WO2022115715A1 - Compositions and methods for selective depletion of target molecules - Google Patents
Compositions and methods for selective depletion of target molecules Download PDFInfo
- Publication number
- WO2022115715A1 WO2022115715A1 PCT/US2021/061035 US2021061035W WO2022115715A1 WO 2022115715 A1 WO2022115715 A1 WO 2022115715A1 US 2021061035 W US2021061035 W US 2021061035W WO 2022115715 A1 WO2022115715 A1 WO 2022115715A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- peptide
- binding
- target
- receptor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70582—CD71
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/79—Transferrins, e.g. lactoferrins, ovotransferrins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- soluble and cell surface proteins are indicated in a variety of human diseases, ranging from neurodegenerative diseases to cancer. Furthermore, numerous diseases are associated with mutations in soluble or cell surface proteins resulting in constitutive activity, resistance to treatment, or dominant negative activity. However, many of these proteins have been deemed “undruggable,” “difficult to drug,” or “yet to be drugged” targets due to challenges in targeting them with small molecule therapeutics. For example, in the neurodegenerative Alzheimer’s disease, the amyloid protein which accumulates to form plaques in the brain as a marked aspect of the disease lacks therapeutic agents that target the protein despite its critical role in neurodegeneration. There is a need for compositions and methods to target and selectively deplete soluble and cell surface proteins associated with disease.
- the present disclosure provides a peptide complex comprising: a cellular receptor-binding peptide; and a target-binding peptide complexed with the cellular receptor-binding peptide, wherein (i) the target-binding peptide is engineered to have an affinity for a target that is lower in an endosome than in an extracellular environment, (ii) the cellular receptor-binding peptide is engineered to have an affinity for a cellular receptor is lower in an endosome than in an extracellular environment, or both (i) and (ii).
- the affinity of the target-binding peptide for the target, the affinity of the cellular receptor binding peptide for the cellular receptor, or both is pH dependent. In some aspects, the affinity of the target-binding peptide for the target, the affinity of the cellular receptor-binding peptide for the cellular receptor, or both is ionic strength dependent.
- the present disclosure provides a peptide complex comprising: a cellular receptor binding peptide; and a target-binding peptide complexed with the cellular receptor-binding peptide, wherein (i) an affinity of the target-binding peptide for a target is pH dependent, (ii) an affinity of the cellular receptor-binding peptide for a cellular receptor is pH dependent, or both (i) and (ii).
- the cellular receptor-binding peptide is a transferrin receptor-binding peptide or a PD-L1 -binding peptide. In some aspects, the cellular receptor-binding peptide is a transferrin receptor-binding peptide. In some aspects, the cellular receptor-binding peptide is a PD-Ll-binding peptide. In some aspects, the cellular receptor is a transferrin receptor or PD-L1. In some aspects, the cellular receptor is a transferrin receptor. In some aspects, the cellular receptor is PD-L1.
- the cellular receptor-binding peptide binds to the cellular receptor at a pH of from pH 4.5 to pH 7.4, from pH 5.5 to pH 7.4, or from pH 6.5 to pH 7.4.
- the cellular receptor-binding peptide is capable of binding the cellular receptor with a dissociation constant (KD) of no more than 100 nM, no more than 20 nM, no more than 10 nM, no more than 5 nM, no more than 2 nM, no more than 1 nM, no more than 0.5 nM, no more than 0.4 nM, no more than 0.3 nM, no more than 0.2 nM, or no more than 0.1 nM at pH 7.4.
- KD dissociation constant
- the cellular receptor-binding peptide is capable of binding the cellular receptor with a dissociation constant (KD) of no more than 100 nM, no more than 20 nM, no more than 10 nM, no more than 5 nM, no more than 2 nM, no more than 1 nM, no more than 0.5 nM, no more than 0.4 nM, no more than 0.3 nM, no more than 0.2 nM, or no more than 0.1 nM at pH 5.5.
- KD dissociation constant
- the affinity of the cellular receptor for the cellular receptor is pH-independent.
- the affinity of the cellular receptor-binding peptide for the cellular receptor at pH 7.4 and at pH 5.5 differs by no more than 2-fold, no more than 5-fold, no more than 10-fold, no more than 15-fold, no more than 20-fold, no more than 25-fold, no more than 30-fold, no more than 40-fold, or no more than 50-fold.
- the affinity of the cellular receptor-binding peptide for the cellular receptor is pH dependent. In some aspects, the affinity of the cellular receptor-binding peptide for the cellular receptor decreases as pH decreases. In some aspects, the affinity of the cellular receptor-binding peptide for the cellular receptor is higher at pH 7.4 than at pH 5.5.
- the affinity of the target-binding peptide for the target is pH dependent. In some aspects, the affinity of the target-binding peptide for the target decreases as pH decreases. In some aspects, the affinity of the target-binding peptide for the target is higher at a higher pH than at a lower pH. In some aspects, the higher pH is pH 7.4, pH 7.2, pH 7.0, or pH 6.8. In some aspects, the lower pH is pH 6.5, pH 6.0, pH 5.5, pH 5.0, or pH 4.5. In some aspects, the affinity of the target-binding peptide for the target is higher at pH 7.4 than at pH 6.0.
- the affinity of the target-binding peptide for the target is higher at pH 7.4 than at pH 5.5.
