WO2022136569A1 - Anti-il1rap antibody - Google Patents
Anti-il1rap antibody Download PDFInfo
- Publication number
- WO2022136569A1 WO2022136569A1 PCT/EP2021/087338 EP2021087338W WO2022136569A1 WO 2022136569 A1 WO2022136569 A1 WO 2022136569A1 EP 2021087338 W EP2021087338 W EP 2021087338W WO 2022136569 A1 WO2022136569 A1 WO 2022136569A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- antigen
- binding fragment
- chain variable
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/283—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against Fc-receptors, e.g. CD16, CD32, CD64
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to an anti-IL1RAP antibody or fragments thereof with anti-inflammatory, anti-fibrotic and/or anti-neoplastic properties, and to its use in the prevention, treatment, alleviation, detection and/or diagnosis of diseases or disorders associated with IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ signaling.
- IL-1 interleukin-1 family of cytokine ligands and its receptors is associated with inflammation, autoimmunity, immune regulation, fibrosis, cell proliferation, tumor growth, tumor metastasis and host defense.
- the IL-1 family comprises a number of agonist cytokines including IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ , and each of these cytokines bind their specific IL-1 family cell membrane receptor.
- IL1RAP IL-1 Receptor Accessory Protein
- IL1RAP is the co-receptor for the IL-1 receptor I (IL1R1; binding IL-1 ⁇ and IL-1 ⁇ ), IL-33 receptor (ST2, IL1RL1; binding IL-33), and the IL-36 receptor (IL1RL2; binding IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ ) and is required for signal transduction downstream of the cytokines IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ .
- Antibodies binding to IL1RAP can block cytokine signaling downstream of IL1RAP dependent receptors.
- antibodies binding IL1RAP can also be used with regard to other functions, for example to induce antibody-dependent cell-mediated cytotoxicity (ADCC) and/or antibody-dependent cellular phagocytosis (ADCP), thereby leading to the killing of target cells, such as IL1RAP- expressing tumor cells.
- ADCC antibody-dependent cell-mediated cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- IL1RAP-expressing tumor cells IL1RAP- expressing tumor cells.
- antibodies have been generated which are capable of decreasing, inhibiting, and/or blocking signaling pathways of cytokine ligands of the IL-1 family, depending on the properties of the respective antibody.
- WO 2015/132602 discloses an anti IL1RAP antibody inhibiting signaling of IL-1 ⁇ , IL-1 ⁇ and IL-33, to varying degrees.
- IL-1 ⁇ IL-1 ⁇
- IL-33 IL-36 ⁇
- IL-36 ⁇ IL-36 ⁇
- IL-36 ⁇ IL-36 ⁇
- IL-36 ⁇ Blocking all six cytokines is expected to be beneficial with regard to therapeutic approaches targeting IL-1 family of cytokine ligands and receptors.
- IL-1 ⁇ and IL-1 ⁇ are two potent pro-inflammatory cytokines and the involvement of these in acute inflammation have been extensively described.
- IL-33 is traditionally thought of as a Th2 cytokine that induces production of type 2 cytokines such as IL-5 and IL-13.
- the function of IL-36 is less well described but several studies suggest that IL-36 is involved in immune cell activation and induces release of pro- inflammatory cytokines.
- IL-1 interleukin-1 family of cytokine ligands and receptors, such as those associated with signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL- 36 ⁇ .
- the inventors of the present invention have generated an antibody, and variants thereof, binding to IL-1RAP domain 2 with the capability of inhibiting the signaling downstream of six IL1RAP dependent ligands; IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ .
- this antibody can be used for the prevention, treatment, alleviation, detection and/or diagnosis of diseases and disorders associated with signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ , thereby simultaneously targeting several downstream pathways associated with these cytokines. Consequently, this antibody can be used in targeting several aspects and processes of diseases and disorders associated with signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ , for example inflammatory and fibrotic aspects in inflammatory or fibrotic diseases or disorders, or inflammatory, fibrotic or proliferative aspects in neoplastic diseases or disorders.
- the antibody described here allows for simultaneous targeting of multiple cytokine pathways, for example targeting pathways of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ , which is a clinical advantage when treating diseases or disorders where blocking only one or a few cytokines would not be effective enough to treat or prevent a disease or disorder. Further disclosed is the optimization of this antibody by humanization and de-immunization procedures, resulting in antibody variants with fine-tuned properties.
- a first aspect of the invention relates to an antibody or antigen-binding fragment thereof with binding specificity for interleukin-1 receptor accessory protein (IL1RAP), wherein the antibody or antigen-binding fragment comprises: a light chain variable region comprising a) a CDR-L1 comprising or consisting of an amino acid sequence selected from the group consisting of ESISTA (SEQ ID NO: 1), QASESISTALA (SEQ ID NO: 7) and QASESISTALA (SEQ ID NO: 13); b) a CDR-L2 comprising or consisting of an amino acid sequence selected from the group consisting of KAS, KASTLPS (SEQ ID NO: 8) and KASTLPS (SEQ ID NO: 14); and c) a CDR-L3 comprising or consisting of an amino acid sequence selected from the group consisting of QQGFSSGNVHNA (SEQ ID NO: 3), QQGFSSGNVHNA (SEQ ID NO: 9) and QQGFSSGNVHNA (SEQ ID NO:
- a second aspect of the invention relates to a polynucleotide encoding the antibody or antigen-binding fragment of the first aspect of the invention, or a component polypeptide chain thereof.
- a third aspect of the invention relates to a vector comprising the polynucleotide according to the second aspect of the invention.
- a fourth aspect of the invention relates to a recombinant host cell comprising the polynucleotide according to the second aspect of the invention or a vector according to the third aspect of the invention.
- a fifth aspect of the invention relates to a method for producing the antibody or antigen-binding fragment of the first aspect of the invention, the method comprising culturing the host cell of the fourth aspect of the invention, comprising the polynucleotide of the second aspect of the invention or the vector of the third aspect of the invention, under conditions which permit expression of the encoded antibody or antigen-binding fragment thereof.
- a sixth aspect of the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, and/or the host cell of the fourth aspect of the invention, in a pharmaceutical composition, wherein the composition further comprises a pharmaceutically-acceptable diluent, carrier or excipient.
- a seventh aspect of the invention relates to the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, for use in medicine.
- An eighth aspect of the invention relates to the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, for use in the prevention and/or treatment and/or alleviation and/or detection and/or diagnosis of a disease or disorder susceptible to treatment with an inhibitor of IL-1 ⁇ , IL- 1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ signaling, and/or wherein the disease or disorder is associated with cells expressing IL1RAP.
- a ninth aspect of the invention relates to the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, for use in inducing cell death and/or inhibiting the growth and/or proliferation of pathological cells associated with a neoplastic disorder in a subject, or stem cells or progenitor cells thereof, wherein the cells express IL1RAP.
- a tenth aspect of the invention relates to the use of the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, in the preparation of a medicament for the prevention, treatment, alleviation, detection and/or diagnosis of a disease or disorder susceptible to treatment with an inhibitor of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ signaling, and/or wherein the disease or disorder is associated with cells expressing IL1RAP.
- An eleventh aspect of the invention relates to the use of the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, in the preparation of a medicament for the detection and/or diagnosis of a disease or disorder associated with cells expressing IL1RAP.
- a twelfth aspect of the invention relates to a method for the prevention and/or treatment and/or alleviation and/or detection and/or diagnosis of a disease or disorder susceptible to treatment with an inhibitor of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL- 36 ⁇ signaling and/or wherein the disease or disorder is associated with cells expressing IL1RAP in a subject, comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- a thirteenth aspect of the invention relates to an in vitro method for the detection of cells expressing IL1RAP in a subject, the method comprising: (a) providing a sample of cells from a subject to be tested, such as biopsy tissue or blood sample; (b) optionally, extracting and/or purifying the cells present in the sample; (c) contacting the antibody or antigen-binding fragment of the first aspect of the invention with cells present in the sample; (d) determining whether the antibody or antigen-binding fragment thereof binds to the cells wherein the binding of the antibody or antigen-binding fragment thereof to the cells is indicative of the presence of a disease or disorder associated with cells expressing IL1RAP in the tissue of a subject.
- a fourteenth aspect of the invention relates to an in vitro method for identifying a patient with a disease or disorder associated with cells expressing IL1RAP who would benefit from treatment with the antibody or antigen-binding fragment of the first aspect of the invention, the method comprising: (a) providing a sample of cells, such as biopsy tissue or blood sample from a patient to be tested; (b) optionally, extracting and/or purifying the cells present in the sample; (c) contacting the antibody or antigen-binding fragment of the first aspect of the invention with cells present in the sample; (d) determining whether the antibody or antigen-binding fragment thereof binds to the cells wherein the binding of the antibody or antigen-binding fragment thereof to cells expressing IL1RAP is indicative of a patient who would benefit from treatment with the antibody or antigen-binding fragment of the first aspect of the invention.
- a fifteenth aspect of the invention relates to a method for treating a patient with a disease or disorder associated with cells expression IL1RAP, the method comprising: a) selecting a patient identified as having a disease or disorder associated with cells expressing IL1RAP using a method according to the fourteenth aspect of the invention; and b) administering to said patient a therapeutic agent effective in the treatment of said disease or disorder.
- a sixteenth aspect of the invention relates to a method for the detection of cells expressing IL1RAP, the method comprising: (a) contacting an antibody or antigen-binding fragment thereof according to the first aspect with cells to be analysed for their expression of IL1RAP; (b) determining whether the antibody or antigen-binding fragment thereof binds to the cells wherein the binding of the antibody or antigen-binding fragment thereof to the cells is indicative of the presence of a disease or disorder associated with cells expressing IL1RAP in the tissue of a subject.
- a seventeenth aspect of the invention relates to a method for reducing inflammation in a subject with peritonitis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- An eighteenth aspect of the invention relates to a method for reducing disease severity in a subject with psoriasis or psoriatic arthritis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- a nineteenth aspect of the invention relates to a method for reducing atherosclerotic plaque inflammation in a subject with atherosclerosis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- a twentieth aspect of the invention relates to a method for reducing atherosclerotic plaque volume and/or atherosclerotic plaque size in a subject with atherosclerosis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- a twenty-first aspect of the invention relates to a method for reducing inflammation and/or fibrosis in a subject with myocarditis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- a twenty-second aspect of the invention relates to a method for counteracting deterioration in cardiac function in a subject with myocarditis or autoimmune myocarditis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention.
- a twenty-third aspect of the invention relates to a method for reducing dermal fibrosis in a subject with systemic sclerosis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- a twenty-fourth aspect of the invention relates to a method for reducing pulmonary fibrosis in a subject with systemic sclerosis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- the anti-IL1RAP antibody mCAN10 reduces inflammation in a model for acute peritonitis WT or KO mice were immunized with MSU crystals and 6 hrs after immunization, flow cytometry was performed on peritoneal lavages for quantification of infiltrating cells (A). WT mice were treated with mCAN10, IL1RA, isotype control antibody (Isotype), or PBS only 1 hr prior to immunization with MSU crystals. Six hrs after immunization, peritoneal lavages were collected for flow cytometry for quantification of infiltrating cells (B), or for quantification of cytokines and chemokines by a Luminex assay (C).
- FIG. 2 The anti-IL1RAP antibody mCAN10 reduces disease severity in models for psoriasis and psoriatic arthritis Psoriasis was induced in BALB/c mice by administration of Imiquimod on the shaved backs of mice for 7 days. During this period, mice were treated on three occasions with mCAN10, anti IL 1 ⁇ antibody (Anti IL 1 ⁇ ), isotype control antibodies (Isotype anti IL 1 ⁇ , Isotype mCAN10), dexamethasone, or PBS only (Vehicle). Disease severity was evaluated throughout the 7-day period by scoring of the inflammation and erythema of the back area (A and B).
- Psoriatic arthritis was induced in B6N.Q.NCF1 mice by administration of mannan from Saccharomyces cerevisiae. Mice were treated as in A and B and disease severity evaluated throughout a 7-day period by scoring of the joint inflammation of all paws (C and D). On day 7, mice were sacrificed and blood collected for analysis of IL-17 levels in plasma (E).
- Figure 3 mCAN10 reduces aortic plaque inflammation in a model for atherosclerosis Development of atherosclerotic lesions was induced in apolipoprotein E (Apoe) KO mice by feeding mice with high cholesterol diet (HCD).
- mice were treated with mCAN10 or isotype control antibody (Iso) biweekly (twice weekly) for 6 wks. During this period, mice were kept on HCD. At the end of the experiment, mice were sacrificed and aortas collected for flow cytometry analyses of total CD45 + cells (A), myeloid cells such as CD11b + cells and Ly6G + neutrophils (B and C), and T lymphocytes such as TCR- ⁇ + cells, CD4 + cells and CD8 + cells (D-F).
- Figure 4 mCAN10 reduces the size of aortic plaques in a model for atherosclerosis Mice were treated as described for Figure 3.
- mice were sacrificed, hearts collected and sections at the aortic root stained for lipid accumulation by Oil-Red O for comparison of both plaque volume (A) and area (B).
- Figure 5 The anti-IL1RAP antibody mCAN10 reduces inflammation and fibrosis in experimental autoimmune myocarditis (EAM) EAM was induced in BALB/c mice by immunization with ⁇ -myosin heavy chain peptide, emulsified in complete Freund’s adjuvant, on two occasions. Starting from day 7 after the final immunization, mice were treated with mCAN10, isotype control antibody (Isotype) or PBS only, biweekly for 4 wks.
- Isotype isotype control antibody
- PBS biweekly for 4 wks.
- mice were sacrificed, hearts collected, and heart sections stained with H&E staining to assess the degree of inflammation (A and B), or by Masson’s trichrome staining to assess the degree of fibrosis (C and D).
- Figure 6 The anti-IL1 RAP antibody mCAN10 counteracts deterioration in cardiac function in experimental autoimmune myocarditis
- EAM was induced in BALB/c mice by immunization with a-myosin heavy chain peptide, emulsified in complete Freund’s adjuvant, on two occasions. Starting from the day of the final immunization (day 7), mice were treated with mCAN10, anti-IL-1 (3 antibody (Anti-IL-1 P) or isotype control antibodies (Isotype anti-IL-1 ⁇ , Isotype mCAN10) biweekly for 5 wks (A).
- mice were treated with mCAN10, isotype control antibody (Isotype mCAN10), IL1 RA, prednisone or vehicle controls (Vehicle IL1 RA, Vehicle Prednisone) daily for 5 wks (B).
- mice received mCAN10, isotype control antibody (Isotype), or vehicle control (PBS) as in A, but with treatment starting from day 7 after the final immunization (day 14) (C). Cardiac function was assessed by transthoracic echocardiography at the start of the study, and on day 28 and 42.
- Figure 7 mCAN10 ameliorates dermal fibrosis in a mouse model for sclerodermatous chronic graft-versus-host disease (scl cGvHD)
- scl cGvHD sclerodermatous chronic graft-versus-host disease
- Female BALB/c (H-2 d ) recipient mice received bone marrow from male B10.D2 donor mice (H-2 d ) in an allogeneic transplantation manner to create an MHC mismatch model which would develop scl cGvHD.
- the same recipient mice received bone marrow from female BALB/c (H-2 d ) donor mice in a syngeneic transplantation manner, resulting in no disease development.
- mice received mCAN10 (20 mg/kg at first dose; 10 mg/kg at subsequent doses), or the same doses of isotype control antibody (Iso) i.p. biweekly for 4 wks. Alternatively, these mice were treated with nintedanib at 50 mg/kg p.o. daily for 4 wks. Mice receiving syngeneic transplants were treated with isotype control antibody (Iso) only. Mice were sacrificed on day 49, and skin samples from the upper back collected for histological evaluation to analyze dermal thickness (A) and number of fibroblasts (B), or for quantification of hydroxyproline content (C).
- Iso isotype control antibody
- Figure 8 mCAN10 ameliorates pulmonary fibrosis in a mouse model for scl cGvHD
- mice were treated as described for Figure 7. After sacrifice of mice on day 49 post transplantation, lungs were collected for histological evaluation to determine Ashcroft score (A) and area stained by Sirius Red (B), or for quantification of hydroxyproline content (C).
- Figure 9 mCAN10 ameliorates weight loss in a mouse model for scl cGvHD Mice were treated as described for Figure 7. Following transplantation, the mice were continuously weighed for the duration of the study, which was finalized 49 days post transplantation.
- Figure 10 mCAN10 alters the IL-1 family gene expression profile in a mouse model for scl cGvHD Mice were treated as described for Figure 7. After sacrifice of mice on day 49 post transplantation, skin samples from the upper back were used for RNA sequencing to generate a heatmap visualizing the changes in gene expression level for the indicated IL-1 family members.
- MFI mean fluorescent intensity
- Figure 13 Inhibition of interleukin signaling by chimeric 48D2
- the ability of chimeric 48D2 to block IL-1alpha (A), IL-1beta (B), IL-33 (C), IL-36alpha (D), IL-36beta (E) and IL-36gamma (F) signaling was investigated in a HEK-BlueTM assay.
- hIgG1 isotype antibody was included as a control. Dotted lines show positive (cells stimulated with cytokine) and negative (cells only) controls to illustrate the window of inhibition.
- Chimeric 48D2 blocks the signaling downstream of all six cytokines.
- FIG. 14 Chimeric 48D2 binds human, cynomolgus monkey and pig IL1RAP Cross reactivity of chimeric 48D2 with the IL1RAP orthologues was measured by ELISA. Chimeric 48D2 cross reacts with human (hIL1RAP), cynomolgus monkey (mfIL1RAP) and pig (ssIL1RAP) IL1RAP, but not with mouse (mIL1RAP), rat (rnIL1RAP), rabbit (ocIL1RAP) or dog (clIL1RAP) IL1RAP.
- Figure 15 Inhibition of interleukin signaling by the humanized 48D2 variants
- humanized (h) 48D2 VH variants VH1, VH2, VH3, VH4, and VH5 in combination with VL variants VL1, VL2, VL3, VL4 and VL5 to block IL-1alpha (A-E), IL- 1beta (F-J), and IL-33 (K-O) signaling was investigated in a HEK-BlueTM assay.
- Variants of h48D2 harboring VH5 block the downstream signaling to a similar degree as chimeric 48D2 and were further investigated for inhibition of IL-36alpha (P), IL- 36beta (Q), and IL-36gamma (R).
- Variants of h48D2 harboring VH1, VH2, VH3 or VH4 inhibited signaling of IL-1alpha, IL-1beta and IL-33 to varying degrees.
- hIgG1 isotype antibody and chimeric 48D2 were included as controls. Dotted lines show positive (cells stimulated with cytokine) and negative (only cells) controls to illustrate the window of inhibition.
- Variants of h48D2 harboring VH5 in combination with any VL variant (VL1-VL5) block the downstream signaling of all six interleukins to a similar degree as chimeric 48D2.
- Figure 16 Dose-dependent binding of two humanized and de-immunized clones to cell membrane IL1RAP Two of the humanized and de-immunized 48D2 clones, h48D2 VH5.GL:VL4 and h48D2 VH5.GL:VL5.GL were added to SKMEL-5 cells in increasing concentrations and extracellular binding was analyzed by flow cytometry. Chimeric 48D2 and hIgG1 isotype antibody were included as controls.
- h48D2 VH5.GL:VL4 and h48D2 VH5.GL:VL5.GL specifically bound IL1RAP on the cell membrane in a dose-dependent manner and with higher mean fluorescent intensity (MFI) compared to the hIgG1 isotype control antibody and the chimeric 48D2 antibody.
- MFI mean fluorescent intensity
- FIG. 17 De-immunized h48D2 clones have preserved inhibitory activity on all six interleukin pathways Inhibitory activity of the de-immunized h48D2 clones on IL-1alpha (A), IL-1beta (B), IL- 33 (C), IL-36alpha (D), IL-36beta (E) and IL-36gamma (F) signaling was assessed in a HEK-BlueTM assay.
- hIgG1 isotype antibody and h48D2 VH5:VL4 and h48D2 VH5:VL5 were included as controls.
- Figure 18 De-immunized h48D2 clones bind human, cynomolgus monkey and pig IL1RAP Cross reactivity was measured by ELISA.
- FIG. 19 48D2 in hIgG1 format induces ADCC of IL1RAP expressing SKMEL-5 cells
- ADCC assay was performed in vitro with IL1RAP expressing SKMEL-5 cells and human NK cells and the number of dying SKMEL-5 cells was analyzed by flow cytometry and shown as % dead (DAPI positive) cells.
- 48D2 in hIgG1 format can direct NK cells to kill SKMEL-5 cells in a dose-dependent manner.
- 48D2 is expressed in a hIgG1-LALA format, no dose-dependent ADCC was induced.
- Isotype hIgG1 and Isotype-LALA did not induce ADCC greater than the background cell death observed in untreated cells.
- FIG. 20 48D2 inhibits cytokine-induced IL-6 mRNA expression in human dermal fibroblasts
- Primary human dermal fibroblasts were cultured in vitro and stimulated with IL-1alpha or IL-1beta (A) or IL-36alpha, IL-36beta or IL-36gamma (B), with or without the addition of chimeric 48D2.
- Data is shown as fold change (2 -ddCT ) compared to unstimulated control (0 ng/mL). All cytokines induced IL-6 mRNA expression in a dose-dependent manner and 48D2 inhibited the increase down to levels comparable with the unstimulated control.
- FIG. 21 VH5.GL:VL4 inhibits IL-1 ⁇ -induced cytokine and chemokine release in human whole blood
- Blood was collected from two human donors and incubated with VH5.GL:VL4 for 30 min.
- the blood was subsequently stimulated with either IL-1 ⁇ or lipopolysaccharide (LPS) for 20 hrs.
- LPS lipopolysaccharide
- the plate was centrifuged, and plasma layer collected for analysis by the Human Cytokine/Chemokine 71-Plex Discovery Assay Array.
- Levels of G-CSF (A), GRO ⁇ /CXCL1 (B), IL-17A (C) and TNF- ⁇ (D) are shown for one of the two donors.
- FIG. 22 VH5.GL:VL4 inhibits IL-1 ⁇ -induced cytokine release in a blood-loop system
- Blood was collected from ten human donors and transferred to a blood-loop system.
- VH5.GL:VL4 was administered to the blood at 32 ⁇ g/ml and IL-1 ⁇ at 1 ng/ml was added 15 mins later. The loops were run for 4 hrs.
- Plasma was obtained from the blood samples and levels of IL-6 (A) and IL-8 (B) measured using the MULTI-ARRAY® technology from MSD.
- VH5.GL:VL4 is internalized by IL1RAP-expressing cells WT and IL1RAP KO SKMEL cells were incubated with fluorescently-conjugated VH5.GL:VL4 or isotype control (Iso Ctrl) for 1, 2 or 4 hrs in Ibidi-treat microscope chamber slides. Cell nuclei were stained by DAPI. Interactive visual analyses were performed of scanned optical sections through the cells, and representative images captured to evaluate membrane binding and internalization of VH5.GL:VL4 (indicated by arrows).
- FIG. 24 VH5.GL:VL4 localizes to lysosomes or endosomes upon internalization by IL1RAP-expressing cells
- WT SKMEL cells were incubated with fluorescently-conjugated VH5.GL:VL4 for 1, 2 or 4 hrs in Ibidi-treat microscope chamber slides. The cells were additionally stained for the markers EEA1 and Lamp1 to detect endosomes and lysosomes, respectively. Cell nuclei were stained by DAPI. Interactive visual analyses were performed of scanned optical sections through the cells, and representative images captured to evaluate overlap of VH5.GL:VL4 staining with EEA1 and Lamp1 staining.
- FIG. 25 VH5.GL:VL4 in hIgG1-LALA format does not induce Fc-mediated cytokine release
- Blood was collected from ten human donors and transferred to a blood-loop system.
- VH5.GL:VL4 was added to the blood at increasing concentrations as indicated.
- the anti CD52 antibody alemtuzumab was added. The loops were run for 4 hrs.
- Plasma was obtained from the blood samples and levels of IFN- ⁇ (A), IL-6 (B), IL-8 (C) and TNF- ⁇ (D) measured using the MULTI-ARRAY® technology from MSD.
