제하는 생체친화적 펩타이드 | |
| WO2023014062A1 (ko) | Hapln1을 포함하는 섬유성 질환의 예방 또는 치료용 조성물 | |
| WO2020009551A1 (ko) | 신경단백질의 비정상적 섬유화 또는 응집과 관련된 질환 치료제로서의 그래핀 양자점 | |
| WO2018026212A2 (ko) | 섬유증 질환 모델의 제조방법 및 섬유증 질환 모델의 용도 | |
| WO2018080146A2 (ko) | 단백질 탈 인산화 효소 1 억제 펩타이드를 포함하는 혈관 질환 치료용 조성물 | |
| WO2022065968A1 (ko) | 에보디아민을 유효성분으로 포함하는 비소세포폐암의 예방 또는 치료용 약학적 조성물 | |
| WO2022055334A1 (ko) | 폐 섬유화 질환의 예방 또는 치료용 조성물 | |
| WO2014054927A1 (ko) | 엠피레귤린 특이적 이중 나선 올리고 rna, 그러한 이중나선 올리고 rna를 포함하는 이중나선 올리고 rna 구조체 및 이를 포함하는 호흡기 질환의 예방 또는 치료용 조성물 | |
| WO2022015115A1 (ko) | 3중 작용성 지속형 결합체 또는 3중 작용제를 포함하는 조합물의 치료학적 용도 | |
| WO2022050778A1 (en) | Improved cell-permeable modified parkin recombinant protein for treatment of neurodegenerative diseases and use thereof | |
| WO2022139493A1 (ko) | TGF-β 신호전달을 억제할 수 있는 신규한 펩타이드 및 이의 용도 | |
| WO2022014975A1 (ko) | Bi-1 길항제 및 그의 용도 | |
| WO2023038416A1 (ko) | 폐 섬유증의 바이오마커 및 치료 표적으로서 csf3r | |
| WO2020263063A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 간 질환에 대한 치료적 용도 | |
| WO2017048069A1 (ko) | 신규한 피라졸린 유도체 및 이의 용도 | |
| WO2023128674A1 (ko) | Hapln1을 포함하는 안구건조증의 예방 또는 치료용 조성물 | |
| WO2017164486A1 (ko) | Tesk1 억제제를 포함하는 항암제 내성 억제용 조성물 및 tesk1 억제제의 스크리닝 방법 | |
| WO2022085925A1 (ko) | 디펜신 유래 10량체 펩타이드를 유효성분으로 포함하는 패혈증의 예방 또는 치료용 조성물 | |
| WO2018038539A2 (ko) | Eprs 단백질 또는 이의 단편을 포함하는 항rna-바이러스용 조성물 | |
| WO2019147104A1 (ko) | 벤조[d]싸이아졸 유도체 또는 이의 염을 유효성분으로 포함하는 면역세포 이동 관련 질환의 예방 또는 치료용 약학적 조성물 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22853439 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 20237016789 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280054108.1 Country of ref document: CN Ref document number: 3228288 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022322679 Country of ref document: AU Ref document number: AU2022322679 Country of ref document: AU |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022853439 Country of ref document: EP Effective date: 20240304 |
|
| ENP | Entry into the national phase |
Ref document number: 2022322679 Country of ref document: AU Date of ref document: 20220802 Kind code of ref document: A |