- the target-binding peptide is capable of binding the target molecule with a dissociation constant (KD) of no more than 100 nM, no more than 20 nM, no more than 10 nM, no more than 5 nM, no more than 2 nM, no more than 1 nM, no more than 0.5 nM, no more than 0.4 nM, no more than 0.3 nM, no more than 0.2 nM, no more than 1 nM, or no more than 0.1 nM at pH 7.4.
- KD dissociation constant
- the target-binding peptide is capable of binding the target molecule with a dissociation constant (KD) of no less than 1 nM, no less than 2 nM, no less than 5 nM, no less than 10 nM, no less than 20 nM, no less than 50 nM, no less than 100 nM, no less than 200 nM, or no less than 500 nM at pH 5.5.
- KD dissociation constant
- the affinity of the target binding peptide for the target at pH 7.4 is at least 2-fold, at least 3-fold, at least 4-fold, at least 5- fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 15- fold, or at least 20-fold greater than the affinity of the target binding peptide for the target at pH 5.5.
- the target-binding peptide comprises one or more histidine amino acid residues.
- the affinity of the target-binding peptide for the target decreases as ionic strength increases.
- the target-binding peptide comprises one or more polar or charged amino acid residues capable of forming polar or charge-charge interactions with the target molecule.
- the cellular receptor-binding peptide is conjugated to the target binding peptide.
- the cellular receptor-binding peptide and the target binding peptide form a single polypeptide chain.
- the peptide complex comprises a dimer dimerized via a dimerization domain.
- the dimerization domain comprises an Fc domain.
- the dimer is a homodimer dimerized via a homodimerization domain.
- the homodimerization domain comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 245 - SEQ ID NO: 259.
- the dimer is a heterodimer dimerized via a first heterodimerization domain and a second heterodimerization domain.
- the first heterodimerization domain comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 260, SEQ ID NO: 262, SEQ ID NO: 264, SEQ ID NO: 266, SEQ ID NO: 268, SEQ ID NO: 270, SEQ ID NO: 272, SEQ ID NO: 274, SEQ ID NO: 276, SEQ ID NO: 278, SEQ ID NO: 280, SEQ ID NO: 282, SEQ ID NO: 284, or SEQ ID NO: 286.
- the second heterodimerization domain comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 261, SEQ ID NO:
- the target-binding peptide is linked to the dimerization domain via a peptide linker.
- the cellular receptor-binding peptide is linked to the dimerization domain via a peptide linker.
- the cellular receptor-binding peptide is linked to the target binding peptide via a peptide linker.
- the peptide linker has a length of from 1 to 50 amino acid residues, from 2 to 40 amino acid residues, from 3 to 20 amino acid residues, or from 3 to 10 amino acid residues.
- the peptide linker comprises glycine and serine amino acids.
- the peptide linker has a persistence length of no more than 6 A, no more than 8 A, no more than 10 A, no more than 12 A, no more than 15 A, no more than 20 A, no more than 25 A, no more than 30 A, no more than 40 A, or no more than 50 A.
- the peptide linker is derived from an immunoglobulin peptide.
- the peptide linker is derived from a double-knot toxin peptide.
- the peptide linker comprises a sequence of any one of SEQ ID NO: 129 - SEQ ID NO: 141,
- the cellular receptor-binding peptide, the target-binding peptide, or both comprises a miniprotein, a nanobody, an antibody, an antibody fragment, an scFv, a DARPin, or an affibody.
- the antibody comprises an IgG, or wherein the antibody fragment comprises a Fab, a F(ab)2, an scFv, or an (scFv)2.
- the miniprotein comprises a cystine-dense peptide, an affitin, an adnectin, an avimer, a Kunitz domain, a nanofittin, a fynomer, a bicyclic peptide, a beta-hairpin, or a stapled peptide.
- the cellular receptor-binding peptide comprises at least one disulfide bond, at least two disulfide bonds, at least three disulfide bonds, or at least four disulfide bonds.
- the target-binding peptide comprises at least one disulfide bond, at least two disulfide bonds, at least three disulfide bonds, or at least four disulfide bonds.
- the cellular receptor-binding peptide comprises at least six cysteine residues. In some aspects, the at least six cysteine residues are positioned at amino acid positions 4, 8, 18, 32, 42, and 46 of the cellular receptor-binding peptide. In some aspects, the at least six cysteine residues form at least three disulfide bonds.
- the cellular receptor-binding peptide comprises a sequence of any one of SEQ ID NO: 148 - SEQ ID NO: 177. In some aspects, the cellular receptor-binding peptide comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64, or at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with a fragment of any one of SEQ ID NO:
- the cellular receptor binding peptide comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ ID NO: 96, or at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with a fragment of SEQ ID NO: 96.
- the cellular receptor-binding peptide comprises a sequence of SEQ ID NO: 96.
- the cellular receptor-binding peptide comprises a sequence of any one of SEQ ID NO: 392 - SEQ ID NO: 399. In some aspects, the cellular receptor-binding peptide comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 187, SEQ ID NO: 233 - SEQ ID NO: 239, SEQ ID NO: 400 - SEQ ID NO: 456, or SEQ ID NO: 241, or at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with a fragment of any one of SEQ ID NO: 187, SEQ ID NO: 233 - SEQ ID NO: 239, SEQ ID NO: 400 -
- the cellular receptor-binding peptide comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ ID NO: 187, SEQ ID NO: 235, SEQ ID NO: 236, SEQ ID NO: 238, SEQ ID NO: 239, SEQ ID NO: 400, or SEQ ID NO: 401 or at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with a fragment of SEQ ID NO: 187, SEQ ID NO: 235, SEQ ID NO: 236, SEQ ID NO: 238, SEQ ID NO: 239, SEQ ID NO: 400, or SEQ ID NO: 401.