- FIG. 26 VH5.GL:VL4 in hIgG1-LALA format does not induce Fc-mediated complement activation
- Blood was collected from ten human donors and transferred to a blood loop system.
- VH5.GL:VL4 was added to the blood at increasing concentrations as indicated.
- the anti-CD52 antibody alemtuzumab was added. The loops were run for 15 min.
- Plasma was obtained from the blood samples and complement activation was analyzed by measurement of the complement split products C3a (A) and C5a (B) using the ELISA kit from RayBiotech.
- FIG. 27 Serum concentrations of VH5.GL:VL4 after single intravenous administration to cynomolgus monkeys
- VH5.GL:VL4 was administered intravenously at 5, 20 or 50 mg/kg as a single dose to one male (M) and one female (F) cynomolgus monkey for each dose level evaluated.
- Blood samples were collected at 0.083, 1, 3, 6, 24, 48, 96, 168, 264 and 336 hrs after administration and serum obtained.
- the serum samples were transferred to IL1RAP- coated MSD plates and VH5.GL:VL4 in the samples detected by adding an anti-human IgG antibody conjugated to an electrochemiluminescent label and measuring the intensity of emitted light.
- FIG. 28 Serum concentrations of VH5.GL:VL4 after single intravenous or subcutaneous administration to cynomolgus monkeys VH5.GL:VL4 was administered intravenously or subcutaneously at 10 mg/kg as a single dose to two female cynomolgus monkeys.
- Blood samples were collected at 0.083, 0.5, 1, 3, 6, 24, 48, 96, 168, 264, 336, 480 and 672 hrs after administration and serum obtained.
- the serum samples were transferred to IL1RAP-coated MSD plates and VH5.GL:VL4 in the samples detected by adding an anti-human IgG antibody conjugated to an electrochemiluminescent label and measuring the intensity of emitted light.
- an antibody includes a plurality of such antibodies, such as one or more antibodies, at least one antibody, or two or more antibodies.
- an anti-IL1RAP antibody can also refer to “anti- IL1RAP antibodies”, as for example the antibody variants described in Examples 9 to 22.
- the term “some embodiments” can include one, or more than one embodiment.
- IL1RAP antibody A first aspect of the invention relates to an antibody or antigen-binding fragment thereof with binding specificity for interleukin-1 receptor accessory protein (IL1RAP), wherein the antibody or antigen-binding fragment comprises: a light chain variable region comprising a) a CDR-L1 comprising or consisting of an amino acid sequence selected from the group consisting of ESISTA (SEQ ID NO: 1), QASESISTALA (SEQ ID NO: 7) and QASESISTALA (SEQ ID NO: 13); b) a CDR-L2 comprising or consisting of an amino acid sequence selected from the group consisting of KAS, KASTLPS (SEQ ID NO: 8) and KASTLPS (SEQ ID NO: 14); and
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises: a light chain variable region comprising a) a CDR-L1 consisting of an amino acid sequence selected from the group consisting of ESISTA (SEQ ID NO: 1), QASESISTALA (SEQ ID NO: 7) and QASESISTALA (SEQ ID NO: 13); b) a CDR-L2 consisting of an amino acid sequence selected from the group consisting of KAS, KASTLPS (SEQ ID NO: 8) and KASTLPS (SEQ ID NO: 14); and c) a CDR-L3 consisting of an amino acid sequence selected from the group consisting of QQGFSSGNVHNA (SEQ ID NO: 3), QQGFSSGNVHNA (SEQ ID NO: 9) and QQGFSSGNVHNA (SEQ ID NO: 15); and / or a heavy chain variable region comprising d) a CDR-H1 consisting of an amino acid sequence selected from the
- IL1RAP interleukin-1 receptor accessory protein
- IL1-RAP IL1-RAP
- IL1RAP is also known in the scientific literature as IL1R3, C3orf13, FLJ37788, IL-1RAcP and EG3556.
- mCAN10 abbreviation for “murine CAN10” as used herein refers to an antibody against murine IL1RAP.
- This antibody is also denoted as murine surrogate anti-IL1RAP antibody.
- mCAN10 is capable of blocking signaling by IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ . mCAN10 can therefore be used for evaluating therapeutic efficacy of IL1RAP blockade in murine disease models as a surrogate to anti-human IL1RAP antibodies that may lack cross-reactivity to mouse IL1RAP, with similar functional properties.
- the term “48D2” as used herein refers to an antibody against human IL1RAP, notwithstanding that the antibody may also bind to IL1RAP from other species.
- 48D2 is cross reactive to IL1RAP from human, cynomolgus monkey and pig.
- 48D2 may be used for denoting the chimeric antibody (also referred to as “ch48D2”) obtained as described in Example 9 and characterized in Example 10.
- ch48D2 chimeric antibody
- h48D2 as used herein refers to the antibody 48D2 that has been humanized as generated in Example 11, and as further characterized in Example 12.
- Example 12 several variants of h48D2 have been obtained (see for example Table 8).
- Example 13 several further variants of h48D2 have been obtained by de-immunization.
- the antibody or antigen-binding fragment of the invention can be referred to as “the polypeptide of the invention” or “the antibody polypeptide, or antigen-binding fragment thereof”, since an antibody and fragments thereof are polypeptides.
- the antibody or antigen-binding fragment of the invention has specificity for IL1RAP.
- specificity it is meant that the antibody or antigen-binding fragment is capable of binding to IL1RAP in vivo, i.e. under the physiological conditions in which IL1RAP exists within the human body.
- the antibody or antigen-binding fragment does not bind to any other protein in vivo.
- the antibody or antigen-binding fragment is capable of binding to IL1RAP ex vivo or in vitro.
- binding specificity may be determined by methods well known in the art, such as ELISA, immunohistochemistry, immunoprecipitation, Western blots and flow cytometry using transfected cells expressing IL1RAP.
- the antibody or antigen-binding fragment is capable of binding selectively to IL1RAP, i.e. it binds at least 10-fold more strongly to IL1RAP than to any other proteins.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP binds to human IL1RAP.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP binds to non-human IL1RAP. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP binds to IL1RAP from cynomolgus monkey. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP binds to IL1RAP from pig. In some embodiments, the antibody or antigen binding fragment thereof with binding specificity for IL1RAP binds IL1RAP expressed on the surface of a cell.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP binds to an epitope on the extracellular domain of IL1RAP. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP binds to soluble IL1RAP. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP binds to domain 2 of IL1RAP. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP binds IL1RAP at or within the amino acids 135 to 234 of IL1RAP.
- the antibody or antigen-binding fragment may be capable of binding to an epitope located at/within domain 2 of IL1RAP (see Wang et al., 2010, Nature Immunology, 11:905-912, the disclosures of which are incorporated herein by reference), i.e. within amino acids 135 to 234 of IL1RAP (see Accession No. Q9NPH3 within UniProtKB/Swiss- Prot).
- the epitope to which the antibody or antigen-binding fragment may be located within amino acids 135 to 154, 155 to 174, 175 to 194, 195 to 214 or between amino acids 215 to 234, or between amino acids 174 to 191 of IL1RAP.
- the epitope may be non-linear.
- the antibody or antigen-binding fragment of the invention comprises or consists of an antibody mimic selected from the group comprising or consisting of affibodies, tetranectins (CTLDs), adnectins (monobodies), anticalins, DARPins (ankyrins), avimers, iMabs, microbodies, peptide aptamers, Kunitz domains and affilins.
- CTLDs tetranectins
- adnectins monobodies
- anticalins DARPins (ankyrins)
- avimers iMabs, microbodies, peptide aptamers, Kunitz domains and affilins.
- an antibody or an antigen-binding fragment thereof includes substantially intact antibodies as well as fragments and derivatives of antibodies.
- an intact antibody can be regarded as an antibody comprising variable light regions, variable heavy regions, constant light regions and constant heavy regions.
- the term further includes chimeric antibodies, humanised antibodies, isolated human antibodies, single chain antibodies, bispecific antibodies, antibody heavy chains, antibody light chains, homodimers and heterodimers of antibody heavy and/or light chains, and antigen-binding fragments and derivatives of the same.
- Suitable antigen-binding fragments and derivatives include, but are not necessarily limited to, Fv fragments (e.g. single chain Fv and disulphide-bonded Fv), Fab-like fragments (e.g. Fab fragments, Fab’ fragments and F(ab) 2 fragments), single variable domains (e.g.
- VH and VL domains VH and VL domains
- domain antibodies dAbs, including single and dual formats [i.e. dAb-linker-dAb]
- the potential advantages of using antibody fragments, rather than whole antibodies, are several-fold.
- the smaller size of the fragments may lead to improved pharmacological properties, such as better penetration of solid tissue.
- antigen-binding fragments such as Fab, Fv, ScFv and dAb antibody fragments can be expressed in and secreted from E. coli, thus allowing the facile production of large amounts of the said fragments.
- the phrase “an antibody or an antigen-binding fragment thereof” is also intended to encompass antibody mimics (for example, non-antibody scaffold structures that have a high degree of stability yet allow variability to be introduced at certain positions).
- Exemplary antibody mimics include: affibodies (also called Trinectins; Nygren, 2008, FEBS J, 275, 2668-2676); CTLDs (also called Tetranectins; Innovations Pharmac. Technol. (2006), 27-30); adnectins (also called monobodies; Meth. Mol. Biol., 352 (2007), 95-109); anticalins (Drug Discovery Today (2005), 10, 23-33); DARPins (ankyrins; Nat. Biotechnol.
- chimeric T cell receptors also known as chimeric T cell receptors, chimeric immunoreceptors, and chimeric antigen receptors or CARs
- CARs chimeric antigen receptors
- These are engineered receptors, which graft an arbitrary specificity onto an immune effector cell.
- CARs are used to graft the specificity of a monoclonal antibody onto a T cell; with transfer of their coding sequence facilitated by retroviral vectors.
- fusions comprising a single chain variable fragment (scFv) derived from a monoclonal antibody fused to CD3-zeta transmembrane and endodomain.
- scFv single chain variable fragment
- T cells express this fusion molecule, they recognize and kill target cells that express the transferred monoclonal antibody specificity.
- modified versions of antibodies and antigen-binding fragments thereof whether existing now or in the future, e.g. modified by the covalent attachment of polyethylene glycol or another suitable polymer (see below). Methods of generating antibodies and antibody fragments are well known in the art.
- antibodies may be generated via any one of several methods which employ induction of in vivo production of antibody molecules, screening of immunoglobulin libraries (Orlandi. et al, 1989. Proc. Natl. Acad. Sci. U.S.A. 86:3833-3837; Winter et al., 1991, Nature 349:293-299, the disclosures of which are incorporated herein by reference) or generation of monoclonal antibody molecules by cell lines in culture. These include, but are not limited to, the hybridoma technique, the human B-cell hybridoma technique, and the Epstein-Barr virus (EBV)-hybridoma technique (Kohler et al., 1975.
- EBV Epstein-Barr virus
- antibody fragments can be obtained using methods well known in the art (see, for example, Harlow & Lane, 1988, “Antibodies: A Laboratory Manual”, Cold Spring Harbor Laboratory, New York, the disclosures of which are incorporated herein by reference).
- antibody fragments according to the present invention can be prepared by proteolytic hydrolysis of the antibody or by expression in E.
- amino acid as used herein includes the standard twenty genetically-encoded amino acids and their corresponding stereoisomers in the ‘D’ form (as compared to the natural ‘L’ form), omega-amino acids and other naturally-occurring amino acids, unconventional amino acids (e.g. ⁇ , ⁇ -disubstituted amino acids, N-alkyl amino acids, etc.) and chemically derivatised amino acids (see below).
- an amino acid when an amino acid is being specifically enumerated, such as “alanine” or “Ala” or “A”, the term refers to both L-alanine and D-alanine unless explicitly stated otherwise.
- Other unconventional amino acids may also be suitable components for polypeptides (the antibody or antigen-binding fragment thereof) of the present invention, as long as the desired functional property is retained by the antibody or antigen-binding fragment.
- each encoded amino acid residue where appropriate, is represented by a single letter designation, corresponding to the trivial name of the conventional amino acid.
- the antibody or antigen-binding fragment thereof of the present invention and as defined herein comprises or consists of L-amino acids.
- human or humanised antibodies are preferably used.
- Humanised forms of non-human antibodies e.g. rabbit antibodies as described in Examples 9 and 10.
- Humanised antibodies include antibodies in which complementary determining regions of a human antibody (recipient antibody) are replaced by residues from a complementary determining region of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired functionality.
- donor antibody complementary determining region of a non-human species
- Fv framework residues of the human antibody are replaced by corresponding non-human residues.
- Humanised antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported complementarity determining region or framework sequences.
- the humanised antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the complementarity determining regions correspond to those of a non human antibody and all, or substantially all, of the framework regions correspond to those of a relevant human consensus sequence.
- Humanised antibodies optimally also include at least a portion of an antibody constant region, such as an Fc region, typically derived from a human antibody.
- humanised antibodies may lack cross-reactivity to mouse IL1RAP.
- suitable surrogates e.g. mCAN10
- suitable surrogates that exhibit similar functional properties to the humanized antibodies can be used in murine disease models, where the surrogate results could be interpreted to reflect the functionality of the humanised antibody.
- humanised antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues, often referred to as imported residues, are typically taken from an imported variable domain. Humanisation can be essentially performed by substituting human complementarity determining regions with corresponding rodent complementarity determining regions. Accordingly, such humanised antibodies are chimeric antibodies, wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanised antibodies may be typically human antibodies in which some complementarity determining region residues and possibly some framework residues are substituted by residues from analogous sites in rodent antibodies.
- Human antibodies can also be identified using various techniques known in the art, including phage display libraries.
- the optimization of antibodies for example by humanization (see, for example, Jones et al., 1986, Nature 321:522- 525; Reichmann et al., 1988. Nature 332:323-327; Verhoeyen et al., 1988, Science 239:1534-15361; US 4,816,567, the disclosures of which are incorporated herein by reference) and/or de-immunization, as for example described in Jones et al. (Methods Mol Biol.2009;525:405-23) or in Examples 11 and 13, leads to the generation of antibody variants with fine-tuned properties.
- the antibody of the present invention is defined by its characteristic complementarity determining region (CDR) sequences.
- CDR sequences of an antibody There are several approaches for defining the CDR sequences of an antibody.
- the CDRs of the antibody of the present invention have been defined using three different and well-known approaches (resulting in three CDR-defining categories): 1) definition according to Kabat, 2) definition according to IMGT or 3) definition according to a combination of IMGT and Kabat.
- CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 may be defined according to either i) IMGT or ii) Kabat or iii) a combination of Kabat and IMGT.
- CDRs of the antibody of the invention by other approaches known in the art, for example by definition of CDRs according to Chothia (Al-Lazikani et al., (1997) JMB 273,927-948), Martin (Enhanced Chothia), Gelfand or Honneger. Further approaches exist and are known in the art, such as the AbM definition (combination of Kabat definition and Chothia definition used by Oxford Molecular's AbM antibody modelling software) or the contact definition (based on analysis of crystal structures). See, e.g., Kabat et al.
- CDR naming conventions or approaches are encompassed.
- the numbering systems of IMGT and Kabat identified slightly different residues as CDRs.
- these CDR sequences are short (shorter than, for example, an approach combining numbering systems), thus providing the core sequences critical for binding.
- the antibody or antigen-binding fragment thereof with binding specificity for interleukin-1 receptor accessory protein comprises: a light chain variable region comprising a) a CDR-L1 comprising or consisting of the amino acid sequence of ESISTA (SEQ ID NO: 1); a CDR-L2 comprising or consisting of the amino acid sequence of KAS; and a CDR-L3 comprising or consisting of the amino acid sequence of QQGFSSGNVHNA (SEQ ID NO: 3); or b) a CDR-L1 comprising or consisting of the amino acid sequence of QASESISTALA (SEQ ID NO: 7); a CDR-L2 comprising or consisting of the amino acid sequence of KASTLPS (SEQ ID NO: 8); and a CDR-L3 comprising or consisting of the amino acid sequence of QQGFSSGNVHNA (SEQ ID NO: 9); or c) a CDR-L1 comprising or consisting of the amino acid sequence of QASESISTALA (SEQ ID NO:
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises CDRs as described above (comprising or consisting of the amino acid sequence selected from the group consisting of SEQ ID NOs 1 to 18), wherein any one of the amino acids of the CDRs has been altered for another amino acid, for example, with the proviso that no more than 2 amino acids have been so altered, such as 1 amino acid.
- Light chain variable regions As elaborated in Example 9, rabbits were immunized with human and murine IL1RAP.
- resulting antibodies were analysed for desired properties, such as binding to IL1RAP and capacity to inhibit signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ .48D2 was identified as an antibody with superior properties with regard to these features, and has subsequently been modified and optimized with the aim to improve the antibody for clinical and therapeutic application.
- This optimization procedure resulted in antibody variants harbouring variable light chain regions and variable heavy chain regions with different amino acid sequences.
- the CDRs are identical for all antibody variants.
- the CDR sequences (CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 or CDR-H3, respectively), are the same for the chimeric antibody 48D2 and all optimized antibody variants thereof.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain variable region comprising the CDRs comprising or consisting of an amino acid sequence selected from the group consisting of ESISTA (SEQ ID NO: 1), QASESISTALA (SEQ ID NO: 7) and QASESISTALA (SEQ ID NO: 13); comprising or consisting of an amino acid sequence selected from the group consisting of KAS, KASTLPS (SEQ ID NO: 8) and KASTLPS (SEQ ID NO: 14); and/or comprising or consisting of an amino acid sequence selected from the group consisting of QQGFSSGNVHNA (SEQ ID NO: 3), QQGFSSGNVHNA (SEQ ID NO: 9) and QQGFSSGNVHNA (SEQ ID NO: 15).
- ESISTA SEQ ID NO: 1
- QASESISTALA SEQ ID NO: 7
- QASESISTALA SEQ ID NO: 13
- KAS KASTLPS
- KASTLPS S
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain variable region comprising the CDRs comprising a) a CDR-L1 comprising or consisting of the amino acid sequence of ESISTA (SEQ ID NO: 1); a CDR-L2 comprising or consisting of the amino acid sequence of KAS; and a CDR-L3 comprising or consisting of the amino acid sequence of QQGFSSGNVHNA (SEQ ID NO: 3); b) a CDR-L1 comprising or consisting of the amino acid sequence of QASESISTALA (SEQ ID NO: 7); a CDR-L2 comprising or consisting of the amino acid sequence of KASTLPS (SEQ ID NO: 8); and a CDR-L3 comprising or consisting of the amino acid sequence of QQGFSSGNVHNA (SEQ ID NO: 9); or c) a CDR-L1 comprising or consisting of the amino acid sequence of QASESISTALA (SEQ ID NO
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain variable region comprising or consisting of the amino acid sequence of SEQ ID NO: 19; or an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 19, for example at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity.
- This light chain variable region is, for example, part of the chimeric (non-humanized, non-optimized) 48D2 antibody as described in Examples 9 and 10.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain variable region comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24 and SEQ ID NO: 25; or an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24 or SEQ ID NO: 25, for example at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity.
- These light chain variable regions are, for example, part of the humanized h48D2 antibody variants as described in Examples 11 and 12.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain variable region comprising or consisting of the amino acid sequence of SEQ ID NO: 31; or an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 31, for example at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity.
- This light chain variable region is, for example, part of the humanized and de- immunized 48D2 antibody variant as described in Examples 13 and 14.
- Percent identity can be determined by, for example, the LALIGN program at the Expasy facility site (http://www.ch.embnet.org/software/LALIGN_form.html) using as parameters the global alignment option, scoring matrix BLOSUM62, opening gap penalty –14, extending gap penalty –4.
- the percent sequence identity between two polypeptides, such as parts of an antibody may be determined using suitable computer programs, for example the GAP program of the University of Wisconsin Genetic Computing Group and it will be appreciated that percent identity is calculated in relation to polypeptides whose sequence has been aligned optimally. The alignment may alternatively be carried out using the Clustal W program.
- the parameters used may be as follows: - Fast pair-wise alignment parameters: K-tuple(word) size; 1, window size; 5, gap penalty; 3, number of top diagonals; 5. Scoring method: x percent. - Multiple alignment parameters: gap open penalty; 10, gap extension penalty; 0.05. - Scoring matrix: BLOSUM.
- the BESTFIT program may be used to determine local sequence alignments.
- the person skilled in the art will consider further alterations to the above described light chain variable regions, for example to further optimize the antibody or antigen-binding fragment. For example, the person skilled in the art will, as done during humanization and de-immunization procedures, consider to alter amino acids in the framework regions, i.e. outside the epitope binding CDR regions, thereby not altering the CDR regions.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain variable region as described above, wherein any one of the amino acids of the framework region of the light chain variable region has been altered for another amino acid, with the proviso that no more than 5 amino acids have been so altered, such as 4 amino acids, no more than 3 amino acids, such as 2 amino acids or no more than 1 amino acid.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain variable region comprising the CDRs comprising or consisting of an amino acid sequence selected from the group consisting of GPSLSHFD (SEQ ID NO: 4), HFDIT (SEQ ID NO: 10) and GPSLSHFDIT (SEQ ID NO: 16); comprising or consisting of an amino acid sequence selected from the group consisting of ISPGVST (SEQ ID NO: 5), TISPGVSTYYASWAKS (SEQ ID NO: 11) and TISPGVSTYYASWAKS (SEQ ID NO: 17); and comprising or consisting of an amino acid sequence selected from the group consisting of ARGGVGSSWKAFDL (SEQ ID NO: 6), GGVGSSWKAFDL (SEQ ID NO: 12) and ARGGVGSSWKAFDL (SEQ ID NO: 18).
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain variable region comprising a) a CDR-H1 comprising or consisting of the amino acid sequence of GPSLSHFD (SEQ ID NO: 4); a CDR-H2 comprising or consisting of the amino acid sequence of ISPGVST (SEQ ID NO: 5); and a CDR-H3 comprising or consisting of the amino acid sequence of ARGGVGSSWKAFDL (SEQ ID NO: 6); b) a CDR-H1 comprising or consisting of the amino acid sequence of HFDIT (SEQ ID NO: 10); a CDR-H2 comprising or consisting of the amino acid sequence of TISPGVSTYYASWAKS (SEQ ID NO: 11); and a CDR-H3 comprising or consisting of the amino acid sequence of GGVGSSWKAFDL (SEQ ID NO: 12); or c) a CDR-H1 comprising or consisting of the amino acid sequence of GPSLSHFD
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain variable region comprising or consisting of the amino acid sequence of SEQ ID NO: 20; or an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 20, for example at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity.
- This heavy chain variable region is, for example, part of the chimeric (non-humanized, non-optimized) 48D2 antibody as described in Examples 9 and 10.
- the antibody or antigen binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain variable region comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 and SEQ ID NO: 30; or an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO: 30, for example at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity.
- These heavy chain variable regions are, for example, part of the humanized h48D2 antibody variants as described in Examples 11 and 12.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain variable region comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID NO: 32, SEQ ID NO: 33 and SEQ ID NO: 34; or an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 32, SEQ ID NO: 33 or SEQ ID NO: 34, for example at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity.
- These heavy chain variable regions are, for example, part of the humanized and de- immunized 48D2 antibody variants as described in Examples 13 and 14.
- the person skilled in the art will consider further alterations to the above described heavy chain variable regions, for example to further optimize the antibody or antigen- binding fragment.
- the person skilled in the art will, as done during humanization and de-immunization procedures, consider to alter amino acids in the framework regions, i.e. outside the epitope binding CDR regions, thereby not altering the CDR regions.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain variable region as described above, wherein any one of the amino acids of the framework region of the heavy chain variable region has been altered for another amino acid, with the proviso that no more than 5 amino acids have been so altered, such as 4 amino acids, no more than 3 amino acids, such as 2 amino acids or no more than 1 amino acid.
- a heavy chain variable region as described above, wherein any one of the amino acids of the framework region of the heavy chain variable region has been altered for another amino acid, with the proviso that no more than 5 amino acids have been so altered, such as 4 amino acids, no more than 3 amino acids, such as 2 amino acids or no more than 1 amino acid.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 19 and a heavy chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 20, or an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 19 or SEQ ID NO: 20, for example at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity.
- This combination of light and heavy chain variable regions is, for example, part of the chimeric (non-humanized, non-optimized) 48D2 antibody as described in Examples 9 and 10.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises: a) a light chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 21 and a heavy chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 26; b) a light chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 21 and a heavy chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 27; c) a light chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 21 and a heavy chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 28; d) a light chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 21 and a heavy chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 29; e) a light chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO:
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises: a) a light chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 24 and a heavy chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 30; b) a light chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 24 and a heavy chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 32; c) a light chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 24 and a heavy chain variable region which comprises or consists of the amino acid sequence of SEQ ID NO: 33; d) a light chain variable region which comprises or consists of the amino acid sequence
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain variable region which comprises or consists of SEQ ID NO: 24 and a heavy chain variable region which comprises or consists of SEQ ID NO: 34.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain variable region which comprises or consists of SEQ ID NO: 31 and a heavy chain variable region which comprises or consists of SEQ ID NO: 34.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain variable region as described above, wherein any one of the amino acids of the framework region of the light chain variable region and/or the heavy chain variable region has been altered for another amino acid, with the proviso that no more than 5 amino acids have been so altered, such as 4 amino acids, no more than 3 amino acids, such as 2 amino acids or no more than 1 amino acid.
- Constant regions and Fc part The person skilled in the art will appreciate that any light constant region known in the art can be combined with any of the above described variants of light variable regions, and that any heavy constant region known in the art can be combined with any of the above described variants of heavy variable regions, to form a full antibody.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain constant region, or part thereof.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain constant region which is of a kappa or lambda light chain.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a kappa light chain. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a lambda light chain. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a light chain constant region comprising or consisting of the amino acid sequence of SEQ ID NO: 35, or an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 35, for example at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain constant region, or part thereof. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain constant region which is selected from the group consisting of ⁇ , ⁇ , ⁇ , ⁇ and ⁇ . In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain constant region which is of an immunoglobulin isotype selected from the group consisting of IgA, IgD, IgG, IgE and IgM.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain constant region which is of an IgG immunoglobulin isotype. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is an IgG antibody. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a heavy chain constant region which is of an immunoglobulin subclass selected from the group consisting of IgG1, IgG2, IgG3 and IgG4. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is an IgG1 antibody.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is an IgG2 antibody. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is an IgG3 antibody. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is an IgG4 antibody.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises or consists of a heavy chain constant region comprising or consisting of the amino acid sequence of SEQ ID NO: 36 or SEQ ID NO: 2, or an amino acid sequence having at least 70% sequence identity to SEQ ID NO: 36 or SEQ ID NO: 2, for example at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises or consists of a light chain constant region and/or a heavy chain constant region wherein any one of the amino acids of the above mentioned light chain constant region and/or above mentioned heavy chain constant region has been altered for another amino acid, with the proviso that no more than 5 amino acids have been so altered, such as 4 amino acids, no more than 3 amino acids, such as 2 amino acids or no more than 1 amino acid.
- the antibody or antigen-binding fragment of the present invention comprises a CH1, CH2 and/or CH3 region of an IgG heavy chain (such as an IgG1, IgG2, IgG3 or IgG4 heavy chain).
- the antibody or antigen-binding fragment may comprise part or all of the constant regions from an IgG1 heavy chain.
- the antibody or antigen-binding fragment may be a Fab fragment comprising CH1 and CL constant regions, combined with any of the above-defined heavy and light variable regions, respectively.
- the above-defined antibodies or antigen-binding fragments of the invention may further comprise a light chain constant region, or part thereof.
- the antibody or antigen-binding fragment may comprise a CL region from a kappa or lambda light chain.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises or consists of - any one of the above mentioned light chain variable regions; and/or - any one of the above mentioned heavy chain variable regions; and/or - any one of the above mentioned light chain constant regions; and/or - any one of the above mentioned heavy chain constant region.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises -a light chain variable region comprising or consisting of the amino acid sequence selected from the group consisting of an amino acid sequence of SEQ ID NOs 19, 21, 22, 23, 24, 25 and 31; and/or -a heavy chain variable region comprising or consisting of an amino acid sequence selected from the group consisting of SEQ ID NOs 20, 26, 27, 28, 29, 30, 32, 33, and 34; and/or -a light chain constant region comprising or consisting of the amino acid sequence of SEQ ID NO 35; and/or -a heavy chain constant region comprising or consisting of the amino acid sequences of SEQ ID NOs 36 or 2.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises an Fc region. Fc region may also be referred to as Fc domain. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises an Fc region which is naturally occurring. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises an Fc region which is non-naturally occurring. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises an Fc region with a modified, for example with a mutated, IgG constant region.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises an Fc region wherein the Fc region comprises one or more of the mutations identified in Table 1.
- the Fc region may be naturally occurring (e.g. part of an endogenously produced antibody) or may be artificial (e.g. comprising one or more point mutations relative to a naturally-occurring Fc region).
- the Fc region of an antibody mediates its serum half- life and effector functions, such as complement-dependent cytotoxicity (CDC), antibody- dependent cellular cytotoxicity (ADCC) and antibody dependent cell phagocytosis (ADCP).
- FcRn which is expressed on the surface of endothelial cells, binds the IgG in a pH-dependent manner and protects it from degradation.
- the four human IgG isotypes bind the activating Fc ⁇ receptors (Fc ⁇ RI, Fc ⁇ RIIa, Fc ⁇ RIIIa), the inhibitory Fc ⁇ RIIb receptor, and the first component of complement (C1q) with different affinities, yielding very different effector functions (Bruhns et al., 2009, Blood.113(16):3716-25, the disclosures of which are incorporated herein by reference). Binding of IgG to the Fc ⁇ Rs or C1q depends on residues located in the hinge region and the CH2 domain. Two regions of the CH2 domain are critical for Fc ⁇ Rs and C1q binding, and have unique sequences in IgG2 and IgG4.
- Lazar et al. described a triple mutant (S239D/I332E/A330L) with a higher affinity for Fc ⁇ RIIIa and a lower affinity for Fc ⁇ RIIb resulting in enhanced ADCC (Lazar et al., 2006, PNAS 103(11):4005–4010, the disclosures of which are incorporated herein by reference). The same mutations were used to generate an antibody with increased ADCC (Ryan et al., 2007, Mol. Cancer Ther.
- IgG4 antibodies represent a preferred IgG subclass for receptor blocking without cell depletion (i.e. inhibition of IL-1 signaling).
- IgG4 molecules can exchange half-molecules in a dynamic process termed Fab-arm exchange. This phenomenon can also occur in vivo between therapeutic antibodies and endogenous IgG4.
- the S228P mutation has been shown to prevent this recombination process allowing the design of less unpredictable therapeutic IgG4 antibodies (Labrijn et al., 2009, Nat Biotechnol.27(8):767-71, the disclosures of which are incorporated herein by reference).
- Examples of engineered Fc regions are shown in Table 1 below. Table 1: Examples of Engineered Fc C C * The position of the Fc amino acid mutations is defined using the EU Numbering Scheme (see Edelman et al., 1969, Proc. Natl. Acad. Sci.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises an Fc region wherein the Fc region comprises one or more of the mutations selected from the group consisting of L234A, L235A, P329G, G237A, P238S, H269A, A330S and P331S as defined by the EU Index. These mutations may reduce the effector function of the antibody.
- the EU Index is conventionally used in the art (see generally, Kabat et al, 1991). The person skilled in the art will appreciate that the exact position of the herein described Fc mutations may differ in the antibody of the invention.
- variable regions This is due to species variations in chimeric antibodies (and therefrom humanized or humanized/de- immunized antibodies) due to species differences in the variable regions. Varying lengths of regions in the variable heavy region lead to a shift of amino acid positions as compared to the one in the EU Index. However, the relative position of the amino acids in the Fc part is preserved.
- the LALA mutation is defined by the EU index to be at position L234A, L235A.
- An exemplary antibody of the present invention may comprise a variable heavy chain region of, for example SEQ ID NO: 20 Heavy chain variable region (non-humanized, non-deimmunized) QEQLEESGGGLVKPGGSLTLTCTVSGPSLSHFDITWVRQAPGSGLEWIGTISPGVSTYY ASWAKSRSTITSNTNLNTVTLKMTSLTAADTATYFCARGGVGSSWKAFDLWGPGTLVTI SS and a constant heavy chain (not containing the LALA mutation) of, for example SEQ ID NO: 36 Immunoglobulin IgG1 constant heavy chain (heavy chain constant region) (za allotype) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELL GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises an Fc region, wherein the glycan attached to the Fc region is lacking fucose. In some embodiments, the antibody or antigen binding fragment thereof with binding specificity for IL1RAP comprises an Fc region which is lacking fucose.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises an Fc region, wherein the glycan attached to the Fc region is low in fucose. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises an Fc region which is low in fucose. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP, wherein the antibody or antigen-binding fragment is produced in a FUT8 negative cell line. In some embodiments, the antibody is produced in a FUT8 negative cell line.
- FUT8 negative cell lines by knocking out the FUT8 gene, which encodes for the a-(1,6)-fucosyltransferase enzyme, which in turn catalyses fucose transfer.
- Antibodies comprising reduced fucosylation of the Fc region exhibit enhanced ADCC activity, as described in WO 00/61739 A1. It will be appreciated by a skilled person in the art that FUT8 negative cell lines are useful when producing antibodies with enhanced ADCC activity.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is an intact antibody, or part of an intact antibody.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is comprising or consisting of an antigen-binding fragment selected from the group consisting of Fv fragments (e.g. single chain Fv and disulphide-bonded Fv), Fab-like fragments (e.g. Fab fragments, Fab’ fragments and F(ab) 2 fragments) and domain antibodies (e.g. single V H variable domains or V L variable domains).
- Fv fragments e.g. single chain Fv and disulphide-bonded Fv
- Fab-like fragments e.g. Fab fragments, Fab’ fragments and F(ab) 2 fragments
- domain antibodies e.g. single V H variable domains or V L variable domains.
- Interleukins such as interleukins of the IL-1 family, as are cytokines.
- Cytokines include, for example, chemokines, interferons, interleukins, lymphokines, and tumour necrosis factors
- cytokines have a signaling function to the cell, for example via binding to the respective receptor.
- IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ signaling encompasses the events that these cytokines trigger on the cell surface or in the cell.
- these signaling events affect, for example, the confirmation of the receptor, the properties of co-receptors and other molecules, the binding of molecules extracellularly, on the cell surface, in or at the cell membrane or in the cell.
- These events may be physiological or pathological.
- These events may be biological pathways, leading for example to a response in the cell as a reaction to the signaling. This response may be physiological or pathological.
- inhibittion of signaling is defined as a reduction of said signaling event, or of, for example, the activity, confirmation, or production of a receptor or biological pathway or molecule activity.
- This inhibition is to be understood as comparing the situation where the inhibiting factor (in the case of the present invention the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP) is present compared to the situation where the inhibiting factor is not present.
- the person skilled in the art will appreciate that the degree of inhibition can be determined by methods well known in the art, depending on the signaling event or pathway or activity to be measured. This method can be, for example, a cell assay, for examples as described in Examples 10, 12 or 14. It is to be noted that, as used herein, phrases such as “inhibiting signaling of (for example) IL-1 ⁇ ” are used interchangeably with the phrase “inhibiting (for example) IL- 1 ⁇ signaling”.
- IL-1 Interleukin-1 is a potent pro-inflammatory cytokine that can be produced by a variety of cell types, including mononuclear phagocytes, in response to infection and inflammation.
- the IL-1 family consists of seven agonists, including IL-1 ⁇ and IL-1 ⁇ , and three naturally occurring receptor antagonists, including the IL 1 receptor antagonist (IL 1Ra or IL1RA) (Dinarello, CA, Blood 1996, 87(6): 2095-147). Two IL-1 receptors, IL-1R type I and IL-1R type II, have been identified. Both receptors can interact with all three forms of the IL-1 family molecules.
- IL-1RI is responsible for mediating IL-1-induced cellular activation.
- IL-1RAP IL-1R Accessory Protein
- IL1RAP is critical for mediating the effects of IL33, through the ST2/IL1RAP complex, and IL36, through the IL1Rrp2/IL1RAP complex (Garlanda et al, Immunity.2013 Dec 12;39(6):1003-18).
- IL-1 ⁇ is also released from damaged cells and can act as an alarmin.
- IL-1 is a potent pro-inflammatory cytokine, which is induced at sites of local infection or inflammation and is involved in the regulation of a variety of physiological and cellular events (summarised in Dinarello CA, CHEST, 2000, 118: 503-508 and Dinarello, CA, Clin Exp Rheumatol, 2002, 20(5 Suppl 27): S1-13). It is capable of activating several cell types including leukocytes and endothelial cells. IL-1 induces and amplifies immunological responses by promoting the production and expression of adhesion molecules, cytokines, chemokines and other inflammatory mediators such as prostaglandin E 2 and nitric oxide (NO). As a consequence, local inflammation is amplified and sustained.
- cytokines cytokines
- chemokines chemokines
- NO nitric oxide
- IL-1 is a hematopoietic growth factor and has been shown to reduce the nadir of leukocytes and platelets in patients during bone marrow transplantation.
- IL-1 has also been shown to promote angiogenesis by inducing the production of vascular endothelial growth factor, thereby promoting pannus formation and blood supply in rheumatic joints.
- IL-1 has been shown to promote the bone and cartilage degradation in rheumatic diseases.
- IL-1 has been implicated as an important player in the inflammatory response in cardiovascular and fibrotic diseases.
- IL-33 IL-33 is normally released by damaged or necrotic barrier cells (endothelial and epithelial cells), acting as an alarmin, an endogenous danger signal, to alert the immune system of tissue damage during trauma or infection (Liew FY, Interleukin 33 in health and disease. Nature Reviews Immunology, 16, 676–689 (2016)).
- IL-33 induces T helper 2 (Th2) cells, mast cells, type 2 innate lymphoid cells, eosinophils, and basophils to produce type 2 cytokines (e.g. IL-5, IL-13).
- Th2 T helper 2
- IL-33 is also known to target endothelial cells and induce angiogenesis.
- IL-33 As a Th2 inducing cytokine, IL-33 has been implicated in e.g. asthma, allergic diseases, inflammatory bowel disease, and dermatitis. IL-33 can potently stimulate a wide range of cells and its pleiotropic nature is reflected in the role of IL-33 in tissue and metabolic homeostasis, infection, inflammation, cancer and diseases of the central nervous system.
- IL-36 The IL-36 cytokines ⁇ , ⁇ , ⁇ are expressed in a variety of cell types, with abundant expression in e.g. keratinocytes, bronchial epithelium, neuronal cells, dendritic cells, and macrophages.
- IL-36 is most active in barrier tissues (like the skin, lung, and intestines), suggesting that their main responsibility is to regulate the interaction of the environment and the body.
- IL-36 is known to activate NF- ⁇ B and mitogen-activated protein kinases in target cells expressing the IL-36 receptor, such as keratinocytes, monocytes, dendritic cells and CD4 T cells. Emerging evidence indicates that IL-36 signaling is involved in the activation of innate and adaptive immune responses (Ding L, IL-36 cytokines in autoimmunity and inflammatory disease, Oncotarget, Vol. 9, (No. 2), pp: 2895-2901 (2016)).
- IL-36 Besides its critical role in inflammatory skin diseases such as psoriasis and atopic dermatitis, emerging evidence suggests that aberrant IL-36 activities also promote inflammatory diseases in the lung, kidneys, and intestines, underscoring the potential of IL-36 as a therapeutic target for common inflammatory diseases.
- all cytokines described herein IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ , IL-36 ⁇
- stromal cells such as fibroblasts and endothelial cells. Consequently, apart from the well-established impact of these cytokines in inflammatory diseases and disorders, these cytokines are also implicated in fibrotic diseases or disorders.
- the antibody or antigen-binding fragment thereof has the capacity to inhibit signaling of the interleukin-1 (IL-1) family of cytokine ligands and/or receptors.
- IL-1 interleukin-1
- the person skilled in the art will appreciate that inhibition occurs upon binding of the antibody or antigen-binding fragment to the epitope on IL1RAP.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inhibiting signaling upon binding to IL1RAP.
- binding of the antibody or antigen- binding fragment thereof to IL1RAP can affect IL1RAP in different ways, for example on a molecular level or on a conformational level.
- binding of the antibody or antigen-binding fragment thereof to IL1RAP affects IL1RAP.
- binding of the antibody or antigen-binding fragment thereof to IL1RAP can affect the association of IL1RAP with IL-1 receptor, IL-33 receptor and/or IL-36 receptor, respectively. Consequently, the appropriate receptor complex consisting of IL1RAP as co-receptor and any one of IL-1 receptor, IL-33 receptor or IL- 36 receptor, might not be formed.
- cytokines such as IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ bind to their cognate receptor (IL-1 receptor, IL-33 receptor or IL-36 receptor, respectively)
- signaling of these cytokines might be impaired, such as inhibited, such as blocked, such as essentially completely inhibited, such as partially inhibited.
- the person skilled in the art will appreciate that not all IL1RAP binding antibodies, binding to any one epitope of IL1RAP, can disturb the association between IL1RAP with IL-1 receptor, IL-33 receptor and/or IL-36 receptor, respectively, and thereby inhibit signaling. It is an achievement of the present invention to provide such an antibody.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inhibiting signaling of interleukin-1 (IL-1) family cytokine ligands and/or receptors. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inhibiting signaling of IL1RAP-dependent interleukin-1 (IL-1) family of cytokine ligands and/or receptors.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inhibiting signaling of at least one cytokine selected from the group consisting of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ , or any combination thereof.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP thereof is capable of inhibiting signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL- 36 ⁇ , IL-36 ⁇ and IL-36 ⁇ .
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inhibiting signaling of IL-1 ⁇ .
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inhibiting signaling of IL-1 ⁇ . In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inhibiting signaling of IL-33. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP thereof is capable of inhibiting signaling of IL-36 ⁇ . In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inhibiting signaling of IL-36 ⁇ .
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inhibiting signaling of IL-36 ⁇ .
- inhibition of signaling can be of a varying degree. Inhibition of signaling can be complete or essentially complete, such as blocking of signaling. Inhibition of signaling can also be partial, such as decreasing the signaling, such as non-complete. “Essentially complete” is to be understood as “complete” given uncertainties of assessing completeness associated with the methodology used to measure the inhibition of signaling.
- signaling may be inhibited by at least 10%, 20%, 30%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98%, 99% or more relative to signaling in the absence of the antibody or antigen-binding fragment of the invention.
- inhibition of signaling is between 10 to 100% relative to signaling in the absence of the antibody or antigen-binding fragment of the invention. More preferably, the inhibition of signaling is between 25 to 100%. Even more preferably, the inhibition of signaling is between 50 to 100%. Signaling may be inhibited by 100% relative to signaling in the absence of the antibody or antigen-binding fragment of the invention.
- the degree of inhibition of IL-1, IL-33 and/or IL-36 signaling by the antibody or antigen- binding fragment of the invention may be determined using methods well known in the art, for example by the method used in Examples 10, 12 and 14.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of essentially completely inhibiting signaling.
- inhibiting signaling is essentially complete inhibition of signaling.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of essentially completely inhibiting signaling of at least one cytokine selected from the group consisting of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ , or any combination thereof.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of essentially completely inhibiting signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ .
- the antibody might further inhibit signaling to a certain degree, meaning not essentially completely, meaning partially.
- the antibody or antigen binding fragment thereof with binding specificity for IL1RAP is capable of partially inhibiting signaling. In some embodiments, inhibiting signaling is partial inhibition of signaling. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of partially inhibiting signaling of at least one cytokine selected from the group consisting of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ , or any combination thereof.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of partially inhibiting signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ . In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inhibiting signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL- 36 ⁇ and/or IL-36 ⁇ by at least 10%, 20%, 30%, 50%, 60%, 75%, 80%, 85%, 90%, 95%, 98%, 99% relative to signaling in the absence of the antibody or antigen-binding fragment of the invention.
- complete inhibition is desirable in some situations where a process, e.g. a disease process depending on signaling of IL-1 ⁇ , IL- 1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ , should be affected completely and fast to alleviate or treat the disease.
- partial inhibition is desirable where a process, e.g. a disease process depending on signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ , should be modified but not be affected completely, for example to avoid side effects of complete inhibition.
- the person skilled in the art will further appreciate that biological systems are complex and entail various known or unknown feedback loops, which can make it challenging to assess if a process is inhibited completely. Further, this assessment also depends on the sensitivity of the method with which the process, e.g. signaling, is measured. The person skilled in the art will know which method and cut-off values are established and accepted in the field to use to assess the completeness or essential completeness of inhibition of signaling or to assess the degree of partial inhibition of signaling. As shown and explained in detail in the Examples below, antibodies can be subjected to modifications to optimize certain properties. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is humanized.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is a human antibody. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is de-immunized. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is humanized and de-immunized. In some embodiments, the antibody or antigen-binding fragment thereof is monoclonal. Properties of the antibody The antibodies of the present invention were identified after extensive screening of a large number of anti-IL1RAP antibodies, on the basis of exhibiting properties that make them particularly suitable as diagnostic and therapeutic agents for inflammatory, fibrotic and/or neoplastic diseases or disorders.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits one or more of the following properties: a) a binding affinity (K D ) for IL1RAP characterized by a K D -value of 3 nM or less; b) binding to domain 2 of IL1RAP, preferably binding to the H2 region of domain 2, wherein the H2 region comprises or consists of the amino acids of SEQ ID NO: 39; c) cross-reactivity with IL1RAP from cynomolgus monkey or pig; d) an inhibitory action on IL-1 ⁇ signaling; e) an inhibitory action on IL-1 ⁇ signaling; f) an inhibitory action on IL-33 signaling; g) an inhibitory action on IL-36 ⁇ signaling; h) an inhibitory action on IL 36 ⁇ signaling; i) an inhibitory action on IL-36 ⁇ signaling; j) internalization by IL1RAP-expressing cells.
- K D binding affinity
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits one of the above named properties. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits two of the above named properties. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits three of the above named properties. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits four of the above named properties. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits five of the above named properties.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits six of the above named properties. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits seven of the above named properties. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits eight of the above named properties. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits nine of the above named properties.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP exhibits all of the above named properties.
- the antibody or antigen binding fragment thereof with binding specificity for IL1RAP exhibits all of the following properties: a) a binding affinity (K D ) for IL1RAP characterized by a K D -value of 3 nM or less; b) binding to domain 2 of IL1RAP, preferably binding to the H2 region of domain 2, wherein the H2 region comprises or consists of the amino acids of SEQ ID NO: 39; c) cross-reactivity with IL1RAP from cynomolgus monkey or pig; d) an inhibitory action on IL-1 ⁇ signaling; e) an inhibitory action on IL-1 ⁇ signaling; f) an inhibitory action on IL-33 signaling; g) an inhibitory action on IL-36 ⁇ signaling; h) an inhibitory action on IL-36 ⁇ signaling; i) an inhibitory action on IL-36 ⁇ signaling; j) internalization by IL1RAP-expressing cells.
- K D binding affinity
- the H2 region corresponds to amino acids 174-191 based on the IL1RAP amino acid sequence from Uniprot ID Q9NPH3.
- the binding affinity (K D ) of the antibody or antigen-binding fragment thereof for IL1RAP is 3 nM or less, such as 2.75 nM, for example 2.5 nM, such as 2 nM, for example 1.75 nM, such as 1.5 nM, for example 1.25 nM, such as 1 nM, for example 0.75 nM, such as 0.5 nM or for example 0.5 nM.
- the binding affinity (K D ) of the antibody or antigen-binding fragment thereof for IL1RAP is 3000 pM or less, such as 2750 pM, for example 2500 pM, such as 2000 pM, for example 1750 pM, such as 1500 pM, for example 1250 pM, such as 1000 pM, for example 750 pM, such as 700 pM, for example 650 pM, such as 600 pM, for example 550 pM, such as 500 pM, for example 450 pM, such as 400 pM, for example 350 pM, such as 300 pM, for example 250 pM, such as 200 pM, for example 150 pM, such as 100 pM, for example 50 pM.