- the cellular receptor-binding peptide comprises a sequence of SEQ ID NO: 187, SEQ ID NO: 235, SEQ ID NO: 236, SEQ ID NO: 238, SEQ ID NO: 239, SEQ ID NO: 400, or SEQ ID NO: 401.
- the fragment comprises at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 31, at least 32, at least 33, at least 34, at least 35, at least 36, at least 37, at least 38, at least 39, at least 40, at least 41, at least 42, at least 43, at least 44, at least 45, at least 46, at least 47, at least 48, at least 49, or at least 50 amino acid residues.
- the cellular receptor-binding peptide comprises one or more histidine residues at a cellular receptor-binding interface.
- the target-binding peptide comprises one or more histidine residues at a target-binding interface.
- the target-binding peptide is a PD-L1 -binding peptide, an EGFR-binding peptide, or a TNFa- binding peptide.
- the PD-L1 -binding peptide comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 233,
- the EGFR-binding peptide binds EGFR variant III or tyrosine kinase inhibitor-resistant EGFR.
- the EGFR-binding peptide comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ ID NO: 243, SEQ ID NO: 244, SEQ ID NO: 219, or SEQ ID NO: 242.
- the EGFR-binding peptide comprises a sequence of SEQ ID NO: 242.
- the EGFR-binding peptide comprises a sequence of SEQ ID NO: 243.
- the target is a cell surface molecule, a growth factor receptor, secreted peptide, a secreted protein, a circulated molecule, a cell signaling molecule, an extracellular matrix macromolecule, a neurotransmitter, a cytokine, a growth factor, a tumor associated antigen, a tumor specific antigen or a hormone, a checkpoint inhibitor, an immune checkpoint inhibitor, an inhibitory immune receptor, a ligand of an inhibitory immune receptor, a macrophage surface protein, a lipopolysaccharide, an antibody, an inhibitory immune receptor, a tumor associated antigen, a tumor specific antigen, or an autoantibody.
- the target is collagen, elastin, a microfibrillar protein, a proteoglycan, CD200R, CD300a, CD300f, CEACAM1, FcgRiib, ILT-2, ILT-3, ILT-4, ILT-5, LAIR-1, PECAM-1, PILR-alpha, SIRL-1, and SIRP-alpha, CLEC4A, Ly49Q, MIC, CD3, CD47, CD28, CD 137, CD89, CD 14, CD 16, CD29, CD44, CD71, CD73, CD90, CD105, CD166, CD27, CD39, CD24, CD25, CD74,
- CD40L MUC1, MUC16, MUC2, MUC5AC, MUC4, 0X40, 4-1BB, HLA-G, LAG3, Tim3, TIGIT, GITR, TCR, TNF-a, EGFR, EGFRvIII, TKI-resistant EGFR, HER2, ERBB3, PDGFR, FGF, VEGF, VEGFR, IGFR1, CTLA4, STROl, complement factor C4, complement factor Clq, complement factor Cls, complement factor Clr, complement factor C3, complement factor C3a, complement factor C3b, complement factor C5, complement factor C5a, TGF[:S, PCSK9, P2Y6, HER3, RANK, tau, amyloid B, huntingtin, a-synuclein, glucocerebrosidase, a-glucosidase, IL-1, IL-IR, , IL-1 a, IL-Ib, IL-2, IL-2R, IL-4, IL-5
- the peptide complex comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 288 - SEQ ID NO: 313 or SEQ ID NO: 315 - SEQ ID NO: 346; or at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 347, SEQ ID NO: 348, SEQ ID NO: 351, SEQ ID NO: 352, SEQ ID NO: 355, SEQ ID NO: 356, SEQ ID NO: 358, SEQ ID NO: 359, SEQ ID NO:
- the peptide complex comprises a sequence of: SEQ ID NO: 288, SEQ ID NO: 289, SEQ ID NO: 307, SEQ ID NO: 313, SEQ ID NO: 327, SEQ ID NO: 328, SEQ ID NO: 332, SEQ ID NO: 333, SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 342, or SEQ ID NO: 343; SEQ ID NO: 292, SEQ ID NO: 293, SEQ ID NO: 310, SEQ ID NO: 315, or SEQ ID NO: 316 heterodimerized with SEQ ID NO: 302, SEQ ID NO: 305, SEQ ID NO: 339, SEQ ID NO: 340, SEQ ID NO: 344, or SEQ ID NO: 345; SEQ ID NO: 296 heterodimerized with SEQ ID NO: 302, SEQ ID NO: 339,
- the peptide complex comprises a sequence of: SEQ ID NO: 290, SEQ ID NO: 291, SEQ ID NO: 308, SEQ
- SEQ ID NO: 306 SEQ ID NO: 319, SEQ ID NO: 320, SEQ ID NO: 321, SEQ ID NO: 324, or SEQ
- an off rate of the cellular receptor-binding peptide from the cellular receptor is slower than a recycling rate of the cellular receptor. In some aspects, an off rate of the cellular receptor-binding peptide from the cellular receptor is no faster than 1 minute, no faster than 2 minutes, no faster than 3 minutes, no faster than 4 minutes, no faster than 5 minutes, no faster than 7 minutes, no faster than 10 minutes, no faster than 15 minutes, or no faster than 20 minutes.
- the peptide complex is capable of being endocytosed via receptor-mediated endocytosis. In some aspects, the receptor-mediated endocytosis is transferrin receptor-mediated endocytosis.
- the cellular receptor-binding peptide remains bound to the cellular receptor inside an endocytic vesicle.
- the peptide complex is recycled when the cellular receptor-binding peptide is bound to the cellular receptor and the cellular receptor is recycled.
- the target is released or dissociated from the target-binding peptide when the peptide complex is endocytosed via receptor-mediated endocytosis.
- the target is an extracellular protein, a circulating protein, or a soluble protein.
- the target is a cell surface protein.
- the target is a transmembrane protein.
- the peptide complex further comprises a second target binding peptide.
- the second target-binding peptide binds a second target.
- the target and the second target form a dimer when bound to the target-binding peptide and the second target binding peptide.
- dimerization of the target and the second target increases a rate of endocytosis of the target and the second target.
- the second target is the same as the target.
- the peptide complex further comprises a half-life modifying agent coupled to the cellular receptor-binding peptide, the target-binding peptide, or both.
- the half-life modifying agent is a polymer, a polyethylene glycol (PEG), a hydroxyethyl starch, polyvinyl alcohol, a water soluble polymer, a zwitterionic water soluble polymer, a water soluble poly(amino acid), a water soluble polymer of proline, alanine and serine, a water soluble polymer containing glycine, glutamic acid, and serine, an Fc region, a fatty acid, palmitic acid, or a molecule that binds to albumin.
- PEG polyethylene glycol
- a hydroxyethyl starch polyvinyl alcohol
- a water soluble polymer a zwitterionic water soluble polymer
- a water soluble poly(amino acid) a water soluble polymer of
- the molecule that binds to albumin is a serum albumin-binding peptide.
- the serum albumin-binding peptide comprises a sequence of any one of SEQ ID NO: 178, SEQ ID NO: 179, or SEQ ID NO: 193.
- the cellular receptor-binding peptide, the target-binding peptide, or both is recombinantly expressed.
- the target-binding peptide is configured to dissociate from the target at pH 6.5, pH 6.0, pH 5.5, pH 5.0, or pH 4.5.
- the cellular receptor-binding peptide is configured to dissociate from the cellular receptor at pH 6.5, pH 6.0, pH 5.5, pH 5.0, or pH 4.5.
- the present disclosure provides a method of selectively depleting a target molecule, the method comprising: contacting a peptide complex comprising a cellular receptor-binding peptide a target-binding peptide complexed with the cellular receptor-binding peptide to a cell expressing a cellular receptor; binding the target-binding peptide to the target molecule under extracellular conditions; binding the cellular receptor-binding peptide to the cellular receptor under extracellular conditions; endocytosing the peptide complex, the target molecule, and the cellular receptor; unbinding the target-binding peptide from the target molecule, the cellular-receptor-binding peptide from the cellular receptor, or both under endosomal conditions; and degrading the target molecule, thereby depleting the target molecule.
- the present disclosure provides a method of selectively depleting a target molecule, the method comprising: contacting a peptide complex as described herein to a cell expressing a cellular receptor; binding the target-binding peptide to the target molecule under extracellular conditions; binding the cellular receptor-binding peptide to the cellular receptor under extracellular conditions; endocytosing the peptide complex, the target molecule, and the cellular receptor into an endocytic or lysosomal compartment; releasing the target binding peptide from the target molecule, the cellular-receptor-binding peptide from the cellular receptor, or both under endosomal conditions; and degrading the target molecule, thereby depleting the target molecule.
- the method further comprises recycling the peptide complex and the cellular receptor.
- the cellular receptor is a transferrin receptor or PD-L1 and the cellular receptor-binding peptide is a transferrin receptor-binding peptide or a PD-Ll-binding peptide.
- the cellular receptor-binding peptide is a transferrin receptor-binding peptide and the cellular receptor is a transferrin receptor.
- the cellular receptor binding peptide is a PD-Ll-binding peptide and the cellular receptor is PD-L1.
- the endocytosing comprises receptor-mediated endocytosis.
- the cellular receptor-binding peptide remains bound to the cellular receptor in the endocytic or lysosomal compartment.
- the target molecule is degraded in the endocytic or lysosomal compartment.
- the receptor-mediated endocytosis is transferrin receptor- mediated endocytosis.
- the target molecule is an extracellular protein, a circulating protein, or a soluble protein.
- the target molecule is a cell surface protein.
- the target molecule is a transmembrane protein.
- the method comprises penetrating a cellular layer comprising a blood brain barrier (BBB) with the peptide complex.
- BBB blood brain barrier
- the target molecule is degraded in the central nervous system.
- the cell expresses the cellular receptor.