- an IL1RAP antibody apart from being able to inhibit cytokine signaling (for example of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ , and/or IL-36 ⁇ ), can exhibit one or more further functions. These functions can be conveyed by the constant region of the antibody or the Fc region. Examples of these functions are antibody-dependent cell-mediated cytotoxicity (ADCC) and/or antibody-dependent cellular phagocytosis (ADCP), thereby leading to the killing of target cells, such as IL1RAP-expressing tumor cells.
- ADCC antibody-dependent cell-mediated cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inducing ADCC of cells expressing IL1RAP. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is not capable of inducing ADCC of cells expressing IL1RAP. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inducing ADCP of cells expressing IL1RAP. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is not capable of inducing ADCP of cells expressing IL1RAP.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is capable of inducing ADCC and ADCP of cells expressing IL1RAP. Modifications of the antibody
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP further comprises a moiety for increasing the in vivo half-life of the agent.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP further comprises a moiety for increasing the in vivo half-life of the agent, wherein the moiety for increasing the in vivo half-life is selected from the group consisting of polyethylene glycol (PEG), human serum albumin, glycosylation groups, fatty acids and dextran.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP is PEGylated. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP fragment is covalently bound, directly or indirectly (e.g. via a chelator), to a functional moiety such as a cytotoxic or detectable moiety. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a cytotoxic moiety. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprising a cytotoxic moiety, wherein the cytotoxic moiety comprises or consists of a radioisotope.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprising a cytotoxic moiety which comprises or consists of a radioisotope wherein the radioisotope is selected from the group consisting of beta- emitters, auger-emitters, conversion electron-emitters, alpha-emitters, and low photon energy-emitters.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprising a cytotoxic moiety which comprises or consists of a radioisotope, wherein the radioisotope has an emission pattern of locally absorbed energy that creates a high dose absorbance in the vicinity of the agent.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprising a cytotoxic moiety which comprises or consists of a radioisotope, wherein the radioisotope is selected from the group consisting of long- range beta-emitters, such as 90 Y, 32 P, 186 Re/ 186 Re; 166 Ho, 76 As/ 77 As, 153 Sm; medium range beta-emitters, such as 131 I, 177 Lu, 67 Cu, 161 Tb; low-energy beta-emitters, such as 45 Ca, 35 S or 14 C; conversion or auger-emitters, such as 51 Cr, 67 Ga, 99 Tc m , 111 In, 123 I, 125 I, 201 Tl; and alpha-emitters, such as 212 Bi, 213 Bi, 223 Ac, and 221 At.
- the radioisotope is selected from the group consisting of long- range beta-emitters, such as 90 Y, 32 P, 186
- the antibody or antigen binding fragment thereof with binding specificity for IL1RAP comprising a cytotoxic moiety which comprises or consists of a radioisotope, wherein the radioisotope is 177 Lu.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a cytotoxic moiety, wherein the cytotoxic moiety comprises or consists of a cytotoxic drug.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprising a cytotoxic moiety which comprises or consists of a cytotoxic drug, wherein the cytotoxic drug is selected from the group consisting of a cytostatic drug; an anti-androgen drug; cortisone and derivatives thereof; a phosphonate; a testosterone-5- ⁇ -reductase inhibitor; a boron addend; a cytokine; thapsigargin and its metabolites; a toxin (such as saporin or calicheamicin); a chemotherapeutic agent (such as an antimetabolite); or any other cytotoxic drug useful in the treatment of neoplastic disorders.
- a cytotoxic drug is selected from the group consisting of a cytostatic drug; an anti-androgen drug; cortisone and derivatives thereof; a phosphonate; a testosterone-5- ⁇ -reductase inhibitor; a boron addend; a
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprising a cytotoxic moiety which comprises or consists of a cytotoxic drug, wherein the cytotoxic drug is suitable for use in activation therapy, such as photon activation therapy, neutron activation therapy, neutron induced Auger electron therapy, synchrotron irradiation therapy, or low energy X-ray photon activation therapy.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a detectable moiety.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a detectable moiety, wherein the detectable moiety comprises or consists of a radioisotope.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a detectable moiety comprising or consisting of a radioisotype, wherein the radioisotope is selected from the group consisting of 99m Tc, 111 In, 67 Ga, 68 Ga, 72 As, 89 Zr, 123 I and 201 Tl.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a detectable moiety comprising or consisting of a radioisotype, wherein the radioisotope is 89 Zr.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a pair of detectable and cytotoxic radioisotopes, such as 86 Y/ 90 Y or 124 I/ 211 At.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a radioisotype which is capable of simultaneously acting in a multi-modal manner as a detectable moiety and as a cytotoxic moiety.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a detectable moiety which comprises or consists of a paramagnetic isotope. In some embodiments, the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a detectable moiety which comprises or consists of a paramagnetic isotope, wherein the paramagnetic isotope is selected from the group consisting of 157 Gd, 55 Mn, 162 Dy, 52 Cr and 56 Fe.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a detectable moiety, wherein the detectable moiety is detectable by an imaging technique such as SPECT, PET, MRI, optical or ultrasound imaging.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a cytotoxic moiety and/or detectable moiety, wherein the cytotoxic moiety and/or detectable moiety is joined to the antibody or antigen- binding fragment thereof indirectly, via a linking moiety.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a cytotoxic moiety and/or detectable moiety, wherein the cytotoxic moiety and/or detectable moiety is joined to the antibody or antigen- binding fragment thereof indirectly, via a linking moiety, wherein the linking moiety is a chelator.
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP comprises a cytotoxic moiety and/or detectable moiety, wherein the cytotoxic moiety and/or detectable moiety is joined to the antibody or antigen- binding fragment thereof indirectly, via a linking moiety, wherein the linking moiety is a chelator, and wherein the chelator is selected from the group consisting of derivatives of 1,4,7,10-tetraazacyclododecane-1,4,7,10,tetraacetic acid (DOTA), deferoxamine (DFO), derivatives of diethylenetriaminepentaacetic acid (DTPA), derivatives of S-2-(4- Isothiocyanatobenzyl)-1,4,7-triazacyclononane-1,4,7-triacetic acid (NOTA) and derivatives of 1,4,8,11-tetraazacyclododecan-1,4,8,11-tetraacetic acid (TETA).
- DOTA deferoxamine
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP does not comprise a cytotoxic moiety or a detectable moiety.
- the invention further includes an antibody or antigen-binding fragment thereof with binding specificity for human interleukin-1 receptor accessory protein (IL1RAP), wherein the antibody or antigen-binding fragment is capable of inhibiting the binding of the herein disclosed antibody 48D2 to IL1RAP.
- IL1RAP human interleukin-1 receptor accessory protein
- the term “capable of inhibiting the binding of antibody 48D2 to IL1RAP” means that the presence of another antibody inhibits, in whole or in part, the binding of 48D2 to IL1RAP.
- Such competitive binding inhibition can be determined using assays and methods well known in the art, for example using BIAcore chips with immobilised IL1RAP and incubating with the 48D2 with and without an antibody to be tested.
- a pair-wise mapping approach can be used, in which the antibody 48D2 is immobilised to the surface of the BIAcore chip, IL1RAP antigen is bound to the immobilised antibody, and then a second antibody is tested for simultaneous IL1RAP- binding ability (see ‘BIAcore Assay Handbook’, GE Healthcare Life Sciences, 29-0194- 00 AA 05/2012; the disclosures of which are incorporated herein by reference).
- competitive binding inhibition can be determined using flow cytometry.
- cells expressing the antigen can be pre- incubated with the test antibody for 20 min before cells are washed and incubated with the 48D2 antibody conjugated to a fluorophore, which can be detected by flow cytometry. If the pre-incubation with the test antibody reduces the detection of the 48D2 antibody in flow cytometry, the test antibody inhibits the binding of the reference antibody to the cell surface antigen. If the antibody to be tested exhibits high affinity for IL1RAP, then a reduced pre-incubation period may be used (or even no pre-incubation at all).
- a second aspect of the invention relates to a polynucleotide encoding the antibody or antigen-binding fragment of the first aspect of the invention, or a component polypeptide chain thereof.
- polynucleotide as used herein includes DNA (e.g. genomic DNA or complementary DNA) and mRNA molecules, which may be single- or double-stranded.
- the polynucleotide is an isolated polynucleotide.
- the polynucleotide is a cDNA molecule.
- the polynucleotide may be codon- optimised for expression of the antibody or antigen-binding fragment in a particular host cell, e.g. for expression in human cells (for example, see Angov, 2011, Biotechnol. J. 6(6):650-659, the disclosures of which are incorporated herein by reference).
- the polynucleotide encoding the antibody or antigen-binding fragment of the invention is encoding an antibody light chain or variable region thereof.
- the polynucleotide encoding the antibody or antigen-binding fragment of the invention is encoding an antibody heavy chain or variable region thereof.
- a third aspect of the invention relates to a vector comprising the polynucleotide according to the second aspect of the invention.
- the vector is an expression vector.
- expression vector is defined herein as a DNA molecule, for example linear or circular, that comprises a polynucleotide encoding a polypeptide of the present invention (the antibody or antigen-binding fragment thereof) and is operably linked to additional nucleotides that provide for its expression.
- the terms "plasmid”, “expression vector” and “vector” are used interchangeably as the plasmid is generally the most commonly used form of vector at present. However, the invention is intended to include such other forms of expression vectors that serve equivalent functions that are known in the art.
- expression vector refers to a DNA construct containing a DNA sequence that is operably linked to a suitable control sequence capable of effecting the expression of the DNA in a suitable host.
- control sequences may, e.g., include a promoter to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites and sequences which control termination of transcription and translation.
- the vector may, e.g., be a plasmid, a phage or simply a potential genomic insert. Once transformed into a suitable host, the vector may, e.g., replicate and function independently of the host genome, or may, in some instances, integrate into the genome itself.
- a fourth aspect of the invention relates to a recombinant host cell comprising the polynucleotide according to the second aspect of the invention or a vector according to the third aspect of the invention.
- the recombinant host cell is a bacterial cell.
- the recombinant host cell is a yeast cell.
- the recombinant host cell is a mammalian cell.
- the recombinant host cell is a human cell.
- a fifth aspect of the invention relates to a method for producing the antibody or antigen-binding fragment of the first aspect of the invention, the method comprising culturing the host cell of the fourth aspect of the invention comprising the polynucleotide of the second aspect of the invention or the vector of the third aspect of the invention, under conditions which permit expression of the encoded antibody or antigen-binding fragment thereof.
- composition A sixth aspect of the invention relates to a pharmaceutical composition comprising the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, and/or the host cell of the fourth aspect of the invention, in a pharmaceutical composition, wherein the composition further comprises a pharmaceutically-acceptable diluent, carrier or excipient.
- the composition comprises an effective amount of the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, and/or the host cell of the fourth aspect of the invention.
- compositions may be prepared in a manner known in the art that is sufficiently storage stable and suitable for administration to humans and animals.
- the pharmaceutical compositions may be lyophilised, e.g. through freeze drying, spray drying, spray cooling, or through use of particle formation from supercritical particle formation.
- pharmaceutically acceptable is intended to mean a non-toxic material that does not decrease the effectiveness of the IL1RAP-binding activity of the antibody or antigen binding fragment of the invention.
- buffer is intended to mean an aqueous solution containing an acid-base mixture with the purpose of stabilising pH.
- buffers are Trizma, Bicine, Tricine, MOPS, MOPSO, MOBS, Tris, Hepes, HEPBS, MES, phosphate, carbonate, acetate, citrate, glycolate, lactate, borate, ACES, ADA, tartrate, AMP, AMPD, AMPSO, BES, CABS, cacodylate, CHES, DIPSO, EPPS, ethanolamine, glycine, HEPPSO, imidazole, imidazolelactic acid, PIPES, SSC, SSPE, POPSO, TAPS, TABS, TAPSO and TES.
- diluent is intended to mean an aqueous or non-aqueous solution with the purpose of diluting the antibody or antigen-binding fragment in the pharmaceutical preparation.
- the diluent may be one or more of saline, water, polyethylene glycol, propylene glycol, ethanol or oils (such as safflower oil, corn oil, peanut oil, cottonseed oil or sesame oil).
- adjuvant is intended to mean any compound added to the formulation to increase the biological effect of the antibody or antigen-binding fragment of the invention.
- the adjuvant may be one or more of zinc, copper or silver salts with different anions, for example, but not limited to fluoride, chloride, bromide, iodide, thiocyanate, sulfite, hydroxide, phosphate, carbonate, lactate, glycolate, citrate, borate, tartrate, and acetates of different acyl composition.
- the adjuvant may also be cationic polymers such as cationic cellulose ethers, cationic cellulose esters, deacetylated hyaluronic acid, chitosan, cationic dendrimers, cationic synthetic polymers such as poly(vinyl imidazole), and cationic polypeptides such as polyhistidine, polylysine, polyarginine, and peptides containing these amino acids.
- the excipient may be one or more of carbohydrates, polymers, lipids and minerals. Examples of carbohydrates include lactose, glucose, sucrose, mannitol, and cyclodextrines, which are added to the composition, e.g. for facilitating lyophilisation.
- polymers are starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carrageenans, hyaluronic acid and derivatives thereof, polyacrylic acid, polysulphonate, polyethyleneglycol/polyethylene oxide, polyethyleneoxide/polypropylene oxide copolymers, polyvinylalcohol/polyvinylacetate of different degree of hydrolysis, and polyvinylpyrrolidone, all of different molecular weight, which are added to the composition, e.g., for viscosity control, for achieving bioadhesion, or for protecting the lipid from chemical and proteolytic degradation.
- lipids are fatty acids, phospholipids, mono-, di-, and triglycerides, ceramides, sphingolipids and glycolipids, all of different acyl chain length and saturation, egg lecithin, soy lecithin, hydrogenated egg and soy lecithin, which are added to the composition for reasons similar to those for polymers.
- minerals are talc, magnesium oxide, zinc oxide and titanium oxide, which are added to the composition to obtain benefits such as reduction of liquid accumulation or advantageous pigment properties.
- the antibody or antigen-binding fragment of the invention may be formulated into any type of pharmaceutical composition known in the art to be suitable for the delivery thereof.
- the pharmaceutical compositions of the invention may be in the form of a liposome, in which the antibody or antigen-binding fragment is combined, in addition to other pharmaceutically acceptable carriers, with amphipathic agents such as lipids, which exist in aggregated forms as micelles, insoluble monolayers and liquid crystals.
- Suitable lipids for liposomal formulation include, without limitation, monoglycerides, diglycerides, sulfatides, lysolecithin, phospholipids, saponin, bile acids, and the like.
- Suitable lipids also include the lipids above modified by poly(ethylene glycol) in the polar headgroup for prolonging bloodstream circulation time.
- compositions of the invention may also be in the form of biodegradable microspheres.
- Aliphatic polyesters such as poly(lactic acid) (PLA), poly(glycolic acid) (PGA), copolymers of PLA and PGA (PLGA) or poly(caprolactone) (PCL), and polyanhydrides have been widely used as biodegradable polymers in the production of microspheres.
- PLA poly(lactic acid)
- PGA poly(glycolic acid)
- PCL poly(caprolactone)
- polyanhydrides have been widely used as biodegradable polymers in the production of microspheres.
- Preparations of such microspheres can be found in US 5,851,451 and in EP 0213303, the disclosures of which are incorporated herein by reference.
- compositions of the invention are provided in the form of polymer gels, where polymers such as starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carrageenans, hyaluronic acid and derivatives thereof, polyacrylic acid, polyvinyl imidazole, polysulphonate, polyethyleneglycol/polyethylene oxide, polyethyleneoxide/polypropylene oxide copolymers, polyvinylalcohol/polyvinylacetate of different degree of hydrolysis, and polyvinylpyrrolidone are used for thickening of the solution containing the agent.
- polymers such as starch, cellulose ethers, cellulose carboxymethylcellulose, hydroxypropylmethyl cellulose, hydroxyethyl cellulose, ethylhydroxyethyl cellulose, alginates, carrageenans, hyaluronic acid and derivatives thereof
- the polymers may also comprise gelatin or collagen.
- the antibody or antigen-binding fragment may simply be dissolved in saline, water, polyethylene glycol, propylene glycol, ethanol or oils (such as safflower oil, corn oil, peanut oil, cottonseed oil or sesame oil), tragacanth gum, and/or various buffers.
- the pharmaceutical compositions of the invention may include ions and a defined pH for potentiation of action of the active antibody or antigen-binding fragment.
- the compositions may be subjected to conventional pharmaceutical operations such as sterilisation and/or may contain conventional adjuvants such as preservatives, stabilisers, wetting agents, emulsifiers, buffers, fillers, etc.
- compositions according to the invention may be administered via any suitable route known to those skilled in the art.
- possible routes of administration include parenteral (intravenous, subcutaneous, and intramuscular), topical, ocular, nasal, pulmonar, buccal, oral, parenteral, vaginal and rectal.
- administration from implants is possible.
- the pharmaceutical compositions are administered parenterally, for example, intravenously, intracerebroventricularly, intraarticularly, intra- arterially, intraperitoneally, intrathecally, intraventricularly, intrasternally, intracranially, intramuscularly or subcutaneously, or they may be administered by infusion techniques.
- the pharmaceutical compositions are administered intravenously.
- aqueous solutions which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood.
- the aqueous solutions should be suitably buffered (preferably to a pH of from 3 to 9), if necessary.
- suitable parenteral formulations under sterile conditions is readily accomplished by standard pharmaceutical techniques well known to those skilled in the art.
- Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
- the formulations may be presented in unit-dose or multi- dose containers, for example sealed ampoules and vials, and may be stored in a freeze- dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
- sterile liquid carrier for example water for injections
- Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules and tablets of the kind previously described.
- the pharmaceutical compositions of the invention are particularly suitable for parenteral, e.g. intravenous, administration.
- compositions may be administered intranasally or by inhalation (for example, in the form of an aerosol spray presentation from a pressurised container, pump, spray or nebuliser with the use of a suitable propellant, such as dichlorodifluoromethane, trichlorofluoro-methane, dichlorotetrafluoro-ethane, a hydrofluoroalkane such as 1,1,1,2-tetrafluoroethane (HFA 134A3 or 1,1,1,2,3,3,3- heptafluoropropane (HFA 227EA3), carbon dioxide or other suitable gas).
- a suitable propellant such as dichlorodifluoromethane, trichlorofluoro-methane, dichlorotetrafluoro-ethane, a hydrofluoroalkane such as 1,1,1,2-tetrafluoroethane (HFA 134A3 or 1,1,1,2,3,3,3- heptafluor
- the dosage unit may be determined by providing a valve to deliver a metered amount.
- the pressurised container, pump, spray or nebuliser may contain a solution or suspension of the active antibody or antigen-binding fragment, e.g. using a mixture of ethanol and the propellant as the solvent, which may additionally contain a lubricant, e.g. sorbitan trioleate.
- Capsules and cartridges (made, for example, from gelatin) for use in an inhaler or insufflator may be formulated to contain a powder mix of a compound of the invention and a suitable powder base such as lactose or starch.
- Aerosol or dry powder formulations are preferably arranged so that each metered dose or ‘puff’ contains at least 1 mg of a compound of the invention for delivery to the patient.
- the overall daily dose with an aerosol will vary from patient to patient, and may be administered in a single dose or, more usually, in divided doses throughout the day.
- the antibody or antigen-binding fragment of the invention can be administered in the form of a suppository or pessary, or they may be applied topically in the form of a lotion, solution, cream, ointment or dusting powder.
- the compounds of the invention may also be transdermally administered, for example, by the use of a skin patch. They may also be administered by the ocular route.
- the antibody or antigen-binding fragment of the invention can be formulated as micronised suspensions in isotonic, pH adjusted, sterile saline, or, preferably, as solutions in isotonic, pH adjusted, sterile saline, optionally in combination with a preservative such as a benzylalkonium chloride. Alternatively, they may be formulated in an ointment such as petrolatum.
- the antibody or antigen-binding fragment of the invention can be formulated as a suitable ointment containing the active compound suspended or dissolved in, for example, a mixture with one or more of the following: mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene polyoxypropylene compound, emulsifying wax and water.
- compositions will be administered to a patient in a pharmaceutically effective dose.
- a “therapeutically effective amount”, or “effective amount”, or “therapeutically effective”, as used herein, refers to that amount which provides a therapeutic effect for a given condition and administration regimen.
- a therapeutically effective amount can be determined by the ordinary skilled medical or veterinary worker based on patient characteristics, such as age, weight, sex, condition, complications, other diseases, etc., as is well known in the art.
- the administration of the pharmaceutically effective dose can be carried out both by single administration in the form of an individual dose unit or else several smaller dose units and also by multiple administrations of subdivided doses at specific intervals. Alternatively, the dose may be provided as a continuous infusion over a prolonged period.
- a “pharmaceutically effective amount”, or “effective amount”, or “diagnostically effective”, as used herein refers to that amount which provides a detectable signal for diagnosis, e.g.
- the antibody or antigen-binding fragment can be formulated at various concentrations, depending on the efficacy/toxicity of the antibody or antigen-binding fragment being used.
- the formulation may comprise the active antibody or antigen-binding fragment at a concentration of between 0.1 ⁇ M and 1 mM, more preferably between 1 ⁇ M and 500 ⁇ M, between 500 ⁇ M and 1 mM, between 300 ⁇ M and 700 ⁇ M, between 1 ⁇ M and 100 ⁇ M, between 100 ⁇ M and 200 ⁇ M, between 200 ⁇ M and 300 ⁇ M, between 300 ⁇ M and 400 ⁇ M, between 400 ⁇ M and 500 ⁇ M, between 500 ⁇ M and 600 ⁇ M, between 600 ⁇ M and 700 ⁇ M, between 800 ⁇ M and 900 ⁇ M or between 900 ⁇ M and 1 mM.
- the formulation comprises the active antibody or antigen-binding fragment at a concentration of between 300 ⁇ M and 700 ⁇ M.
- the therapeutic dose of the antibody or antigen-binding fragment (with or without a therapeutic moiety) in a human patient will be in the range of 100 ⁇ g to 1 g per administration (based on a body weight of 70 kg, e.g. between 300 ⁇ g to 700 mg per administration).
- the maximum therapeutic dose may be in the range of 0.1 to 10 mg/kg per administration, e.g. between 0.1 and 5 mg/kg or between 1 and 5 mg/kg or between 0.1 and 2 mg/kg.
- the therapeutic dose may be 5, 20 or 50 mg/kg, or any range formed from these values.
- the therapeutic dose may be from 5 to 50 mg/kg, from 5 to 20 mg/kg, or from 20 to 50 mg/kg. It will be appreciated that such a dose may be administered at different intervals, as determined by the oncologist/physician; for example, a dose may be administered daily, twice- weekly, weekly, bi-weekly or monthly. It will be appreciated by persons skilled in the art that the pharmaceutical compositions of the invention may be administered alone or in combination with other therapeutic agents used in the treatment of inflammatory, fibrotic and/or neoplastic disorders or diseases.
- said composition is adapted for parenteral delivery.
- said composition is adapted for intravenous delivery.
- said composition is adapted for topical delivery.
- said composition is adapted for subcutaneous delivery. In some embodiments, said composition is adapted for intramuscular delivery. It will be further appreciated by persons skilled in the art that the antibody or antigen- binding fragment and pharmaceutical compositions or formulations of the present invention have utility in both the medical and veterinary fields. Thus, the methods of the invention may be used in the treatment of both human and non-human animals (such as horses, dogs and cats). Preferably, however, the patient is human.
- a seventh aspect of the invention relates to the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, for use in medicine.
- An eighth aspect of the invention relates to the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, for use in the prevention and/or treatment and/or alleviation and/or detection and/or diagnosis of a disease or disorder susceptible to treatment with an inhibitor of IL-1 ⁇ , IL- 1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ signaling, and/or wherein the disease or disorder is associated with cells expressing IL1RAP.
- the invention relates to the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, for use in the prevention and/or treatment and/or alleviation and/ or detection and/or diagnosis of a disease or disorder susceptible to treatment with an inhibitor of IL-1 ⁇ , IL- 1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ signaling.
- the invention relates to the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, for use in the prevention and/or treatment and/or alleviation and/or detection and/or diagnosis of a disease or disorder, wherein the disease or disorder is associated with cells expressing IL1RAP.