- the method comprises binding the cellular receptor-binding peptide to the cellular receptor with a dissociation constant (KD) of no more than 50 mM, no more than 5 pM, no more than 500 nM, no more than 100 nM, no more than 40 nM, no more than 30 nM, no more than 20 nM, no more than 10 nM, no more than 5 nM, no more than 2 nM, no more than 1 nM, no more than 0.5 nM, no more than 0.4 nM, no more than 0.3 nM, no more than 0.2 nM, or no more than 0.1 nM under the extracellular conditions.
- KD dissociation constant
- the method comprises binding the cellular receptor-binding peptide to the cellular receptor with a dissociation constant (KD) of no more than 50 pM, no more than 5 pM, no more than 500 nM, no more than 100 nM, no more than 40 nM, no more than 30 nM, no more than 20 nM, no more than 10 nM, no more than 5 nM, no more than 2 nM, no more than 1 nM, no more than 0.5 nM, no more than 0.4 nM, no more than 0.3 nM, no more than 0.2 nM, or no more than 0.1 nM under the endosomal conditions.
- KD dissociation constant
- the target-binding peptide remains bound to the target molecule in the endocytic compartment.
- the method comprises binding the target-binding peptide to the target molecule with a dissociation constant (KD) of no more than 50 pM, no more than 5 pM, no more than 500 nM, no more than 100 nM, no more than 40 nM, no more than 30 nM, no more than 20 nM, no more than 10 nM, no more than 5 nM, no more than 2 nM, no more than 1 nM, no more than 0.5 nM, no more than 0.4 nM, no more than 0.3 nM, no more than 0.2 nM, or no more than 0.1 nM under the extracellular conditions.
- KD dissociation constant
- the method comprises binding the target-binding peptide to the target molecule with a dissociation constant (KD) of no less than 1 nM, no less than 2 nM, no less than 5 nM, no less than 10 nM, no less than 20 nM, no less than 50 nM, no less than 100 nM, no less than 200 nM, or no less than 500 nM under the endosomal conditions.
- KD dissociation constant
- the method comprises binding the cellular receptor-binding peptide to the cellular receptor with an affinity that differs by no more than 2-fold, no more than 5-fold, no more than 10-fold, no more than 15-fold, no more than 20-fold, no more than 25-fold, no more than 30-fold, no more than 40-fold, or no more than 50-fold under the extracellular conditions as compared to the endosomal conditions.
- the method comprises forming one or more polar or charge-charge interactions between the target-binding peptide and the target molecule.
- the cellular receptor binding peptide comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64.
- the cellular receptor binding peptide comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ ID NO: 96.
- the cellular receptor-binding peptide comprises a sequence of SEQ ID NO: 96.
- the cellular receptor-binding peptide comprises a sequence of any one of SEQ ID NO: 392 - SEQ ID NO: 399.
- the cellular receptor-binding peptide comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 187, SEQ ID NO: 233 - SEQ ID NO: 239, SEQ ID NO: 400 - SEQ ID NO: 456, or SEQ ID NO: 241, or at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with a fragment of any one of SEQ ID NO: 187, SEQ ID NO: 233 - SEQ ID NO: 239, SEQ ID NO: 400 - SEQ ID NO: 456, or SEQ ID NO: 241.
- the cellular receptor-binding peptide comprises a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ ID NO: 187, SEQ ID NO: 235, SEQ ID NO: 238, or SEQ ID NO: 239 or at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with a fragment of SEQ ID NO: 187, SEQ ID NO: 235, SEQ ID NO: 238, or SEQ ID NO: 239.
- the cellular receptor-binding peptide comprises a sequence of SEQ ID NO: 187, SEQ ID NO: 235, SEQ ID NO: 238, or SEQ ID NO: 239.
- the method further comprises binding a second target molecule with a second target-binding peptide.
- the target molecule and the second target molecule dimerize when bound to the target-binding peptide and the second target-binding peptide.
- the method comprises increasing a rate of endocytosis of the target molecule and the second target molecule upon dimerization of the target molecule and the second target molecule.
- the second target molecule is degraded upon endocytosis of the target molecule and the second target molecule.
- the second target molecule is the same as the target molecule.
- the present disclosure provides a method of treating a disease or condition in a subject, the method comprising: administering to the subject a peptide complex comprising a cellular receptor-binding peptide a target-binding peptide complexed with the cellular receptor-binding peptide; binding the target-binding peptide under extracellular conditions to a target molecule associated with the disease or condition on a cell of the subject expressing the target molecule and a cellular receptor; binding the cellular receptor-binding peptide under extracellular conditions to the cellular receptor on the cell of the subject; endocytosing the peptide complex, the target molecule, and the cellular receptor; unbinding the target-binding peptide from the target molecule, the cellular-receptor-binding peptide from the cellular receptor, or both under endosomal conditions; and degrading the target molecule, thereby treating the disease or condition.
- the present disclosure provides a method of treating a disease or condition in a subject, the method comprising: administering to the subject a peptide complex as described herein; binding the target-binding peptide under extracellular conditions to a target molecule associated with the disease or condition on a cell of the subject expressing the target molecule and a cellular receptor; binding the cellular receptor-binding peptide under extracellular conditions to the cellular receptor on the cell of the subject; endocytosing the peptide complex, the target molecule, and the cellular receptor; unbinding the target-binding peptide from the target molecule, the cellular-receptor-binding peptide from the cellular receptor, or both under endosomal conditions; and degrading the target molecule, thereby treating the disease or condition.
- the target molecule is a cell surface molecule, a growth factor receptor, secreted peptide, a secreted protein, a circulated molecule, a cell signaling molecule, an extracellular matrix macromolecule, a neurotransmitter, a cytokine, a growth factor, a tumor associated antigen, a tumor specific antigen or a hormone, a checkpoint inhibitor, an immune checkpoint inhibitor, an inhibitory immune receptor, a ligand of an inhibitory immune receptor, a macrophage surface protein, a lipopolysaccharide, an antibody, an inhibitory immune receptor, a tumor associated antigen, a tumor specific antigen, or an autoantibody.
- the target molecule is collagen, elastin, a microfibrillar protein, a proteoglycan, CD200R, CD300a, CD300f, CEACAM1, FcgRiib, ILT-2, ILT-3, ILT-4, ILT-5, LAIR-1, PECAM-1, PILR-alpha, SIRL-1, and SIRP-alpha, CLEC4A, Ly49Q, MIC, CD3, CD47, CD28, CD 137, CD89, CD 14,
- the target molecule is a receptor tyrosine kinase.
- the receptor tyrosine kinase is EGF receptor, ErbB, Insulin receptor, PDGF receptor, VEGF receptor, FGF receptor, CCK receptor, NGF receptor, HGF receptor, Eph receptor, AXL receptor, TIE receptor, RYK receptor, DDR receptor, RET receptor, ROS receptor, LTK receptor, ROR receptor, MuSK receptor, or LMR receptor.
- the target molecule is a pathogen or a pathogen surface molecule.
- the disease or condition is a cancer, a neurodegenerative disease, a lysosomal storage disease, an inflammatory disease, an autoimmune disease, a neuroinflammatory disease, an immune disease, or pain.
- the cancer is breast cancer, liver cancer, colon cancer, brain cancer, leukemia, lymphoma, non-Hodgkin lymphoma, myeloma, blood-cell-derived cancer, lung cancer, sarcoma, stomach cancer, a gastrointestinal cancer, glioblastoma, head and neck cancer, non-small -cell lung cancer, squamous non-small cell lung cancer, pancreatic cancer, ovarian cancer, blood cancer, skin cancer, liver cancer, kidney cancer, or colorectal cancer.
- the cancer is TKI-resistant, cetuximab- resistant, necitumumab-resistant, or panitumumab-resistant.
- the cancer is an advanced cancer, a metastatic cancer, a metastatic cancer in the central nervous system, metastatic breast cancer, metastatic skin cancer, a refractory cancer, a KRAS wild type cancer, a KRAS mutant cancer, or an exon20 mutant non-small-cell lung cancer.
- the target molecule is HER2, EGFR, FGFR-1, PD-L1, VEGF, PD-1, CD38, GD2, SLAMF7, CTLA- 4, CCR4, CD20, PDGFRa, VEGFR2, CD33, CD30, CD22, CD79B, Nectin-4, or TROP2.
- the target molecule is EGFR or PD-L1.
- the method further comprises administering an additional therapy to the subject.
- the additional therapy comprises radiation, chemotherapy, platinum therapy, or anti-metabolic therapy.
- the additional therapy comprises fluorouracil, FOLFIRI, irinotecan, FOLFOX, gemcitabine, or cisplatin.
- the neurodegenerative disease is Alzheimer’s disease, amyotrophic lateral sclerosis, Friedreich’s ataxia, Huntington’s disease, Parkinson’s disease, or spinal muscular atrophy.
- the target molecule is tau, amyloid B, huntingtin, or a- synuclein.
- the lysosomal storage disease is Gaucher’s Disease or Pompe Disease.
- the target molecule is glucocerebrosidase or a-glucosidase.
- the inflammatory disease is rheumatoid arthritis, psoriasis, multiple sclerosis, glomerulonephritis, lupus, inflammatory bowel disease, ulcerative colitis, Crohn’s disease, cutaneous vasculitis, neuroinflammatory disease, inflammation-associated neurodegeneration, Alzheimer’s disease, stroke, traumatic brain injury, Sjogren’s disease, or cystic fibrosis.
- the target molecule is apolipoprotein E4, TNF-a, IL-1, IL-6, IL-7, IL-12, or IL-23. In some aspects, the target molecule is TNF-a.
- the cell is a cancer cell, an immune cell, a central nervous system cell, a neuronal cell, a T cell, a B cell, a macrophage, a monocyte, a neutrophil, a dendritic cell, a mast cell, a basophil, or an eosinophil.
- the method further comprises forming a ternary complex between the selective depletion complex, the target molecule, and the cellular receptor.
- formation of the ternary complex increases recycling or turnover of the cellular receptor, the target molecule, or both.
- formation of the ternary complex increases binding of the target molecule to the cellular receptor.
- FIG. 1A - FIG. 1G illustrate a Coomassie stained gel of human soluble transferrin receptor (hTfR) ectodomain protein and flow cytometry plots showing successive enrichment of cells that bind to hTfR ectodomain from a pooled, highly diverse peptide library.
- hTfR human soluble transferrin receptor
- FIG. 1A illustrates a Coomassie stained gel of transferrin receptor (TfR) protein showing successful purification of TfR.