- said disease or disorder is associated with IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ signaling.
- said disease or disorder is associated with cells expressing IL1RAP.
- treatment we include both therapeutic and prophylactic or preventive treatment of the patient.
- preventive or “prophylactic” are used to encompass the use of an antibody or antigen-binding fragment thereof, or formulation thereof, as described herein which either prevents or reduces the likelihood of an inflammatory disease or disorder, a fibrotic disease or disorder, a neoplastic disorder or disorder, which also includes the prevention or reduction of the spread, dissemination, or metastasis of neoplastic cells in a patient or subject.
- prophylactic also encompasses the use of an antibody or antigen-binding fragment thereof, or formulation thereof, as described herein to prevent recurrence of an inflammatory, fibrotic and/or neoplastic disease or disorder in a patient who has previously been treated for any of these diseases or disorders.
- diagnosis or “detection” we include the detection of cells which are associated with an inflammatory, fibrotic and/or neoplastic disease or disorder, either in vivo (i.e. within the body of a patient) or ex vivo (i.e. within a tissue or cell sample removed from the body of a patient).
- an inflammatory, fibrotic and/or neoplastic disease or disorder associated with cells expressing IL1RAP we include such diseases or disorders wherein the pathological cells which are responsible, directly or indirectly, for the disorder express IL1RAP on the cell surface.
- the cells expressing IL1RAP may be immune cells, cells of the connective tissue such as fibroblasts or neoplastic cells (cancer cells), e.g. tumour cells, per se.
- such cells include pathological stem cells (i.e.
- cancer stem cells or CSCs
- progenitor cells which are responsible, directly or indirectly, for the development of an inflammatory, fibrotic and/or neoplastic disease or disorder in an individual.
- CSCs are disclosed in Visvader & Lindeman, 2008, Nat Rev Cancer 8:755-768, the disclosures of which are incorporated herein by reference.
- the cells expressing IL1RAP may be associated indirectly with an inflammatory, fibrotic and/or neoplastic disease or disorder, for example, they may mediate cellular processes required for the cells to survive.
- the antibody or antigen- binding fragment thereof of the invention may in this event target cells essential for the maintenance of inflammatory and/or fibrotic processes, or, for example, blood supply of the tumour (angiogenesis) or cells inhibiting a beneficial immune response directed against the malignant cells (e.g. suppressive macrophages or T cells).
- an antibody or antigen-binding fragment according to the first aspect of the invention may be used that it capable of inducing ADCC.
- the target cells expressing IL1RAP are cancer cells (such as CML, AML, ALL, melanoma, lung cancer cells, etc).
- the antibody or antigen-binding fragment may be capable of inducing ADCC in order to eliminate such cells.
- a therapeutic benefit may also be achieved using an antibody or antigen-binding fragment that lacks ADCC activity, for example through inhibition of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ signaling leading to reduced angiogenesis in the vicinity of a cancer or tumour.
- Rheumatoid arthritis all types of arthritis, psoriatic arthritis, all types of juvenile arthritis, including systemic onset juvenile idiopathic arthritis (SOJIA), osteoarthritis, familial cold auto-inflammatory syndrome (FCAS), Muckle-Wells disease, neonatal onset multi-system inflammatory disease (NOMID), familial Mediterranean fever (FMF), pyogenic arthritis pyoderma gangrenosum and acne (PAPA) syndrome, adult onset Still’s disease, hyper IgD syndrome, type 2 diabetes mellitus, macrophage activation syndrome, TNF receptor-associated periodic syndrome, Blau disease, ankylosing spondylitis, Sweets disease, lupus arthritis, Alzheimer’s disease, psoriasis, asthma, allergy, atherosclerosis, sarcoidosis, atopic dermatitis, systemic lupus erythemat
- Blockade of IL-1 signaling is also believed to be beneficial in the treatment of myocardial infarction.
- An extensive clinical trial is sought to confirm the efficacy of anti-IL-1 ⁇ antibody blockade (using Canakinumab) following myocardial infarction (the CANTOS trail; see Ridker et al., 2011, Am Heart Journal 162(4):597-605, the disclosures of which are incorporated herein by reference).
- a therapeutic benefit may also be achieved using an antibody or antigen-binding fragment that binds IL1RAP and thereby blocking IL-1 and/or IL-33 and/or IL-36 signaling associated with immune cells.
- Such antibody could be modified to lack ADCC activity.
- said disease or disorder is an inflammatory and/or fibrotic and/or neoplastic disease or disorder.
- binding of the antibody, or antigen-binding fragment thereof, to IL1RAP present on the surface of the cells associated with the inflammatory, fibrotic and/or neoplastic disease or disorder may lead to a modulation (i.e. an increase or decrease) of a biological activity of IL1RAP.
- the antibody or antigen-binding fragment thereof of the invention may elicit a therapeutic and prophylactic effect simply by virtue of binding to IL1RAP on the surface of the cells associated with the disease or disorder, which in turn may trigger the immune system to induce processes, such as cell death (e.g. by ADCC and/or by the presence within the agent of a cytotoxic/radioactive moiety).
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP inhibits the biological activity of IL1RAP.
- biological activity of IL1RAP we include any interaction or signaling event which involves IL1RAP on the cells associated with the inflammatory, fibrotic and/or neoplastic disease or disorder.
- the antibody or antigen-binding fragment thereof is capable of blocking binding of one or more co-receptors to IL1RAP (such as IL1R1, ST2, C-KIT and/or IL1RL2).
- the antibody or antigen-binding fragment thereof with binding specificity for IL1RAP inhibits signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ .
- cytokines such as cytokines of the IL-1 family, such as inhibiting signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇
- Such inhibition of the biological activity of IL1RAP by an antibody or antigen binding fragment thereof of the invention may be in whole or in part.
- the antibody or antigen binding fragment thereof may inhibit the biological activity of IL1RAP by at least 10%, preferably at least 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90%, and most preferably by 100% compared to the biological activity of IL1RAP in cells associated with the inflammatory, fibrotic and/or neoplastic disease or disorder which have not been exposed to the antibody or antigen-binding fragment thereof.
- the antibody or antigen binding fragment thereof is capable of inhibiting the biological activity of IL1RAP by 50% or more compared to the biological activity of IL1RAP in cells associated with the inflammatory, fibrotic and/or neoplastic disease or disorder which have not been exposed to the antibody or antigen-binding fragment.
- inhibition of growth and/or proliferation of the cells associated with the neoplastic disease or disorder may be in whole or in part.
- the antibody or antigen-binding fragment thereof may inhibit the growth and/or proliferation of the cells associated with the neoplastic disease or disorder by at least 10%, preferably at least 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90%, and most preferably by 100% compared to the growth and/or proliferation of cells associated with the neoplastic disease or disorder which have not been exposed to the antibody or antigen binding fragment thereof.
- IL-1, IL-33 and IL-36 in disease IL-1 is implicated in a wide range of diseases and conditions ranging from gout to cancer (for reviews, see Dinarello et al., 2012, Nature Reviews 11:633-652 and Dinarello, 2014, Mol. Med. 20(suppl.
- x Joint, bone and muscle diseases such as rheumatoid arthritis and osteoarthritis
- Hereditary systemic autoinflammatory diseases such as familial Mediterranean fever
- Systemic autoinflammatory diseases such as systemic juvenile idiopathic arthritis and adult-onset Still’s disease
- Common inflammatory diseases such as gout and type 2 diabetes
- x Acute-onset ischemic diseases such as myocardial infarction
- x Cancer A number of therapies for blocking IL-1 activity are approved and in development.
- IL ⁇ 1Ra IL ⁇ 1 receptor antagonist
- IL ⁇ 1 Neutralising IL ⁇ 1 with antibodies or soluble receptors has also proved to be effective, and the soluble decoy receptor rilonacept (Arcalyst; Regeneron) and the anti ⁇ IL ⁇ 1 ⁇ neutralizing monoclonal antibody canakinumab (Ilaris; Novartis) have now been approved.
- Other therapeutic approaches including IL ⁇ 1 ⁇ neutralisation, a therapeutic vaccine targeting IL ⁇ 1 ⁇ and a chimeric IL ⁇ 1Ra, are in early clinical trials.
- orally active small ⁇ molecule inhibitors of IL ⁇ 1 production such as caspase 1 inhibitors, have been developed and are being tested.
- caspase 1 inhibitors caspase 1 inhibitors
- IL-33 has been implicated in e.g. asthma, allergic diseases, inflammatory bowel disease, and dermatitis. Importantly, IL-33 is implicated in fibrosis and inflammation (Kotsiou et al.2018, IL-33/ST2 Axis in Organ Fibrosis, Front Immunol.2018 Oct 24;9:2432). IL-33 can potently stimulate a wide range of cells and its pleiotropic nature is reflected in the role of IL-33 in tissue and metabolic homeostasis, infection, inflammation, cancer and diseases of the central nervous system.
- the antibody or antigen-binding fragment thereof of the present invention may have or is expected to have profound effects on inflammatory and/or fibrotic diseases or disorders, for example due to the ability to inhibit signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ , thereby targeting several IL-dependent pathways at the same time.
- said disease or disorder is an inflammatory and/or fibrotic disease or disorder.
- said disease or disorder is an inflammatory and/or fibrotic disease or disorder, wherein the inflammatory and/or fibrotic disease or disorder is selected from the group consisting of rheumatoid arthritis, all types of arthritis, psoriatic arthritis, all types of juvenile arthritis, including systemic onset juvenile idiopathic arthritis (SOJIA), osteoarthritis, familial cold auto-inflammatory syndrome (FCAS), Muckle-Wells disease, neonatal onset multi-system inflammatory disease (NOMID), familial Mediterranean fever (FMF), pyogenic arthritis pyoderma gangrenosum and acne (PAPA) syndrome, adult onset Still’s disease, hyper IgD syndrome, type 2 diabetes mellitus, macrophage activation syndrome, TNF receptor-associated periodic syndrome, Blau disease, ankylosing spondylitis, Sweets disease, lupus arthritis, Alzheimer’s disease, psorias
- said disease or disorder is systemic sclerosis, also called scleroderma or systemic scleroderma.
- said disease or disorder is peritonitis, such as acute peritonitis.
- said disease or disorder is psoriasis.
- said disease or disorder is psoriatic arthritis.
- said disease or disorder is psoriasis and psoriatic arthritis.
- said disease or disorder is atherosclerosis.
- the use of the herein disclosed invention in the prevention, treatment, alleviation, detection and/or diagnosis of atherosclerosis comprises the reduction of atherosclerosis, for example the reduction of clinical signs, symptoms or pathophysiological correlates of atherosclerosis, for example reduction of atherosclerotic plaque inflammation, such as aortic plaque inflammation, and/or a reduction in plaque size (for example, plaque volume and/or plaque area).
- Plaque inflammation can be assessed based on a cellular count of CD45 + leukocytes using flow cytometric analyses of an aorta (for example, as shown in Example 4).
- a higher count of CD45 + leukocytes in a test aorta indicates atherosclerotic plaque inflammation.
- the leukocyte count may be assessed based on myeloid CD11b + cells (including Ly6G + neutrophils) and/or TCR- ⁇ + cells (including CD4 + and/or CD8 + cells).
- Plaque size may be assessed based on plaque volume and/or plaque area. An increase in plaque size (e.g.
- said disease or disorder is lung fibrosis, also known as pulmonary fibrosis. Fibrosis is the hallmark of a multitude of diseases. In some cases, fibrosis may be an integral part of the disease, meaning that fibrosis may be the consequence of aberrant or pathologic cellular behaviour leading to a pathological deposition of extracellular matrix proteins.
- fibrosis may be a secondary event occurring in diseased tissue, in parallel to the primary disease or in the course of the healing process.
- fibrosis may be scar formation.
- Any type of fibrosis may be targeted, for example treated or prevented, by the antibodies as disclosed herein.
- Fibrosis may be categorized as uncontrolled or dysregulated scar tissue formation, which can be caused by excessive accumulation of extracellular matrix components, such as collagen. Accordingly, the use of the herein disclosed invention in the prevention, treatment, alleviation, detection and/or diagnosis of fibrosis may be upstream of the prevention, treatment, alleviation, detection and/or diagnosis of a disease for which fibrosis is a hallmark.
- the use of the herein disclosed invention in the prevention, treatment, alleviation, detection and/or diagnosis of fibrosis may be downstream of a disease for which fibrosis is a secondary event in said disease.
- said disease or disorder is myocarditis.
- said disease or disorder is autoimmune myocarditis.
- the use of the herein disclosed invention in the prevention, treatment, alleviation, detection and/or diagnosis of myocarditis, such as autoimmune myocarditis comprises the reduction of myocarditis, such as autoimmune myocarditis, for example the reduction of clinical signs, symptoms or pathophysiological correlates of myocarditis, such as autoimmune myocarditis, for example reduction of deterioration in cardiac function, reduction in inflammation and/or reduction fibrosis.
- said disease or disorder is graft-versus-host disease, including chronic graft-versus-host disease and sclerodermatous chronic graft-versus-host disease.
- said disease or disorder is dermal fibrosis and/or pulmonary fibrosis in graft-versus-host disease.
- the graft- versus-host disease is caused by a syngeneic transplantation.
- the graft-versus-host disease is caused by an allogeneic transplantation.
- said disease or disorder is an acute inflammatory disease or disorder.
- said disease or disorder is a chronic inflammatory disease or disorder.
- a disease or disorder may not be explicitly labelled as an inflammatory or fibrotic disease, it may still have an inflammatory and/or fibrotic components, for example inflammatory and/or fibrotic processes which form part or contribute to the disease or disorder.
- said disease or disorder has an inflammatory and/or fibrotic component.
- said disease or disorder is an autoimmune disease or disorder.
- the antibody or antigen-binding fragment of the first aspect of the invention inhibits inflammatory processes.
- the antibody or antigen-binding fragment of the first aspect of the invention inhibits fibrotic processes.
- the antibody or antigen-binding fragment of the first aspect of the invention inhibits proliferative processes.
- IL1RAP as a biomarker for neoplastic diseases or disorders
- a neoplasm indicative of neoplastic diseases or disorders (i.e. cancer) is a type of abnormal and excessive growth (also called neoplasia) of tissue or cells, for example tumours.
- Tumour biomarkers or biomarkers of neoplastic diseases or disorders are endogenous proteins or metabolites whose amounts or modifications are indicative of tumour state, progression characteristics, and response to therapies. They are present in tumour tissues or body fluids and encompass a wide variety of molecules, including transcription factors, cell surface receptors, and secreted proteins. Effective tumour markers are in great demand since they have the potential to reduce cancer mortality rates by facilitating diagnosis of cancers at early stages and by helping to individualize treatments.
- Interleukin-1 receptor accessory protein has previously been identified as cell- surface biomarker associated with haematological neoplastic disorders such as chronic myeloid leukemia (CML), acute myeloid leukemia (AML) and myelodysplatic syndromes (MDS) (for example, see WO 2011/021014 to Cantargia AB, Jär ⁇ s et al., 2010, Proc Natl Acad Sci USA 107(37):16280-5, Askmyr et al., 2013, Blood. 121(18):3709-13 and Barreyro et al., 2012, Blood 120(6):1290-8, the disclosures of which are incorporated herein by reference).
- CML chronic myeloid leukemia
- AML acute myeloid leukemia
- MDS myelodysplatic syndromes
- said disease or disorder is a neoplastic disease or disorder.
- the person skilled in the art will appreciate that the antibody of the present invention may have profound effects on neoplastic diseases or disorders, for example due to the ability to inhibit signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ , thereby targeting several IL-dependent pathways at the same time.
- said disease or disorder is a neoplastic disease or disorder, wherein the neoplastic disease or disorder is a hematologic disease or disorder or a solid tumour.
- said neoplastic disease or disorder is a hematologic disease, wherein the neoplastic hematologic disease or disorder is selected from the group consisting of chronic myeloid leukemia (CML), myeloproliferative disorders (MPD), myelodysplastic syndrome (MDS), acute lymphoblastic leukemia (ALL) and acute myeloid leukemia (AML).
- CML chronic myeloid leukemia
- MPD myeloproliferative disorders
- MDS myelodysplastic syndrome
- ALL acute lymphoblastic leukemia
- AML acute myeloid leukemia
- said neoplastic disease or disorder is a solid tumor, wherein the solid tumour is selected from the group consisting of prostate cancer, breast cancer, lung cancer, colon cancer, colorectal cancer, melanomas, bladder cancer, brain/CNS cancer, cancer of urinary organs, biliary tract cancer (also known as bile duct cancer), cervical cancer, oesophageal cancer, gastric cancer, head/neck cancer, kidney cancer, liver cancer, lymphomas, ovarian cancer, pancreatic cancer, sarcomas, skin cancer and uterus cancer.
- the solid tumour is selected from the group consisting of prostate cancer, breast cancer, lung cancer, colon cancer, colorectal cancer, melanomas, bladder cancer, brain/CNS cancer, cancer of urinary organs, biliary tract cancer (also known as bile duct cancer), cervical cancer, oesophageal cancer, gastric cancer, head/neck cancer, kidney cancer, liver cancer, lymphomas, ovarian cancer, pancreatic cancer, sarcom
- the antibody of the present invention is expected to have profound effects on neoplastic diseases or disorders, for example due to the ability to inhibit signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ , thereby targeting several IL-dependent pathways at the same time.
- the person of skill in the art would, for example in the light of the evidence stated above, understand that the antibody of the present invention could be used for the prevention, treatment, alleviation, detection and/or diagnosis of any disease or disorder implicated by activity of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ .
- a ninth aspect of the invention relates to the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, for use in inducing cell death and/or inhibiting the growth and/or proliferation of pathological cells associated with a neoplastic disorder in a subject, or stem cells or progenitor cells thereof, wherein the cells express IL1RAP.
- a tenth aspect of the invention relates to the use of the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, in the preparation of a medicament for the prevention, treatment, alleviation, detection and/or diagnosis of a disease or disorder susceptible to treatment with an inhibitor of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL-36 ⁇ signaling, and/or wherein the disease or disorder is associated with cells expressing IL1RAP.
- An eleventh aspect of the invention relates to the use of the antibody or antigen-binding fragment of the first aspect of the invention, the polynucleotide of the second aspect of the invention, the vector of the third aspect of the invention, the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention, in the preparation of a medicament for the detection and/or diagnosis of a disease or disorder associated with cells expressing IL1RAP.
- a twelfth aspect of the invention relates to a method for the prevention and/or treatment and/or alleviation and/or detection and/or diagnosis of a disease or disorder susceptible to treatment with an inhibitor of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and/or IL- 36 ⁇ signaling and/or wherein the disease or disorder is associated with cells expressing IL1RAP in a subject, comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- a thirteenth aspect of the invention relates to an in vitro method for the detection of cells expressing IL1RAP in a subject, the method comprising: (a) providing a sample of cells from a subject to be tested, such as biopsy tissue or blood sample; (b) optionally, extracting and/or purifying the cells present in the sample; (c) contacting the antibody or antigen binding fragment of the first aspect of the invention with cells present in the sample; (d) determining whether the antibody or antigen-binding fragment thereof binds to the cells wherein the binding of the antibody or antigen-binding fragment thereof to the cells is indicative of the presence of a disease or disorder associated with cells expressing IL1RAP in the tissue of a subject.
- a fourteenth aspect of the invention relates to an in vitro method for identifying a patient with a disease or disorder associated with cells expressing IL1RAP who would benefit from treatment with the antibody or antigen-binding fragment of the first aspect of the invention, the method comprising: (a) providing a sample of cells, such as biopsy tissue or blood sample from a patient to be tested; (b) optionally, extracting and/or purifying the cells present in the sample; (c) contacting the antibody or antigen-binding fragment of the first aspect of the invention with cells present in the sample; (d) determining whether the antibody or antigen-binding fragment thereof binds to the cells wherein the binding of the antibody or antigen-binding fragment thereof to cells expressing IL1RAP is indicative of a patient who would benefit from treatment with the antibody or antigen-binding fragment of the first aspect of the invention.
- a fifteenth aspect of the invention relates to a method for treating a patient with a disease or disorder associated with cells expression IL1RAP, the method comprising: a) selecting a patient identified as having a disease or disorder associated with cells expressing IL1RAP using a method according to the fourteenth aspect of the invention; and b) administering to said patient a therapeutic agent effective in the treatment of said disease or disorder.
- a sixteenth aspect of the invention relates to a method for the detection of cells expressing IL1RAP, the method comprising: (a) contacting an antibody or antigen-binding fragment thereof according to the first aspect with cells to be analysed for their expression of IL1RAP; (b) determining whether the antibody or antigen-binding fragment thereof binds to the cells wherein the binding of the antibody or antigen-binding fragment thereof to the cells is indicative of the presence of a disease or disorder associated with cells expressing IL1RAP in the tissue of a subject.
- the method of the sixteenth aspect is an in vitro method. In some embodiments, the method of the sixteenth aspect is an in vivo method.
- a seventeenth aspect of the invention relates to a method for reducing inflammation in a subject with peritonitis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- said method for reducing inflammation in a subject with peritonitis comprises reducing infiltration of immune cells into the peritoneum, for example neutrophils and monocytes.
- said method for reducing inflammation in a subject with peritonitis comprises reducing the levels of cytokines, for example reducing the levels of Eotaxin, G-CSF, IL-5, MCP-1, MIP-1 ⁇ , IL-6 and/or KC (also known as CXCL1).
- An eighteenth aspect of the invention relates to a method for reducing disease severity in a subject with psoriasis or psoriatic arthritis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- said method for reducing disease severity in a subject with psoriasis or psoriatic arthritis comprises reducing skin inflammation and/or erythema of the skin.
- said method for reducing disease severity in a subject with psoriasis or psoriatic arthritis comprises reducing the levels of cytokines, for example reducing the level of IL-17.
- a nineteenth aspect of the invention relates to a method for reducing atherosclerotic plaque inflammation in a subject with atherosclerosis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- said method for reducing atherosclerotic plaque inflammation in a patient with atherosclerosis comprises reducing the numbers of CD45+ leukocytes, for example myeloid CD11b+ cells, for example Ly6G+ neutrophils, and/or reducing the numbers of TCR- ⁇ + cells, for example CD4+ and/or CD8+ cells.
- CD45+ leukocytes for example myeloid CD11b+ cells, for example Ly6G+ neutrophils
- TCR- ⁇ + cells for example CD4+ and/or CD8+ cells.
- a twentieth aspect of the invention relates to a method for reducing atherosclerotic plaque volume and/or atherosclerotic plaque size in a subject with atherosclerosis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- a twenty-first aspect of the invention relates to a method for reducing inflammation and/or fibrosis in a subject with myocarditis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- a twenty-second aspect of the invention relates to a method for counteracting deterioration in cardiac function in a subject with myocarditis or autoimmune myocarditis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- a twenty-third aspect of the invention relates to a method for reducing dermal fibrosis in a subject with systemic sclerosis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or the composition of the sixth aspect of the invention.
- said method for reducing dermal fibrosis in a subject with systemic sclerosis comprises reducing dermal thickness, reducing the number of myofibroblasts and/or reducing the amount of collagen in the skin.
- a twenty-fourth aspect of the invention relates to a method for reducing pulmonary fibrosis in a subject with systemic sclerosis, the method comprising the step of administering to the subject an effective amount of -the antibody or antigen-binding fragment of the first aspect of the invention, -the polynucleotide of the second aspect of the invention, -the vector of the third aspect of the invention, -the host cell of the fourth aspect of the invention, and/or -the composition of the sixth aspect of the invention.
- said method for reducing pulmonlary fibrosis in a subject with systemic sclerosis comprises reducing the Ashcroft score and/or the amount of collagen in the lungs.
- the embodiments and explanations relating to the eighth aspect shall also apply to the ninth, tenth, eleventh, twelfth, thirteenth, fourteenth, fifteenth and/or sixteenth aspect of the invention. They may also apply to the seventeenth, eighteenth, nineteenth, twentieth, twenty-first, twenty-second, twenty-third or twenty-fourth aspect of the invention.
- Example 1 Inhibition of cytokine signaling by the murine surrogate anti-IL1RAP antibody mCAN10, specific inhibitor of mouse IL1RAP Aim
- This example illustrates the characterization of the murine surrogate anti IL1RAP antibody mCAN10, specific inhibitor of mouse IL1RAP, with respect to blocking signaling by IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ .
- Material and methods Chickens were immunized with mouse IL1RAP antigen and multiple anti-mouse IL1RAP binders identified. A selection of these were cloned into a mouse IgG2a backbone.
- mCAN10 capable of binding domain 2 of mouse IL1RAP, was evaluated for its capacity to inhibit signaling by IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ .
- HEK-BlueTM cells stably transfected with the murine IL-1R were used.
- HEK-BlueTM cells were transiently transfected with the murine IL-33 and IL-36 receptors the day before the assay.
- HEK-BlueTM cells were seeded into 96-well plates and allowed to settle for a minimum of 2 hrs before continuing.
- mCAN10 mCAN10 (0, 0.001, 0.003, 0.01, 0.03, 0.1, 0.3, 1, 3, 10, 30 and 100 ⁇ g/ml) and incubated for 1 hr at 37°C, 5% CO 2 , before addition of murine cytokines.
- the cytokines were added in the following concentrations: 3 pg/ml IL-1 ⁇ , 30 pg/ml IL-1 ⁇ , 5 ng/ml IL-33, 4 ng/ml IL-36 ⁇ , 5 ng/ml IL-36 ⁇ and 10 ng/ml IL- 36 ⁇ .
- mouse IL-1 ⁇ and IL-1 ⁇ may cross-react with human IL-1R, endogenously expressed by HEK-BlueTM cells
- an anti-human IL1RAP antibody was used to block signaling via IL-1R, prior to stimulation of these cells with mouse IL-1 ⁇ and IL-1 ⁇ .
- Cells were cultured for 16-18 hrs at 37°C, 5% CO 2 and then analyzed for activation of NF- ⁇ B and subsequent production of SEAP using QUANTI-BlueTM Solution measured at 620 nm using the SpectraMax i3x spectrophotometer.
- Results mCAN10 was added to HEK-BlueTM cells in increasing concentrations and mouse IL- 1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ or IL-36 ⁇ added at a constant concentration. Graphs of optical density values at 620 nm were used to calculate the IC50 values shown in Table 2. mCAN10 induced inhibition of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ signaling.
- mCAN10 is a murine surrogate anti-mouse IL1RAP inhibitor capable of blocking signaling by IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ . Therefore, mCAN10 provides a useful tool for evaluating therapeutic efficacy of IL1RAP blockade in various murine disease models.
- mCAN10 is a suitable surrogate to anti-human IL1RAP antibodies with similar functional properties.
- mCAN10 in an effector function silent mouse IgG2a format was used.
- Example 2 The murine surrogate anti-IL1RAP antibody mCAN10, specific inhibitor of mouse IL1RAP, reduces inflammation in a model for acute peritonitis Aim
- the aim of these experiments is to evaluate how blockade of IL-1 ⁇ / ⁇ , IL-33 and IL- 36 ⁇ / ⁇ / ⁇ signaling with the murine surrogate anti-IL1RAP antibody mCAN10 impacts the inflammatory response in a mouse model for acute peritonitis.
- An additional aim is to compare the effects of this antibody to recombinant IL-1R antagonist (IL1RA) protein, anakinra, which only blocks IL-1 ⁇ / ⁇ signaling.
- IL1RA recombinant IL-1R antagonist
- mice Female C57Bl/6 mice (10-18 wks of age), which were either wildtype (WT) or IL1RAP knock-out (KO), were immunized intraperitoneal (i.p.) with 2.5 mg monosodium urate (MSU) crystals. WT mice which were not immunized with MSU crystals were included as controls (No MSU). All mice were terminated 6 hrs after immunization and peritoneal lavage collected for quantification of infiltrating cells (B cells, T cells, monocytes, neutrophils and eosinophils) by flow cytometry (Figure 1A).
- mice Female C57Bl/6 WT mice (8-9 wks of age) were treated with 20 mg/kg mCAN10 or IL1RA at a molar equivalent dose (2.3 mg/kg). Mice which were treated with isotype control antibody or PBS were included as controls. One hour (hr) following treatment, mice were immunized i.p. with 2.5 mg MSU crystals. Mice which did not receive any treatment and were not immunized with MSU crystals were also included as controls (No MSU).
- mice were terminated 6 hrs after immunization and peritoneal lavage collected for quantification of infiltrating cells by flow cytometry (Figure 1B), or for quantification of various cytokines and chemokines (eotaxin, G-CSF, IL-5, MCP-1, MIP-1 ⁇ , IL-6 and KC (also known as CXCL1)) by a Luminex assay (Figure 1C).
- cytokines and chemokines eotaxin, G-CSF, IL-5, MCP-1, MIP-1 ⁇ , IL-6 and KC (also known as CXCL1)
- mCAN10 and IL1RA significantly reduced the number of infiltrating cells, such as neutrophils and monocytes, in the peritoneal cavity in WT mice immunized with MSU crystals, compared to isotype and PBS control, respectively.
- mCAN10 had a more potent anti-inflammatory effect on monocytes and neutrophils than IL1RA ( Figure 1B).
- mCAN10 and IL1RA also significantly decreased G-CSF and IL-6 compared to isotype and PBS control, respectively.
- mCAN10 also reduced eotaxin, IL-5, MCP-1 and MIP-1 ⁇ compared to isotype control, and showed a significantly stronger reduction of IL-6 compared to IL1RA ( Figure 1C).
- Example 3 The murine surrogate anti-IL1RAP antibody mCAN10, specific inhibitor of mouse IL1RAP, reduces disease severity in models for psoriasis and psoriatic arthritis
- the aim of these experiments is to evaluate how blockade of IL-1 ⁇ / ⁇ , IL-33 and IL- 36 ⁇ / ⁇ / ⁇ signaling with the murine surrogate anti-IL1RAP antibody mCAN10 impacts the disease severity in Imiquimod induced psoriasis and mannan induced psoriatic arthritis.
- An additional aim is to compare the effects of this antibody to an anti-IL-1 ⁇ antibody, which only blocks IL-1 ⁇ signaling.
- mice Female BALB/c mice (8-10 wks of age), which received a daily topical administration of Zyclara cream (3.75% Imiquimod; approximately 71.4 mg/day), starting from day 0 until termination on day 7. The cream was applied on the shaved backs of the mice. During this period of disease induction, mice received treatments i.p. on day 0, 3 and 5. The mice were treated with mCAN10 (10 mg/kg), anti-IL-1 ⁇ antibody (0.5 mg/kg), or the same dose of isotype controls for these antibodies. Mice which were treated with PBS only (Vehicle) or dexamethasone (10 mg/kg) were included as negative and positive controls, respectively.
- Example 4 The murine surrogate anti-IL1RAP antibody mCAN10, specific inhibitor of mouse IL1RAP, reduces atherosclerosis and aortic plaque inflammation in Apoe KO mice Aim The aim of these experiments is to evaluate how blockade of IL-1 ⁇ / ⁇ , IL-33 and IL- 36 ⁇ / ⁇ / ⁇ signaling with the murine surrogate anti-IL1RAP antibody mCAN10 impacts the atherosclerosis in apolipoprotein E (Apoe) KO mice.
- Material and methods Female Apoe KO mice (10-12 wks of age) were fed a high-cholesterol diet (HCD; 21% fat, 0.21% cholesterol) to develop atherosclerotic lesions.
- HCD high-cholesterol diet
- mice were anesthetized and sacrificed, whereafter aortas were collected to study changes in immune cell composition by flow cytometry, including myeloid cells (total CD11b + cells, and the Ly6G + neutrophil subpopulation thereof) (Figure 3A-C) and T lymphocytes (total TCR- ⁇ + cells, and CD4 + and CD8 + subpopulations thereof) (Figure 3D-F).
- Hearts were harvested, sectioned at the aortic root and sections stained for lipid accumulation by Oil-Red O and plaque size was compared between groups ( Figure 4A-B). Results Flow cytometry analyses of the atherosclerotic aorta show that mCAN10 decreases the plaque inflammation.
- Example 5 The murine surrogate anti-IL1RAP antibody mCAN10, specific inhibitor of mouse IL1RAP, reduces inflammation and fibrosis in experimental autoimmune myocarditis Aim
- the aim of these experiments is to evaluate how blockade of IL-1 ⁇ / ⁇ , IL-33 and IL- 36 ⁇ / ⁇ / ⁇ signaling with the murine surrogate anti-IL1RAP antibody mCAN10 impacts the development of inflammation and fibrosis in experimental autoimmune myocarditis (EAM).
- EAM was induced in male BALB/c mice (7-8 wks of age) by immunization of mice with 100 ⁇ g mouse ⁇ -myosin heavy chain ( ⁇ MHC) peptide, emulsified in complete Freund’s adjuvant, s.c. on day 0 and 7.
- Mice were treated with mCAN10 (20 mg/kg at first dose; 10 mg/kg at subsequent doses), or the same doses of isotype control antibody i.p., biweekly for 4 wks.
- Mice treated with PBS were included as controls. The treatments were initiated one wk after the final immunization with ⁇ MHC, on day 14. At the end of the experiment, on day 42, mice were sacrificed and hearts were collected.
- the hearts were fixated with 10% buffered formalin, embedded in paraffin, and sectioned longitudinally.
- One middle section per heart was stained with hematoxylin and eosin (H&E) to assess the degree of inflammation in the left ventricle (LV), by grading the area infiltrated by hematopoietic cells using a scoring system ranging from 0-5 ( Figure 5A-B).
- H&E hematoxylin and eosin
- LV left ventricle
- Masson’s trichrome to detect collagen deposits, as a measure of fibrotic tissue. Fibrotic blue area and whole area was measured using computerized planimetry (ImageJ). The fibrotic area is presented as percentage of the whole area ( Figure 5C-D).
- Example 6 The murine surrogate anti-IL1RAP antibody mCAN10, specific inhibitor of mouse IL1RAP, counteracts deterioration in cardiac function in experimental autoimmune myocarditis Aim
- the aim of these experiments is to evaluate how blockade of IL-1 ⁇ / ⁇ , IL-33 and IL- 36 ⁇ / ⁇ / ⁇ signalling with the murine surrogate anti-IL1RAP antibody mCAN10 impacts the cardiac function in experimental autoimmune myocarditis (EAM).
- An additional aim is to compare the effects of this antibody to an anti-IL-1 ⁇ antibody, which only blocks IL-1 ⁇ signalling, recombinant IL-1R antagonist (IL1RA) protein, anakinra, which only blocks IL-1 ⁇ / ⁇ signaling, and prednisone, an anti-inflammatory glucocorticoid.
- Material and methods EAM was induced in male BALB/c mice (7-8 wks of age) by immunization of mice with 100 ⁇ g mouse ⁇ -myosin heavy chain ( ⁇ MHC) peptide, emulsified in complete Freund’s adjuvant, s.c. on day 0 and 7. The treatments were initiated on the same day as the final immunization with ⁇ MHC, on day 7.
- mice were treated with mCAN10 (20 mg/kg at first dose; 10 mg/kg at subsequent doses), anti-IL-1 ⁇ antibody (0.5 mg/kg), or the same dose of isotype controls for these antibodies i.p., biweekly for 5 wks.
- mice were treated with IL1RA at 25 mg/kg s.c., prednisone at 5 mg/kg by oral gavage, or relevant vehicle controls, daily for 5 wks.
- Mice treated with PBS were included as controls.
- transthoracic echocardiography was performed on mice for measurement of left ventricular ejection fraction (LVEF) at the start of the study, and on day 28 and 42 ( Figure 6A-C).
- Example 7 The murine surrogate anti-IL1RAP antibody mCAN10, specific inhibitor of mouse IL1RAP, ameliorates dermal and pulmonary fibrosis in a model of sclerodermatous chronic graft-versus-host disease Aim
- the aim of these experiments is to evaluate how blockade of IL-1 ⁇ / ⁇ , IL-33 and IL- 36 ⁇ / ⁇ / ⁇ signaling with the murine surrogate anti-IL1RAP antibody mCAN10 impacts the fibrosis in a mouse model of sclerodermatous chronic graft-versus-host disease (scl cGvHD).
- All BALB/c (H-2 d ) recipients received bone marrow from either female BALB/c mice (H-2 d ) in a syngeneic, or male B10.D2 mice (H-2 d ) in an allogeneic transplantation manner. Due to MHC mismatch, allogeneically transplanted mice develop scl cGvHD, with fibrosis of skin and multiple inner organs.
- mice For transplantation, 5x10 6 splenocytes and 2x10 6 bone marrow cells from donor mice were resuspended in PBS and injected via tail veins. Treatment was initiated 21 days after bone marrow transplantation. Mice receiving allogeneic transplants were treated with mCAN10 (20 mg/kg at first dose; 10 mg/kg at subsequent doses), or the same doses of isotype control antibody (Iso) i.p. biweekly for 4 wks. Alternatively, these mice were treated with the small molecule tyrosine kinase inhibitor nintedanib at 50 mg/kg p.o. daily for 4 wks.
- mCAN10 20 mg/kg at first dose; 10 mg/kg at subsequent doses
- Iso isotype control antibody
- mice were treated with the small molecule tyrosine kinase inhibitor nintedanib at 50 mg/kg p.o. daily for 4 wks.
- Nintedanib is approved for treatment of systemic sclerosis patients with interstitial lung disease and is used here as a positive control.
- Mice receiving syngeneic transplants were treated with isotype control antibody only.
- mice were sacrificed and skin samples and lungs collected.
- Histological evaluation of dermal and pulmonary fibrosis Skin samples of defined areas of 1 cm 2 on the upper back were fixed in 4% formalin for 6 hrs and embedded in paraffin. Sections were cut at 5 ⁇ m and stained with hematoxylin and eosin (H&E).
- the dermal thickness was quantified on H&E-stained sections using images captured with a light microscope (Nikon Eclipse 80i) at 100-fold magnification by manually measuring the distance between the epidermal-dermal junction and the dermal-subcutaneous fat junction at four sites per mouse.
- the right lobes of the lung samples were similarly fixed, paraffin-embedded and sectioned and were subsequently stained with Trichrome and Sirius Red.
- Histologic readouts included evaluation of stained (fibrotic) area as percent of total lung area in Sirius Red-stained sections (two sections per mouse) and quantification of pulmonary changes by Ashcroft score, a numeric scale for determining the degree of fibrosis in lung specimens (four sections per mouse).
- Hydroxyproline quantification The amount of collagen protein in skin and lung samples was determined by quantification of hydroxyproline. After digestion in 6 M hydrogen chloride for 3 hrs at 120°C, the pH of the samples was adjusted to 6 with 6 M sodium hydroxide. Subsequently, 0.06 M chloramine T was added, and samples incubated for 20 min at room temperature. Next, 3.15 M perchloric acid and 20% p- dimethylaminobenzaldehyde were added and samples were incubated for 20 min at 60°C. The absorbance was determined at 557 nm with a Spectra MAX 190 microplate spectrophotometer. Absolute values were determined using standard curves generated with type I collagen.
- Myofibroblasts positive for ⁇ -SMA smooth muscle actin
- ⁇ -SMA smooth muscle actin
- DAB 3,3-diaminobenzidine tetra hydrochloride
- Monoclonal mouse IgG antibodies were used for controls. Images of sections stained for ⁇ SMA were captured on a light microscope (Nikon Eclipse 80i). Images were manually evaluated at four different areas at 200-fold magnification.
- Myofibroblasts were defined as single, spindle-shaped, ⁇ SMA-positive cells in the dermis.
- Example 8 The murine surrogate anti-IL1RAP antibody mCAN10, specific inhibitor of mouse IL1RAP, alters gene expression profiles related to inflammatory processes Aim
- the aim of this study is to evaluate molecular pathways affected by IL1RAP blockade using the murine surrogate anti-IL1RAP antibody mCAN10 in a mouse model of sclerodermatous chronic graft-versus-host disease (scl cGvHD).
- the aim is also to identify disease-related differentially expressed genes (DEG) affected by IL1RAP- inhibition, in skin from scl cGvHD mice, and compare these to disease related genes in skin biopsies from systemic sclerosis (SSc) patients.
- DEG disease-related differentially expressed genes
- mice were obtained from mice that had undergone syngeneic or allogeneic transplantation with or without treatment with mCAN10 as reported in Example 7.
- RNASeq preprocessing and analysis Raw paired-end reads were aligned to GRCm39 reference genome and mapped reads were counted using Rsubread (v 2.6.4) in R (v 4.1.1).
- Principal component analysis was performed to determine the potential outliers among samples in each batch. Following PCA, three samples (one per condition) were excluded. For each group, four samples resulting in dense group-specific clustering were selected. Median of ratios normalization and differential expression analysis were performed using DESeq2 package (v 1.32.0).
- the significant DEG list is considered as adjusted p-value ⁇ 0.05 and
- the transcriptomic profile of SSc patients was retrieved from a North American SSc patient cohort (NCBI/GEO/GSE130955) consisting of 143 SSc patients and 22 healthy individuals.
- NCBI/GEO/GSE130955 consisting of 143 SSc patients and 22 healthy individuals.
- human orthologs were mapped to murine gene symbols using r package “biomaRt” (v 2.48.3).
- Treated DEG Treated vs. Allo
- SSc DEG SSc vs. Healthy
- information retrieved from a previously published dataset NCBI/GEO/GSE130955 identified 449 overlapping genes between the mouse model (Allo vs. Syn) and human dataset (SSc vs. Healthy).
- mCAN10 impacts processes and pathways related to inflammation in scl GvHD mice, which supports the observed effects of mCAN10 on disease manifestations in this model.
- a substantial number of genes influenced by mCAN10 in scl GvHD mice were differentially expressed in SSc patients compared to healthy controls, suggesting that IL1RAP inhibition may influence human disease as well.
- Example 9 Immunization with IL1RAP to generate anti-IL1RAP antibodies Aim This example illustrates how anti-IL1RAP antibodies were isolated from rabbits immunized with IL1RAP.
- the specific antibody titer was measured by ELISA, coating the plates with human and mouse IL1RAP separately for immune response comparison. Two to three weeks after the fourth immunization, the animals were boosted once and spleens were collected four to five days after the boost. Spleens of test animals were homogenized, cells frozen and stored in liquid nitrogen. Monoclonal antibody sequences were isolated from immunized rabbits using the approach described in Kivi et al. (Kivi G, HybriFree: a robust and rapid method for the development of monoclonal antibodies from different host species. BMC Biotechnology 16:2 (2016)).
- Streptavidin-coated 96-well plates were coated with biotinylated human or murine IL1RAP, or a mixture of both, at 5 ⁇ g/ml. Ten thousand spleen cells were used for each panning. In total 48 panning reactions were performed. After incubation for 45 minutes, wells were washed with PBS to remove unbound cells. RNA was isolated from the bound cells and VH and VL cDNA was synthesized and used for construction of a combinatorial VH-VL library in a human IgG expression plasmid format. Plasmid DNA was purified and transfected into CHO cells for production of chimeric rabbit/human IgG1 pools.
- Chimeric antibody 48D2 was selected for further characterization and optimization (see following Examples).
- the light chain variable region of this antibody comprises a light chain variable region comprising or consisting of the amino acid sequence of SEQ ID NO: 19.
- the heavy chain variable region of this antibody comprises a heavy chain variable region comprising or consisting of the amino acid sequence of SEQ ID NO: 20.
- the variable regions were combined with light chain constant regions comprising or consisting of the amino acid sequence of SEQ ID NO: 35, and with IgG1 heavy chain constant regions, either comprising or consisting of the amino acid sequence of SEQ ID NO: 36 or SEQ ID NO: 2.
- Example 10 Identification and characterization of an antibody binding to IL1RAP and blocking IL-1, IL-33 and IL-36 signaling Aim
- This example illustrates the characterization of the selected antibody, 48D2 chimeric (ch) rabbit/human anti-human IL1RAP, generated as described in Example 9. The goal was to identify an antibody that had high affinity for both cynomolgus monkey and human IL1RAP and completely blocked all IL1RAP regulated signaling pathways.
- Material and methods Binding of the antibody to IL1RAP-expressing cells The malignant melanoma (or malign melanoma) cell line SKMEL-5, which expresses IL1RAP on the cell surface, was used for the analysis.
- SKMEL-5 cells were cultured according to standard procedures.5x10 4 SKMEL-5 cells were blocked with human Fc block and then stained with 8-step serial dilutions (100 ⁇ g/ml - 0.03 ⁇ g/ml) of chimeric 48D2 or isotype control antibody. Following secondary staining using Alexa488- conjugated anti-human IgG antibody, 10000 cells/sample were analyzed on a CytoFlex (Beckman Coulter). HTB183 cells expressing low levels of surface IL1RAP were used as negative controls. Inhibition of cytokine signaling For analysis of IL-1 and IL-33 inhibition, HEK-BlueTM (IL-33/IL-1) cells were used as provided.
- HEK-BlueTM IL-33/IL-1 cells were transiently transfected with the IL-36 receptor the day before the assay or HEK-BlueTM clones with stable expression of the IL-36 receptor (generated in house) were used. Briefly, HEK-BlueTM cells were seeded into 384-well plates and allowed to settle for a minimum of 2 hours before continuing. Cells were then exposed to increasing concentrations of chimeric 48D2 (as depicted in the figures) and incubated for 1 hour at 37°C, 5% CO 2 , before addition of cytokine.
- the cytokines were added in the following concentrations: 2 ng/ml IL-1 ⁇ , 0.1 ng/ml IL-1 ⁇ , 0.2 ng/ml IL-33, 1 ng/ml IL-36 ⁇ , 3 ng/ml IL-36 ⁇ and 0.2 ng/ml IL- 36 ⁇ .
- Cells were cultured for 16-18 hours at 37°C, 5% CO 2 and then analyzed for activation of NF- ⁇ B and subsequent production of SEAP using QUANTI-BlueTM Solution measured at 620 nm using the SpectraMax i3x spectrophotometer. Expression and purification of chimeric 48D2 Chimeric 48D2 was transiently expressed in CHO cells.
- Protein A biosensors were hydrated in blocking buffer (PBS, 0.5% BSA, 0.05% Tween 20, pH 7.4) for minimum 10 min at room temperature before coating. Protein A biosensors were coated with antibodies by dipping the biosensors in 200 ⁇ l of antibody solution (10 ⁇ g/ml in blocking buffer) for 30 min at room temperature. The sensors were then incubated in 200 ⁇ l blocking buffer for at least 10 min before use.
- blocking buffer PBS, 0.5% BSA, 0.05% Tween 20, pH 7.4
- Each antibody was analyzed at four different concentrations of hIL1RAP (21-367) in blocking buffer; 0.8 nM (0.032 ⁇ g/ml), 4 nM (0.16 ⁇ g/ml), 20 nM (0.8 ⁇ g/ml) and 100 nM (4 ⁇ g/ml).
- the baseline was made in blocking buffer with a duration time of 30 sec.
- Association was made for 120 sec in hIL1RAP followed by 120 sec dissociation in blocking buffer.
- Domain mapping The IL1RAP ectodomain consists of three domains (domain 1, domain 2, domain 3).
- Microtiter plates were coated with 100 ng of recombinant hIL1RAP Domain1+2+3 (made up of domain 1, domain 2 and domain 3) (aa21-367) (positive control), recombinant hIL1RAP Domain1+2 (made up of domain 1 and domain 2) (aa21-234), Domain1 (aa21-134) or recombinant hIL1RAP Domain3 (aa235-367) (100 ⁇ l/well) diluted in 0.01 M PBS, pH 7.4, and incubated overnight at 4°C.
- ELISA washing buffer (0.01 M PBS, 0.05% Tween 20, pH 7.4) followed by a blocking step using 150 ⁇ l/well of ELISA blocking solution (PBS, 0.5% BSA, 0.05% Tween 20, pH 7.4). After one hour incubation at room temperature on agitation, the plates were washed again using ELISA washing buffer. A series of 48D2 dilutions in ELISA blocking solution was prepared (ranging from 1 to 10000 ng/ml) and then transferred to the wells at 100 ⁇ l/well. Plates were incubated at room temperature for one hour on agitation and then washed with ELISA washing solution.
- Microtiter plates were coated with the chimeric IL1RAP constructs and ELISA measurements were performed as described above for the domain mapping.