- FIG. IB illustrates a flow cytometry plot of cells displaying candidate TfR-binding peptides after one flow sort. Cells were sorted based on ability to bind to TfR labeled with a fluorescent streptavidin. Data points in the upper right region represent cells expressing a candidate peptide, quantified by GFP fluorescence, that bind TfR, quantified by fluorescence of the fluorescent TfR- streptavidin.
- FIG. 1C illustrates a negative control flow cytometry plot of cells displaying candidate TfR-binding peptides after one flow sort.
- Cells were stained based on ability to bind to a control protein labeled with a fluorescent streptavidin.
- Data points in the upper right region represent cells expressing a candidate peptide, quantified by GFP fluorescence, that bind to the negative control protein, quantified by fluorescence of the fluorescent control protein-streptavidin.
- FIG. ID illustrates a flow cytometry plot of cells displaying candidate TfR-binding peptides after a second flow sort, following the first cell sort illustrated in FIG. IB.
- Cells were sorted based on ability to bind to TfR labeled with a fluorescent streptavidin. Data points in the upper right region represent cells expressing a candidate peptide, quantified by GFP fluorescence, that bind TfR, quantified by fluorescence of the fluorescent TfR-streptavidin.
- FIG. IE illustrates a negative control flow cytometry plot of cells displaying candidate TfR-binding peptides after a second flow sort, following the first cell sort illustrated in FIG. IB and FIG. 1C.
- Cells were stained based on ability to bind to a control protein labeled with a fluorescent streptavidin. Data points in the upper right region represent cells expressing a candidate peptide, quantified by GFP fluorescence, that bind to the negative control protein, quantified by fluorescence of the fluorescent control protein-streptavidin.
- FIG. IF illustrates a flow cytometry plot of cells displaying candidate TfR-binding peptides after a third flow sort, following the second cell sort illustrated in FIG. ID.
- Cells were sorted based on ability to bind to TfR labeled with a fluorescent streptavidin.
- Data points in the upper right region represent cells expressing a candidate peptide, quantified by GFP fluorescence, that bind TfR, quantified by fluorescence of the fluorescent TfR-streptavidin.
- the box indicates cells expressing peptides that bind to TfR.
- FIG. 1G illustrates a negative control flow cytometry plot of cells displaying candidate TfR-binding peptides after a third flow sort, following the second cell sort illustrated in FIG. ID and FIG. IE.
- Cells were stained based on ability to bind to a control protein labeled with a fluorescent streptavidin.
- Data points in the upper right region represent cells expressing a candidate peptide, quantified by GFP fluorescence, that bind to the negative control protein, quantified by fluorescence of the fluorescent control protein-streptavidin.
- the box indicates cells expressing peptides that bind to the negative control protein.
- FIG. 2A - FIG. 2D illustrate flow cytometry of cells displaying a single clonal TfR- binding peptide and screened for binding to either TfR or a negative control protein to confirm binding of the TfR-binding peptide identified in FIG. 1A - FIG. 1G to TfR.
- Flow cytometry was performed using TfR or the control protein labeled with either streptavidin or an anti-His antibody to verify that binding was not dependent on the streptavidin label.
- FIG. 2A illustrates a negative control flow cytometry plot of cells expressing a TfR- binding peptide of SEQ ID NO: 1 (x-axis, GFP) screened for binding to a negative control protein labeled (y-axis, stained with a fluorescent anti-His antibody).
- FIG. 2B illustrates a flow cytometry plot of cells expressing a TfR-binding peptide of SEQ ID NO: 1 (x-axis, GFP) screened for binding to TfR (y-axis, stained with a fluorescent anti-His antibody). The box indicates cells that express the TfR-binding peptide and bind to TfR.
- FIG. 2C illustrates a negative control flow cytometry plot of cells expressing a TfR- binding peptide of SEQ ID NO: 1 (x-axis, GFP) screened for binding to a negative control protein labeled (y-axis, stained with a fluorescent streptavidin).
- FIG. 1 illustrates a flow cytometry plot of cells expressing a TfR-binding peptide of SEQ ID NO: 1 (x-axis, GFP) screened for binding to a negative control protein labeled (y-axis, stained with a fluorescent streptavidin).
- FIG. 2D illustrates a flow cytometry plot of cells expressing a TfR-binding peptide of SEQ ID NO: 1 (x-axis, GFP) screened for binding to TfR (y-axis, stained with a fluorescent streptavidin). The box indicates cells that express the TfR-binding peptide and bind to TfR.
- FIG. 3A and FIG. 3B illustrate TfR-binding for peptide variants arising from permuting enriched variants from site-saturation mutagenesis (SSM).
- SSM site-saturation mutagenesis
- Each graph represents a round of completed SSM and each shaded bar within the applicable graph indicates the number of mutations in the specific variant peptide denoted under the bar as compared to the respective reference peptide sequence with which the round of SSM was started (SEQ ID NO: 1 in FIG. 3A, or SEQ ID NO: 2 in FIG. 3B).
- the data show the relative binding affinity of the identified peptides to TfR, representing the last step of SSM employed showing the next generation molecules.
- FIG. 3A illustrates the level of hTfR binding for variants comprising sequences of SEQ ID NO: 3 - SEQ ID NO: 23, derived from a site- saturation mutagenesis (SSM) for affinity maturation of the peptide having a sequence of SEQ ID NO: 1.