- the polyclonal anti-hIL1RAP antibodies KMT-2 (affinity purified rabbit polyclonal antibodies against human IL1RAP) and KMT 3 (affinity purified rabbit polyclonal antibodies against murine IL1RAP) were used as positive controls.
- Microtiter plate wells were coated with IL1RAP orthologs (Mus musculus, Rattus norvegicus, Macaca fascicularis (Mf, synonymous to cynomolgus monkey), Oryctolagus cuniculus, Canis lupus familiaris, Sus scrofa) and incubated for 1 hour at 37°C. Plates were washed followed by a blocking step. After 1 hour incubation at room temperature on agitation, the plates were washed again. The antibody was diluted in fourfold serial dilution, ranging from 4000 ng/ml to 0.24 ng/ml, in ELISA blocking solution, and then transferred to the ELISA plate.
- IL1RAP orthologs Mus musculus, Rattus norvegicus, Macaca fascicularis (Mf, synonymous to cynomolgus monkey), Oryctolagus cuniculus, Canis lupus familiaris, Sus scrofa
- the antibodies were added in increasing concentrations and then the depicted cytokine was added at a constant concentration.
- the graph shows optical density (OD) values at 620 nm with a high OD representing signaling downstream of the cytokine receptor.
- the chimeric antibody 48D2 induced a pronounced inhibition of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ signaling, up to complete inhibition (blocking) of the signaling of these cytokines.
- the IC50 values are shown in Table 3.
- Table 3 IC50 values [nM] of chimeric 48D2 on the different signaling pathways, obtained from the HEK-BlueTM assay Affinity measurements Affinity measurement results are shown in Table 4 for chimeric 48D2, as well as for humanized 48D2 variant VH5:VL4 (see Example 11) and for humanized and de- immunized 48D2 variant VH5.GL:VL4 (see Example 13).
- k a is the association rate constant, for characterization of the antibody binding to the target
- kd is the dissociation rate constant, for characterization of the antibody dissociation from the target
- KD is the equilibrium dissociation constant between the antibody and its antigen, the ratio of k d /k a .
- K D corresponds to the antibody concentration at which 50% of the antigen binding sites are occupied at equilibrium. The lower the K D value (lower concentration), the higher the affinity.
- the 48D2 variants displayed fast binding to human (h) IL1RAP and slow dissociation resulting in affinities in the nM range. No loss of affinity for human IL1RAP was seen for the humanized, or the humanized and de-immunized, variants compared to chimeric 48D2.
- Table 4 Affinity measurements Domain mapping The domain mapping data is summarized in Table 5 below. The control polyclonal antibody KMT-1 bound to all domains, whereas 48D2 only bound to IL1RAP constructs containing domain 2, suggesting that the antibody binds to this domain.
- Table 5 Domain mapping of chimeric 48D2 Epitope mapping
- the epitope mapping results using murine IL1RAP with the grafted human sequences for regions H1 and H2 are shown in Table 6.
- the h48D2 VH5.GL:VL4 (see Example 13) binding to murine IL1RAP was restored when the human sequence for the H2 region was introduced in murine IL1RAP, suggesting that H2 is involved in the interaction with 48D2 (compare Table 5 and 6).
- the positive control polyclonal antibodies KMT-2 and KMT-3 bound to both chimeric versions of IL1RAP.
- FIG 14 shows cross reactivity of chimeric 48D2 to IL1RAP from different species.
- the antibody is added in increasing concentrations and absorbance at 405 nm is used to detect binding of the antibody to IL1RAP orthologues.
- 48D2 is cross reactive to IL1RAP from human, cynomolgus monkey (cyno) and pig, but has no cross reactivity to IL1RAP from mouse, rat, rabbit or dog ( Figure 14 and Table 7).
- Table 8 In-silico humanized variants of VL and VH (48D2) AADTATYFCARGGVGSSWKAFDLWGPGTLVTISS Conclusions Five in-silico humanized variants of VL and five of VH were created and were to be synthesized in-frame with IgG1 constant domains for production and characterization of 25 humanized antibody variants (see Example 12).
- Example 12 Characterization of humanized 48D2 Aim This example illustrates how the humanized 48D2 variants (see Example 11) were expressed and characterized with the aim of finding a humanized antibody with retained affinity, cytokine inhibition and optimized biochemical properties.
- Material and methods Expression, purification, and characterization of humanized variants
- Heavy and light variable domains of 25 humanized variants of 48D2 were sub-cloned into vectors containing human constant domains: - Kappa constant domain (of the Km3 allotype) is combined with a VL domain forming the entire light chain (SEQ ID NO: 35).
- - IgG1za (of the za allotype) heavy chain constant domain is combined with a VH domain forming the entire heavy chain.
- the heavy chain constant domain also contained the LALA mutation (SEQ ID NO: 2) (corresponding to the one described, for example, in Xu et al., 2000, Cell. Immuno.200: 16-26) in order to avoid Fc-gamma-receptor mediated antibody effector functions.
- the humanized antibodies (h48D2) were transiently expressed in HEK-293 cells, Protein A-purified from the harvested medium of 50 ml cultures and buffer-exchanged into PBS pH 7.4.
- the antibodies were characterized for A) binding (ELISA analysis, human and cynomolgus monkey IL1RAP), B) inhibition of cytokine signaling (HEK-BlueTM assay), C) affinity (Bio-layer interferometry), D) size heterogeneity (SE-HPLC) and E) yield (concentration, A280). Binding ELISA was performed in a similar manner to the indirect ELISA presented for the domain mapping in Example 10 using recombinant hIL1RAP aa21-367 or recombinant mfIL1RAP aa21-367 as coating reagents. SE- HPLC was performed using standard procedures and PBS as running buffer. Affinity and cytokine inhibition were measured as previously described in Example 10.
- FIG. 15A-O shows the inhibitory activity of the humanized 48D2 antibody clones on IL-1 ⁇ , IL-1 ⁇ and IL-33 signaling in HEK cells.
- the antibodies are added in increasing concentrations and then the depicted cytokine is added at a constant concentration.
- the graph shows optical density (OD) values at 620 nm with a high OD representing signaling downstream of the cytokine receptor.
- the antibody clones harboring the VH5 variant induced a complete inhibition of IL-1 ⁇ , IL-1 ⁇ and IL-33 signaling with a similar potency as the chimeric 48D2 antibody ( Figures 15E, 15J, 15O).
- the antibody clones harboring the variants VH1-VH4 inhibited signaling of IL-1 ⁇ , IL-1 ⁇ and IL-33 to varying degrees, with varying potency compared to chimeric 48D2. Partial inhibition was achieved by these variants with regard to IL-1 ⁇ ( Figure 15A-D) and IL-33 (Figure 15K- N); and complete inhibition was achieved with regard to IL-1 ⁇ ( Figure 15F-I).
- VH5:VL4 C Affinity Measurements KD values for affinity towards human IL1RAP are shown in Table 11 for the humanized 48D2 variants. Affinity was measured using bio-layer interferometry. All antibody variants exhibited affinity in the nanomolar range. The highest affinities were obtained for the VH5 series with KD values in the range of 1-4 nM. See also Table 4 for a direct comparison of chimeric 48D2, humanized 48D2 variant VH5:VL4, and a humanized and de-immunized 48D2 variant VH5.GL:VL4. Table 11: Affinity measurements of the humanized antibodies D) Size heterogeneity Size heterogeneity was determined using size-exclusion HPLC (SE-HPLC) (Table 12).
- the intact monomeric antibody consists of two identical heavy chains and two identical light chains covalently linked together by disulfide bonds.
- the high-molecular weight (HMW) species potentially contain soluble antibody aggregates, for example dimers.
- the low-molecular weight (LMW) species potentially contain antibodies where, for example, peptide bonds have been cleaved, i.e. fragmented antibodies. Almost all variants were highly monomeric (t 97%), except for h48D2 VH4:VL3 that contained >5% high-molecular weight species (HMW). For all analyzed variants, no to small amounts of low-molecular weight (LMW) species were detected. Table 12: Size heterogeneity analysis of the humanized antibodies
- the humanized antibody variants harboring the VH5 variant retained full capacity to completely inhibit signaling of IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ , with a similar potency as the chimeric 48D2 antibody.
- the antibody variants harboring the variants VH1-VH4 completely inhibited signaling of IL-1 ⁇ and partially inhibited signaling of IL-1 ⁇ and IL-33, with varying potency compared to chimeric 48D2.
- Example 13 De-immunization of two of the humanized 48D2 clones Aim This example illustrates how sequences in h48D2 VL5 and VH5 with predicted affinity to MHC class II molecules were de-immunized by germlining. Material and methods Removal of sequences with predicted affinity to MHC class II molecules The humanized 48D2 VL5 and VH5 sequences were created using germline antibody sequences.
- Table 14 Binding of the humanized and de-immunized antibody clones to IL1RAP Binding of humanized and de-immunized antibody clones to IL1RAP expressing cells
- Flow cytometry analysis of IL1RAP-expressing SKMEL-5 cells stained with h48D2 VH5.GL:VL4 and h48D2 VH5.GL:VL5.GL or isotype control reveals a higher mean fluorescence intensity (MFI) for VH5.GL:VL4 and VH5.GL:VL5.GL compared to the isotype control antibody, when the antibodies are added in increasing concentrations (Figure 16).
- MFI mean fluorescence intensity
- FIG. 17 shows the inhibitory activity of the humanized and de-immunized 48D2 antibody clones on IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ signaling in HEK cells.
- the antibodies were added in increasing concentrations and the depicted cytokine was added at a constant concentration.
- Humanized variants h48D2 VH5:VL4 and h48D2 VH5:VL5 were included as controls.
- the graph shows OD values at 620 nm with a high OD representing signaling downstream of the cytokine receptor.
- IC50 values are shown in Table 15. Table 15: IC50 values [nM] of the de-immunized antibody clones In the experimental set-up used to obtain the results in Figure 17A-F, HEK-BlueTM (IL- 33/IL-1) cells were transiently transfected with the IL-36 receptor the day before.
- Affinity was measured using bio-layer interferometry. The affinities were similar for all de-immunized variants with KD values at 1-2 nM. See also Table 4 for a direct comparison of 48D2, humanized 48D2, and de-immunized h48D2.
- Table 17 Affinity measurements of the de-immunized h48D2 antibodies Size heterogeneity Size heterogeneity was determined using size exclusion HPLC (SE HPLC) (Table 18). Almost all variants were highly monomeric (t 98%) with the exception of h48D2 variants with VL5.GL which contained some HMW species. For all analyzed variants, no LMW species were detected.
- Table 18 Size heterogeneity analysis of the de-immunized h48D2 antibodies Yield For the de-immunized h48D2 variants, protein concentrations were determined using absorbance measurements at 280 nm and yields were calculated for the 50 ml cultures (Table 19). Antibody variants harboring the VL variant VL5.GL exhibited lower obtainable yields compared to the other variants. Table 19: Yields of de immunized h48D2 antibodies Cross reactivity Figure 18 shows cross reactivity of h48D2 VH5.GL:VL4 and h48D2 VH5.GL:VL5.GL to IL1RAP from different species.
- the antibody is added in increasing concentrations and absorbance at 405nm is used to detect binding to IL1RAP.
- chimeric 48D2 the humanized and de-immunized variants h48D2 VH5.GL:VL4 and h48D2 VH5.GL:VL5.GL were cross reactive to IL1RAP from cynomolgus monkey (cyno) and pig, but have no cross reactivity to IL1RAP from mouse, rat, rabbit or dog ( Figure 18 and Table 20).
- Example 15 ADCC effect of chimeric 48D2 Aim This example aimed to investigate the antibody-dependent cellular cytotoxicity (ADCC) effect of chimeric 48D2 when expressed in hIgG1-wild type (WT) or an effector-function silent IgG1-LALA format.
- ADCC antibody-dependent cellular cytotoxicity
- Target cells were seeded into a 96- well plate at a density of 10000 cells per well.
- 48D2-WT, 48D2-LALA or isotype control antibodies were added to the wells in different concentrations and incubated for 30 min before 100000 NK effector cells were added to each well.
- NK cells were extracted from Leukocyte Concentrates by using an NK cell negative cell isolation kit according to manufacturer’s instructions (Miltenyi Biotech, Bergisch Gladbach, Germany).
- Non-specific human IgG1-WT and IgG1-LALA antibodies were used as controls in the experiment.
- the degree of cell death was assessed by detection of DAPI positive cells using a FACS LSR Fortessa flow cytometer (BD) after 18 hours in culture.
- Results The in vitro ADCC assay shows that chimeric 48D2 in hIgG1 format directs NK cells to kill SKMEL-5 cells in an antibody-specific, dose-dependent manner (Figure 19). There was no increase in the percentage of dead SKMEL-5 cells after treatment with chimeric 48D2 expressed in a hIgG1-LALA format, compared to isotype controls and untreated cells (untreated cells correspond to 0 ng/ml antibody). The effect was shown to be dose-dependent.
- chimeric 48D2 When chimeric 48D2 is expressed in a hIgG1-LALA format, the ADCC effect disappears. It can be assumed that antibody variants of the 48D2 antibody (such as the described antibodies in the Examples above, e.g. humanized, or humanized and de-immunized antibody variants) can have similar effects when expressed in a hIgG1-WT or hIgG1 LALA format. Indeed, Example 19 below demonstrates that antibody variant VH5.GL:VL4 in a hIgG1 LALA format does not induce Fc-mediated immune activation in the blood loop assay.
- antibody variant VH5.GL:VL4 in a hIgG1 LALA format does not induce Fc-mediated immune activation in the blood loop assay.
- Example 16 Inhibition of cytokine signaling in human fibroblasts by chimeric 48D2 Aim The aim of this example is was investigate the inhibitory activities of chimeric 48D2 on IL-1 ⁇ , IL-1 ⁇ , IL-33, IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ -stimulated IL-6 gene expression in human fibroblasts in vitro.
- Fibroblasts from healthy human skin were commercially acquired and grown in complete fibroblast growth media.75000 cells were seeded per well in a 24-well plate. 80% confluent cells were serum starved in fibroblast media containing only 1% FBS overnight. Media was changed to new fibroblast media with 1% FBS and no growth factors and 20 ug/ml chimeric 48D2 was added to the wells 1 hour before stimulating with different concentrations of the cytokines (as depicted in Figure 20). Cells were stimulated for 24 hours after which RNA was isolated according to the manufacturer’s instructions.
- IL-6 mRNA levels were analyzed using SYBR Green and data were analyzed using the ⁇ CT method and shown as fold change 2 - ⁇ CT compared to the untreated control.
- Results IL-1 ⁇ , IL-1 ⁇ , IL-36 ⁇ , IL-36 ⁇ and IL-36 ⁇ induced IL-6 gene expression in dermal fibroblasts in a dose-dependent manner (Figure 20).
- chimeric 48D2 inhibited the increase in gene expression down to levels comparable with the unstimulated control.
- IL-33 had no effect on IL-6 expression in these cells (data not shown). It can be assumed that antibody variants of the 48D2 antibody (such as the described antibodies in the Examples above, e.g.
- Example 17 demonstrates that antibody variant VH5.GL:VL4 inhibits IL-1 ⁇ signaling in human whole blood.
- Conclusions 48D2 can block the cytokine-induced increase in IL-6 gene expression in human fibroblasts.
- Example 17 Inhibition of IL-1 ⁇ signaling in human whole blood by 48D2 variant VH5.GL:VL4 Aim
- the aim of this study is to investigate how blockade of IL-1 ⁇ / ⁇ , IL-33 and IL-36 ⁇ / ⁇ / ⁇ signaling, by pre-incubation of human whole blood with the 48D2 variant VH5.GL:VL4, affects the release of various downstream cytokines and chemokines in response to stimulation with IL-1 ⁇ .
- Material and methods Human blood was collected from two different donors in Heparin tubes. The blood was transferred to wells of a 96-well plate and incubated with 150 ⁇ g/ml VH5.GL:VL4 at 37°C and 5% CO 2 for 30 min during agitation.
- IL-1 ⁇ or LPS were subsequently added to the wells, both at 1 ng/ml, and the blood incubated for 20 hrs at 37°C and 5% CO 2 for 30 min during agitation. Wells where the blood samples were incubated with only formulation buffer were included as negative controls (Ctrl). The plate was centrifuged at 1500 rpm to separate plasma from blood cells.
- the plasma was diluted 1:2 and levels of 71 different cytokines and chemokines (6CKine, BCA-1, CTACK, EGF, ENA- 78, Eotaxin, Eotaxin-2, Eotaxin-3, FGF-2, Flt3L, Fractalkine, G-CSF, GM-CSF, GRO ⁇ /CXCL1, I-309, IFN ⁇ 2, IFN ⁇ , IL-1 ⁇ , IL-1 ⁇ , IL-1RA, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-12p40, IL-12p70, IL-13, IL-15, IL-16, IL-17A, IL-17E/IL-25, IL-17F, IL-18, IL-20, IL-21, IL-22, IL-23, IL-27, IL-28, IL-33, IP-10, LIF, MCP-1, MCP-2, MCP-3, MCP-4,
- Results for four of these, G-CSF, GRO ⁇ /CXCL1, IL-17A and TNF- ⁇ are discussed below.
- Results Blockade of IL-1 ⁇ / ⁇ , IL-33 and IL-36 ⁇ / ⁇ / ⁇ signaling by VH5.GL:VL4 decreased the release of G-CSF, GRO ⁇ /CXCL1, IL-17A and TNF- ⁇ in human whole blood in response to stimulation with IL-1 ⁇ ( Figure 21A-D).
- IL1RAP blockade by VH5.GL:VL4 impacts downstream effects of IL 1R signaling mediated by IL-1 ⁇ and LPS such that the release of multiple cytokines and chemokines is reduced.
- Example 18 Inhibition of IL-1 ⁇ signaling in a blood-loop system by 48D2 variant VH5.GL:VL4 Aim The aim of this study is to investigate how blockade of IL-1 ⁇ / ⁇ , IL-33 and IL-36 ⁇ / ⁇ / ⁇ signaling, by pre-incubation of human whole blood with the 48D2 variant VH5.GL:VL4, affects the release of IL-6 and IL-8 in response to stimulation with IL-1 ⁇ in a blood-loop system, which mimics the human blood circulation.
- Cytokines IL-6 and IL-8 were measured using the MULTI-ARRAY® technology from Meso Scale Discovery. All samples were diluted 1:4 and samples were run in duplicates according to the manufacturer’s instructions. Results Blockade of IL-1 ⁇ / ⁇ , IL-33 and IL-36 ⁇ / ⁇ / ⁇ signaling by VH5.GL:VL4 decreased the release of IL-6 and IL-8 in human whole blood circulating in the blood-loop system, in response to stimulation with IL-1 ⁇ ( Figure 22A-B).
- IL1RAP blockade by VH5.GL:VL4 impacts downstream effects of IL-1R signaling mediated by IL-1 ⁇ such that the release of the cytokines IL-6 and IL-8 is reduced.
- Example 19 Internalization of 48D2 variant VH5.GL:VL4 by IL1RAP-expressing cells Aim The aim of this experiment is to investigate membrane binding and potential internalization of fluorescently-labelled 48D2 variant VH5.GL:VL4 by IL1RAP- expressing cells.
- WT SKMEL cells incubated for 2 hrs with A647-conjugated VH5.GL:VL4 were additionally incubated with 5 ⁇ g/ml rabbit anti- EEA1 antibody and 10 ⁇ g/ml mouse anti-Lamp1 antibody for 3 hrs to stain for endosomal and lysosomal markers, respectively.
- the cells were washed and incubated with AlexaFluor488 (AF488)-conjugated anti-rabbit antibody and rhodamine (RX)- conjugated anti-mouse antibody for 30 min. Following incubation, cells were washed and fixed with 2% paraformaldehyde.
- Example 20 Fc-mediated immune activation in a blood-loop system by 48D2 variant VH5.GL:VL4 Aim
- the aim of this study is to investigate if, and to what extent, the 48D2 variant VH5.GL:VL4, expressed in an effector function silent hIgG1-LALA format, can induce immune activation in the absence of other stimuli in a blood-loop system, which mimics the human blood circulation.
- Immune activation will be evaluated by release of proinflammatory cytokines and complement activation in circulating human whole blood. Material and methods Fresh whole blood was collected from ten healthy donors and low amounts of soluble heparin was added to allow for analysis of drug-related effects on complement system.
- the blood was immediately transferred to pre-coated plastic tubes to form the loops of a blood-loop system, followed by addition of VH5.GL:VL4 at 0.0125 mg/ml, 0.125 mg/ml or 1.25 mg/ml.
- the loops were placed on a rotating wheel and samples were run in parallel. Each loop was sampled following 15 min and 4 hrs and EDTA was added at a concentration of 10 mM to each sample to stop reactions at sampling time points.
- Plasma samples were prepared by centrifugation, aliquoted and stored at ⁇ 60°C until analysis. Cytokines IFN ⁇ , IL-6, IL-8, TNF ⁇ were measured using the MULTI-ARRAY® technology from Meso Scale Discovery. All samples were diluted 1:4 and samples were run in duplicates according to the manufacturer’s instructions. Complement activation was analyzed by measurement of the complement split products C3a and C5a using ELISA kit (RayBio® Human C3a ELISA Kit and RayBio® Human C5a ELISA Kit).
- Plasma samples were diluted 1:500 with sample diluent for C3a analysis and 1:50 with sample diluent for C5a analysis and run in duplicates according to the manufacturer’s instructions.
- Results VH5.GL:VL4 displayed no effect on release of IFN ⁇ , IL-6, IL-8 or TNF ⁇ ( Figure 25A-D), or on complement activation as measured by levels of C3a and C5a ( Figure 26A-B), in the blood-loop system, at any of the three concentrations evaluated.
- the anti-CD52 antibody alemtuzumab induced cytokine release as well as complement activation.
- Conclusions VH5.GL:VL4 with an effector function silent Fc region does not induce Fc-mediated immune activation.
- Example 21 Initial safety and pharmaco- and toxicokinetic properties of intravenously dosed 48D2 variant VH5.GL:VL4 Aim The aim of this study is to determine the pharmacokinetics and potential toxicity of VH5.GL:VL4, administered intravenously as a single dose to male and female cynomolgus monkeys at three escalating dose levels, up to maximum tolerated dose. Material and methods VH5.GL:VL4 was administered intravenously via peripheral veins at 5, 20 or 50 mg/kg as a single dose (bolus) to one male and one female cynomolgus monkey for each dose level evaluated. Animals were observed daily for two weeks after administration for mortality, clinical signs and food consumption.
- Hematology and serum chemistry were performed pre test and on day 8 of the study. Body weight was recorded pre test and on day 8 and 15. Samplings for bioanalytical and toxicokinetic evaluation were collected via the femoral vein (at least 0.6 ml blood for each sampling) pre-dose and at 0.083, 1, 3, 6, 24, 48, 96, 168, 264 and 336 hrs after administration. Blood samples were allowed to clot in tubes for serum separation for 30 min at room temperature. The clot was spun down by centrifugation at 1200 g for 10 min at 4°C. The resultant serum was stored at -80°C until analysis.
- Biotinylated human IL1RAP was added to a Meso Scale Discovery (MSD) plate pre- coated with streptavidin and incubated at room temperature. After washing, serum samples were added to the plate followed by incubation at room temperature. The plate was washed and anti-human IgG conjugated to an electrochemiluminescent label (MSD SULFO-TAG) was added to the plate. After a final incubation and wash, read buffer was added. The SULFO-TAG emits light when a voltage in the MSD instrument is applied to the plate electrodes. The instrument measures the intensity of emitted light to provide a quantitative measure of VH5.GL:VL4 in the samples.
- MSD SULFO-TAG electrochemiluminescent label
- Serum toxicokinetic analyses were performed according to standard noncompartmental approach using WinNonlin package (v.8.1, Pharsight Inc, Certara Company, USA). Results No abnormal clinical signs and no relevant toxicological changes were present in body weights and at clinical pathology investigations. No toxicologically relevant changes in serum chemistry and hematology were observed. In the dose range investigated, dose-normalized maximum concentrations of the compound were similar. At each dose level, male and female serum toxicokinetic parameters of VH5.GL:VL4 were similar.
- Terminal half-life of VH5.GL:VL4 was, on average, 98 hrs (4 days) after the 5 mg/kg dose; after the 20 mg/kg and 50 mg/kg doses the parameter, of the order of 220 hrs (9 days), was two-fold higher than that at 5 mg/kg (Table 21).
- VH5.GL:VL4 was found to decline in a bi-exponential manner (Figure 27). After all doses, serum clearance of VH5.GL:VL4 was low and the volumes of distribution of the terminal phase was of the same order of magnitude as monkey total body water ( ⁇ 700 ml/kg).
- Table 21 Toxicokinetic parameters of VH5.GL:VL4 after single intravenous dosing of 5, 20 and 50 mg/kg to cynomolgus monkeys
- VH5.GL:VL4 was administered intravenously or subcutaneously in the dorsal area at 10 mg/kg, as a single dose to two female cynomolgus monkeys per route of administration.
- Samplings for pharmacokinetic evaluation were collected (at least 0.6 ml blood for each sampling) pre-dose and at 1, 3, 6, 24, 48, 96, 168, 264, 336, 480 and 672 hrs following administration. Additionally, a first dose was collected at 0.083 hrs following intravenous administration and at 0.5 hrs following subcutaneous administration. Blood samples were allowed to clot in tubes for serum separation for 30 min at room temperature. The clot was spun down by centrifugation at 1200 g for 10 min at 4°C.
- CDR sequences (defined according to IMGT) SEQ ID NO: 1 Variable light chain complementarity-determining region 1 (CDR-L1) ESISTA Variable light chain complementarity-determining region 2 (CDR-L2) KAS SEQ ID NO: 3 Variable light chain complementarity-determining region 3 (CDR-L3) QQGFSSGNVHNA SEQ ID NO: 4 Variable heavy chain complementarity-determining region 1 (CDR-H1) GPSLSHFD SEQ ID NO: 5 Variable heavy chain complementarity-determining region 2 (CDR-H2) ISPGVST SEQ ID NO: 6 Variable heavy chain complementarity-determining region 3 (CDR-H3) ARGGVGSSWKAFDL CDR sequences (defined according to Kabat) SEQ ID NO: 7 Variable light chain complementarity-determining region 1 (CDR-L1) QASESISTALA SEQ ID NO: 8 Variable light chain complementarity determining region 2 (CDRL2) KASTLPS SEQ ID NO: 9 Variable light chain complementarity-determining
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Steroid Compounds (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2021405730A AU2021405730A1 (en) | 2020-12-23 | 2021-12-22 | Anti-il1rap antibody |
| IL303922A IL303922A (en) | 2020-12-23 | 2021-12-22 | Anti-il1rap antibody |
| JP2023538679A JP2024500920A (ja) | 2020-12-23 | 2021-12-22 | 抗il1rap抗体 |
| CN202180085996.9A CN116724055A (zh) | 2020-12-23 | 2021-12-22 | 抗il1rap抗体 |
| MX2023007611A MX2023007611A (es) | 2020-12-23 | 2021-12-22 | Anticuerpo anti-il1rap. |
| KR1020237020863A KR20230123962A (ko) | 2020-12-23 | 2021-12-22 | 항-il1rap 항체 |
| EP21844985.8A EP4267625A1 (en) | 2020-12-23 | 2021-12-22 | Anti-il1rap antibody |
| CA3202942A CA3202942A1 (en) | 2020-12-23 | 2021-12-22 | Anti-il1rap antibody |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP20216926.4 | 2020-12-23 | ||
| EP20216926 | 2020-12-23 | ||
| GBGB2105933.2A GB202105933D0 (en) | 2021-04-26 | 2021-04-26 | Anti-IL1rap antibody |
| GB2105933.2 | 2021-04-26 | ||
| EP21212368 | 2021-12-03 | ||
| EP21212368.1 | 2021-12-03 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022136569A1 true WO2022136569A1 (en) | 2022-06-30 |
Family
ID=79731073
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2021/087338 Ceased WO2022136569A1 (en) | 2020-12-23 | 2021-12-22 | Anti-il1rap antibody |
Country Status (9)
| Country | Link |
|---|---|
| US (2) | US11479610B2 (https=) |
| EP (1) | EP4267625A1 (https=) |
| JP (1) | JP2024500920A (https=) |
| KR (1) | KR20230123962A (https=) |
| AU (1) | AU2021405730A1 (https=) |
| CA (1) | CA3202942A1 (https=) |
| IL (1) | IL303922A (https=) |
| MX (1) | MX2023007611A (https=) |
| WO (1) | WO2022136569A1 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN116284401A (zh) * | 2023-02-20 | 2023-06-23 | 中国人民解放军军事科学院军事医学研究院 | 人源抗il-1r3抗体及其应用 |
| WO2024062074A1 (en) | 2022-09-21 | 2024-03-28 | Sanofi Biotechnology | Humanized anti-il-1r3 antibody and methods of use |
| US12043669B2 (en) | 2021-05-21 | 2024-07-23 | Leo Pharma A/S | IL-1 receptor accessory protein-inhibiting antibodies and antigen-binding fragments thereof |
| WO2024231251A1 (en) | 2023-05-05 | 2024-11-14 | Cantargia Ab | Anti-il1rap antibodies |
| US12209131B2 (en) | 2018-08-16 | 2025-01-28 | Cantargia Ab | Anti-IL1RAP antibody compositions |
| WO2026022232A1 (en) | 2024-07-24 | 2026-01-29 | Almirall, S.A. | Il-1rap inhibitor for treating or preventing hidradenitis suppurativa |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4267625A1 (en) * | 2020-12-23 | 2023-11-01 | Cantargia AB | Anti-il1rap antibody |
| CN120775048A (zh) * | 2024-04-02 | 2025-10-14 | 信达生物制药(苏州)有限公司 | 抗il1rap抗体以及其用途 |
Citations (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| EP0213303A2 (en) | 1985-07-12 | 1987-03-11 | Bo Magnus Ekman | A method for producing small, spherical polymer particles |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5851451A (en) | 1995-12-15 | 1998-12-22 | Takeda Chemical Industries, Ltd. | Production of microspheres |
| WO2000061739A1 (fr) | 1999-04-09 | 2000-10-19 | Kyowa Hakko Kogyo Co., Ltd. | Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle |
| EP2213683A1 (en) | 2004-08-04 | 2010-08-04 | Applied Molecular Evolution, Inc. | Variant Fc regions |
| WO2011021014A2 (en) | 2009-08-21 | 2011-02-24 | Cantargia Ab | Novel agents and uses thereof |
| US7960512B2 (en) | 2003-01-09 | 2011-06-14 | Macrogenics, Inc. | Identification and engineering of antibodies with variant Fc regions and methods of using same |
| WO2012098407A1 (en) | 2011-01-19 | 2012-07-26 | Cantargia Ab | Anti - il1rap antibodies and their use for treating human |
| WO2015132602A1 (en) | 2014-03-05 | 2015-09-11 | Cantargia Ab | Anti human interleukin-1 receptor accessory protein (il1 rap) antibodies and uses thereof |
| WO2016207304A2 (en) * | 2015-06-26 | 2016-12-29 | Mab Discovery Gmbh | Monoclonal anti-il-1racp antibodies |
| WO2019028190A1 (en) * | 2017-08-01 | 2019-02-07 | City Of Hope | ANTI-IL1RAP ANTIBODIES |
| WO2020035577A1 (en) * | 2018-08-16 | 2020-02-20 | Cantargia Ab | Anti-il1rap antibody compositions |
| WO2020037154A1 (en) * | 2018-08-17 | 2020-02-20 | 23Andme, Inc. | Anti-il1rap antibodies and methods of use thereof |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA3084459A1 (en) * | 2016-10-16 | 2018-04-19 | Cellerant Therapeutics, Inc. | Anti-il1-rap antibodies |
| EP4267625A1 (en) * | 2020-12-23 | 2023-11-01 | Cantargia AB | Anti-il1rap antibody |
-
2021
- 2021-12-22 EP EP21844985.8A patent/EP4267625A1/en active Pending
- 2021-12-22 AU AU2021405730A patent/AU2021405730A1/en active Pending
- 2021-12-22 JP JP2023538679A patent/JP2024500920A/ja active Pending
- 2021-12-22 US US17/559,227 patent/US11479610B2/en active Active
- 2021-12-22 WO PCT/EP2021/087338 patent/WO2022136569A1/en not_active Ceased
- 2021-12-22 KR KR1020237020863A patent/KR20230123962A/ko active Pending
- 2021-12-22 IL IL303922A patent/IL303922A/en unknown
- 2021-12-22 MX MX2023007611A patent/MX2023007611A/es unknown
- 2021-12-22 CA CA3202942A patent/CA3202942A1/en active Pending
-
2022
- 2022-06-09 US US17/836,457 patent/US12043666B2/en active Active
Patent Citations (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0213303A2 (en) | 1985-07-12 | 1987-03-11 | Bo Magnus Ekman | A method for producing small, spherical polymer particles |
| US5851451A (en) | 1995-12-15 | 1998-12-22 | Takeda Chemical Industries, Ltd. | Production of microspheres |
| WO2000061739A1 (fr) | 1999-04-09 | 2000-10-19 | Kyowa Hakko Kogyo Co., Ltd. | Methode de regulation de l'activite d'une molecule immunologiquement fonctionnelle |
| US7960512B2 (en) | 2003-01-09 | 2011-06-14 | Macrogenics, Inc. | Identification and engineering of antibodies with variant Fc regions and methods of using same |
| EP2213683A1 (en) | 2004-08-04 | 2010-08-04 | Applied Molecular Evolution, Inc. | Variant Fc regions |
| WO2011021014A2 (en) | 2009-08-21 | 2011-02-24 | Cantargia Ab | Novel agents and uses thereof |
| WO2012098407A1 (en) | 2011-01-19 | 2012-07-26 | Cantargia Ab | Anti - il1rap antibodies and their use for treating human |
| WO2015132602A1 (en) | 2014-03-05 | 2015-09-11 | Cantargia Ab | Anti human interleukin-1 receptor accessory protein (il1 rap) antibodies and uses thereof |
| WO2016207304A2 (en) * | 2015-06-26 | 2016-12-29 | Mab Discovery Gmbh | Monoclonal anti-il-1racp antibodies |
| WO2019028190A1 (en) * | 2017-08-01 | 2019-02-07 | City Of Hope | ANTI-IL1RAP ANTIBODIES |
| WO2020035577A1 (en) * | 2018-08-16 | 2020-02-20 | Cantargia Ab | Anti-il1rap antibody compositions |
| WO2020037154A1 (en) * | 2018-08-17 | 2020-02-20 | 23Andme, Inc. | Anti-il1rap antibodies and methods of use thereof |
Non-Patent Citations (76)
| Title |
|---|
| "GenBank", Database accession no. AAB84059 |
| "NCBI", Database accession no. NP_002173.1 |
| "UniProtKB", Database accession no. Q9NPH3-1 |
| ÅGERSTAM HELENA ET AL: "IL1RAP antibodies block IL-1-induced expansion of candidate CML stem cells and mediate cell killing in xenograft models", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US, vol. 128, no. 23, 8 December 2016 (2016-12-08), pages 2683 - 2693, XP086510523, ISSN: 0006-4971, [retrieved on 20201129], DOI: 10.1182/BLOOD-2015-11-679985 * |
| AI-LAZIKANI ET AL., JMB, vol. 273, 1997, pages 927 - 948 |
| ANGOV, BIOTECHNOL. J., vol. 6, no. 6, 2011, pages 650 - 659 |
| ANNE S DE GROOT ET AL: "Beyond humanization and de-immunization: tolerization as a method for reducing the immunogenicity of biologics", EXPERT REVIEW OF CLINICAL PHARMACOLOGY 20141101 EXPERT REVIEWS LTD. GBR, vol. 6, no. 6, 1 November 2013 (2013-11-01), UK, pages 651 - 662, XP055237741, ISSN: 1751-2433, DOI: 10.1586/17512433.2013.835698 * |
| ARMOUR KL. ET AL., EUR J IMMUNOL., vol. 29, no. 8, 1999, pages 2613 - 24 |
| ASKMYR ET AL., BLOOD, vol. 121, no. 18, 2013, pages 3709 - 13 |
| BARREYRO ET AL., BLOOD, vol. 120, no. 6, 2012, pages 1290 - 8 |
| BRUHNS ET AL., BLOOD, vol. 113, no. 16, 2009, pages 3716 - 25 |
| BUSHFIELD ET AL., LEUKEMIA, vol. 28, no. 11, 2014, pages 2213 - 21 |
| COLE ET AL., MOL. CELL. BIOL., vol. 62, 1984, pages 109 - 120 |
| COTE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 80, 1983, pages 2026 - 2030 |
| DATTA-MANNAN A ET AL., DRUG METAB. DISPOS., vol. 35, 2007, pages 86 - 94 |
| DINARELLO CA, CHEST, vol. 118, 2000, pages 503 - 508 |
| DINARELLO ET AL., NATURE REVIEWS, vol. 11, 2012, pages 633 - 652 |
| DINARELLO, CA, BLOOD, vol. 87, no. 6, 1996, pages 2095 - 147 |
| DINARELLO, CA, CLIN EXP RHEUMATOL, vol. 20, no. 27, 2002, pages 1 - 13 |
| DINARELLO, MOL. MED., vol. 20, 2014, pages S43 - S58 |
| DING L: "IL-36 cytokines in autoimmunity and inflammatory disease", ONCOTARGET, vol. 9, no. 2, 2018, pages 2895 - 2901, XP055622716, DOI: 10.18632/oncotarget.22814 |
| DONDELINGER ET AL.: "Understanding the Significance and Implications of Antibody Numbering and Antigen-Binding Surface/Residue Definition", FRONT. IMMUNOL., 16 October 2018 (2018-10-16) |
| DRUG DISCOVERY TODAY, vol. 10, 2005, pages 23 - 33 |
| EXPERT. OPIN. BIOL. THER., vol. 5, 2005, pages 783 - 797 |
| FEBS J, vol. 274, 2007, pages 86 - 95 |
| GARLANDA C: "The interleukin-1 family: back to the future", IMMUNITY, vol. 39, 2013, pages 1003 - 1018, XP055160331, DOI: 10.1016/j.immuni.2013.11.010 |
| GARLANDA ET AL., IMMUNITY, vol. 39, no. 6, 12 December 2013 (2013-12-12), pages 1003 - 18 |
| GEBAUERSKERRA, CURR OPIN CHEM BIOL, vol. 13, no. 3, 2009, pages 245 - 255 |
| HELENA ?GERSTAM ET AL: "Antibodies targeting human IL1RAP (IL1R3) show therapeutic effects in xenograft models of acute myeloid leukemia", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 112, no. 34, 10 August 2015 (2015-08-10), pages 10786 - 10791, XP055308490, ISSN: 0027-8424, DOI: 10.1073/pnas.1422749112 * |
| HINTON ET AL., J BIOL CHEM., vol. 279, no. 8, 2004, pages 6213 - 6 |
| HINTON ET AL., J. BIOL. CHEM., vol. 279, no. 8, 2004, pages 6213 - 6 |
| IDUSOGIE ET AL., J IMMUNOL, vol. 164, no. 8, 2000, pages 4178 - 84 |
| IDUSOGIE ET AL., J IMMUNOL., vol. 164, no. 8, 2000, pages 4178 - 84 |
| INNOVATIONS PHARMAC. TECHNOL., 2006, pages 27 - 30 |
| J G R HURRELL: "Monoclonal Hybridoma Antibodies: Techniques and Applications", 1982, CRC PRESS |
| J. PHARMACOL. EXP. THER., vol. 318, 2006, pages 803 - 809 |
| JARAS ET AL., PROC NATL ACAD SCI USA, vol. 107, no. 37, 2010, pages 16280 - 5 |
| JONES ET AL., METHODS MOL BIOL, vol. 525, 2009, pages 405 - 23 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1987, NIH |
| KIVI G: "HybriFree: a robust and rapid method for the development of monoclonal antibodies from different host species", BMC BIOTECHNOLOGY, vol. 16, 2016, pages 2 |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 4950497 |
| KOTSIOU ET AL.: "IL-33/ST2 Axis in Organ Fibrosis", FRONT IMMUNOL, vol. 9, 24 October 2018 (2018-10-24), pages 2432 |
| KOZBOR ET AL., J. IMMUNOL. METHODS, vol. 81, 1985, pages 31 - 42 |
| LABRIJN AF ET AL., NAT BIOTECHNOL, vol. 27, no. 8, 2009, pages 767 - 71 |
| LABRIJN ET AL., NAT BIOTECHNOL., vol. 27, no. 8, 2009, pages 767 - 71 |
| LAZAR ET AL., PNAS, vol. 103, no. 11, 2006, pages 4005 - 4010 |
| LEFRANC ET AL.: "IMGT unique numbering for immunoglobulin and T cell receptor constant domains and Ig superfamily C-like domains", DEV COMP IMMUNOL., vol. 29, no. 3, 2005, pages 185 - 203, XP004657549, DOI: 10.1016/j.dci.2004.07.003 |
| LI: "Construction strategies for developing expression vectors for recombinant monoclonal antibody production in CHO cells", MOL BIOL REP, vol. 45, no. 6, December 2018 (2018-12-01), pages 2907 - 2912, XP036644906, DOI: 10.1007/s11033-018-4351-0 |
| LIEW FY: "lnterleukin-33 in health and disease", NATURE REVIEWS IMMUNOLOGY, vol. 16, 2016, pages 676 - 689 |
| MASUDA ET AL., MOL IMMUNOL, vol. 44, no. 12, 2007, pages 3122 - 31 |
| METH. MOL. BIOL., vol. 352, 2007, pages 95 - 109 |
| NAT. BIOTECHNOL., vol. 22, 2004, pages 575 - 582 |
| NYGREN, FEBS J, vol. 275, 2008, pages 2668 - 2676 |
| OKAZAKI ET AL., J MOL BIOL., vol. 336, no. 5, 2004, pages 1239 - 49 |
| ORLANDI ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 86, 1989, pages 3833 - 3837 |
| PULE ET AL., CYTOTHERAPY, vol. 5, no. 3, 2003, pages 211 - 26 |
| REICHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| RICHARDS ET AL., MOL CANCER THER, vol. 7, no. 8, 2008, pages 2517 - 27 |
| RICHARDS ET AL., MOL CANCER THERE, vol. 7, no. 8, 2008, pages 2517 - 27 |
| RIDKER ET AL., AM HEART JOURNAL, vol. 162, no. 4, 2011, pages 597 - 605 |
| RUDIKOFF S ET AL: "Single amino acid substitution altering antigen-binding specificity", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, vol. 79, 1 March 1982 (1982-03-01), pages 1979 - 1983, XP007901436, ISSN: 0027-8424, DOI: 10.1073/PNAS.79.6.1979 * |
| RYAN ET AL., MOL. CANCER THER., vol. 6, 2007, pages 3009 - 3018 |
| SHIELDS RL. ET AL., J BIOL CHEM., vol. 276, no. 9, 2001, pages 6591 - 604 |
| STEURER W ET AL., J IMMUNOL, vol. 155, no. 3, 1995, pages 1165 - 74 |
| STROHL, CURR OPIN BIOTECHNOL, vol. 20, no. 6, 2009, pages 685 - 91 |
| TRENDS. BIOTECHNOL., vol. 23, 2005, pages 514 - 522 |
| VACCARO ET AL., NAT BIOTECHNOL., vol. 23, no. 10, 2005, pages 1283 - 8 |
| VACCARO ET AL., NAT. BIOTECHNOL., vol. 23, no. 10, 2005, pages 1283 - 1561 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 15361 |
| VISVADERLINDEMAN, NAT REV CANCER, vol. 8, 2008, pages 755 - 768 |
| WANG ET AL., NATURE IMMUNOLOGY, vol. 11, 2010, pages 905 - 912 |
| WINTER ET AL., NATURE, vol. 349, 1991, pages 293 - 299 |
| XU ET AL., CELL. IMMUNO., vol. 200, 2000, pages 16 - 26 |
| YOON: "Antibodies to domains II and III of the IL-1 receptor accessory protein inhibit IL-1 beta activity but not binding: regulation of IL-1 responses is via type I receptor, not the accessory protein.", THE JOURNAL OF IMMUNOLOGY, vol. 160, no. 7, 1 April 1998 (1998-04-01), pages 3170 - 3179, XP055191790 * |
| ZALEVSKY ET AL., NAT. BIOTECHNOLOGY, vol. 28, no. 2, 2010, pages 157 - 159 |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12209131B2 (en) | 2018-08-16 | 2025-01-28 | Cantargia Ab | Anti-IL1RAP antibody compositions |
| US12043669B2 (en) | 2021-05-21 | 2024-07-23 | Leo Pharma A/S | IL-1 receptor accessory protein-inhibiting antibodies and antigen-binding fragments thereof |
| WO2024062074A1 (en) | 2022-09-21 | 2024-03-28 | Sanofi Biotechnology | Humanized anti-il-1r3 antibody and methods of use |
| US12054552B2 (en) | 2022-09-21 | 2024-08-06 | Sanofi Biotechnology | Humanized anti-IL-1R3 antibody and methods of use |
| CN116284401A (zh) * | 2023-02-20 | 2023-06-23 | 中国人民解放军军事科学院军事医学研究院 | 人源抗il-1r3抗体及其应用 |
| WO2024231251A1 (en) | 2023-05-05 | 2024-11-14 | Cantargia Ab | Anti-il1rap antibodies |
| WO2026022232A1 (en) | 2024-07-24 | 2026-01-29 | Almirall, S.A. | Il-1rap inhibitor for treating or preventing hidradenitis suppurativa |
Also Published As
| Publication number | Publication date |
|---|---|
| MX2023007611A (es) | 2023-07-12 |
| CA3202942A1 (en) | 2022-06-30 |
| IL303922A (en) | 2023-08-01 |
| US12043666B2 (en) | 2024-07-23 |
| KR20230123962A (ko) | 2023-08-24 |
| AU2021405730A1 (en) | 2023-07-06 |
| AU2021405730A9 (en) | 2025-03-20 |
| JP2024500920A (ja) | 2024-01-10 |
| US11479610B2 (en) | 2022-10-25 |
| US20230108007A1 (en) | 2023-04-06 |
| US20220242950A1 (en) | 2022-08-04 |
| EP4267625A1 (en) | 2023-11-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12043666B2 (en) | Anti-IL1RAP antibody | |
| US12398213B2 (en) | Methods of treating IL1RAP associated cancers with anti human interleukin-1 receptor accessory protein (IL1 RAP) antibodies | |
| TWI853077B (zh) | 新型抗cd39抗體 | |
| US10562971B2 (en) | Method of detection of IL1RAP on cells expressing the protein | |
| JP2021526022A (ja) | 抗インターロイキン17a抗体、医薬組成物、およびその使用 | |
| JP6931750B2 (ja) | 抗il−17a/f抗体を用いた治療方法 | |
| JP2020501531A (ja) | 新規抗cd137抗体およびその使用 | |
| JP2019502380A (ja) | TNF−α、IL−17A及びIL−17Fに特異性を有する多重特異性抗体分子 | |
| JP2019162119A (ja) | Il−17cに対する抗体 | |
| KR20230166120A (ko) | 새로운 tnfr2 결합 분자 | |
| JP2020508074A (ja) | Cxcr2抗体及びその使用 | |
| JP2022522815A (ja) | Tsg-6抗体およびその用途 | |
| CN116724055A (zh) | 抗il1rap抗体 | |
| KR20260007604A (ko) | 항-il1rap 항체 | |
| WO2021164722A1 (zh) | 抗il-2抗体、其抗原结合片段及其医药用途 | |
| TWI833227B (zh) | 靶向pd-l1和cd73的特異性結合蛋白及其應用 | |
| CN116490519A (zh) | 多特异性免疫靶向分子及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21844985 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3202942 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202180085996.9 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023538679 Country of ref document: JP Ref document number: MX/A/2023/007611 Country of ref document: MX |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023012655 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2021405730 Country of ref document: AU Date of ref document: 20211222 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021844985 Country of ref document: EP Effective date: 20230724 |
|
| ENP | Entry into the national phase |
Ref document number: 112023012655 Country of ref document: BR Kind code of ref document: A2 Effective date: 20230622 |