- SSM site- saturation mutagenesis
- FIG. 3B illustrates the level of hTfR binding for peptide variants having sequences of SEQ ID NO: 24 - SEQ ID NO: 28 and SEQ ID NO: 30 - SEQ ID NO: 32, derived from a site- saturation mutagenesis (SSM) for affinity maturation of the starting peptide having a sequence of SEQ ID NO: 2.
- SSM site- saturation mutagenesis
- FIG. 4 illustrates surface plasmon resonance (SPR) curves showing binding of TfR- binding peptide variants with different affinities to TfR. Dissociation kinetics were quantified for each peptide variant.
- the surface plasmon resonance (SPR) trace over time is shown using 300 nM of each of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 4, and SEQ ID NO: 32 to hTfR.
- SEQ ID NO: 32 show the strongest binding to TfR, as evaluated by SPR. Data was normalized to the maximum response of each trace.
- FIG. 5 illustrates a surface plasmon resonance (SPR) trace showing hTfR-binding for varying concentrations of the peptide having a sequence of SEQ ID NO: 2. Based on this data, the dissociation constant (KD) of the peptide of SEQ ID NO: 2 was determined to be 8.7 nM.
- FIG. 6 illustrates a surface plasmon resonance (SPR) trace showing hTfR-binding for varying concentrations of the peptide having a sequence of SEQ ID NO: 4. Based on this data, the dissociation constant (KD) of the peptide of SEQ ID NO: 4 was determined to be 14.8 nM. [0058] FIG.
- FIG. 7 illustrates binding and single cycle kinetics data of SEQ ID NO: 32 binding to captured biotinylated hTfR by surface plasmon resonance (SPR).
- 5 concentrations of a peptide having a sequence of SEQ ID NO: 32 (0.037 nM, 0.11 nM, 0.33 nM, 1 nM, 3 nM) were injected over 2 densities of captured biotinylated (Bt)-hTfR and analyzed globally. Analysis parameters were held constant for high and low density runs, and data from both channels was included in the same analysis.
- the dissociation constant (K D ) of the peptide of SEQ ID NO: 32 was determined to be 216 pM
- the association rate (k a ) was determined to be 8.55 x 10 6 M ' V 1
- the dissociation rate (k d ) was determined to be 1.85 x 10 '3 s '1 .
- FIG. 8 illustrates binding and single cycle kinetics data of SEQ ID NO: 30 binding to captured biotinylated hTfR by SPR.
- 5 concentrations of a peptide having a sequence of SEQ ID NO: 30 (0.037 nM, 0.11 nM, 0.33 nM, 1 nM, 3 nM) were injected over 2 densities of captured Bt-hTfR and analyzed globally. Analysis parameters were held constant for high and low density runs, and data from both channels was included in the same analysis.
- the dissociation constant (K D ) of the peptide of SEQ ID NO: 30 was determined to be 486 pM
- the association rate (k a ) was determined to be 8.57 x 10 6 M ' V 1
- the dissociation rate (k d ) was determined to be 4.16 x 10 '3 s '1 .
- FIG. 9A - FIG. 9C illustrate the purification and testing of a soluble transferrin receptor (TfR) ectodomain to assess whether it will bind to transferrin.
- TfR soluble transferrin receptor
- FIG. 9A illustrates a surface plasmon resonance (SPR) trace of holo or apo transferrin (Tf) binding to the purified TfR ectodomain.
- SPR surface plasmon resonance
- Tf holo transferrin
- the data shows that holo Tf binds the TfR ectodomain, but apo Tf does not, as shown by the increase in response (RU) over time for the holo Tf, but not the apo Tf.
- This data validates that the soluble TfR used in the screen for TfR- Binding CDP peptides comprises the endogenous protein structure of TfR on the surface of the cell providing data that the binders have utility for receptor mediated endocytosis.
- FIG. 9B illustrates a schematic of a vector display scaffold and target engagement used to screen for and optimize peptide binding properties.
- the surface display vector (SDGF) encoding a GFP -tagged construct of the binder (e.g., SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 32) is expressed on the cell surface.
- a target protein e.g., TfR
- a fluorescent dye (“Co-Stain”) bind to the surface-expressed binder.
- Fluorescence intensity of the co-stain is used as a measure of peptide affinity for the target since cells expressing a peptide with a high affinity for the target protein will recruit more co-stained target than cells expressing a peptide with lower affinity for the target protein.
- FIG. 9C illustrates flow cytometry to verify specificity of TfR binding for Machupo virus glycoprotein, a known TfR binding target, as measured by the amount of Alexa Fluor 647- TfR (co-stain in FIG. 9B) bound.
- SDGF-A Machupo virus glycoprotein
- FIG. 10A - FIG. IOC show data using flow cytometry to identify the binding of a TfR- binding cystine-dense peptide (CDP, SEQ ID NO: 32) fused with GFP to TfR labeled with streptavidin-AlexaFluor647 (strep-647) under pH conditions representing the physiologic extracellular environment (pH 7.4) or the endosomal environment (pH 5.5).
- CDP cystine-dense peptide
- FIG. 10A illustrates flow cytometry results in a binding assay to measure binding of a TfR-binding cystine-dense peptide (CDP) (SEQ ID NO: 32) to TfR at pH 7.4, representing the physiologic extracellular environment.
- CDP cystine-dense peptide
- FIG. 10B illustrates flow cytometry results in a binding assay to measure binding of a TfR-binding CDP (SEQ ID NO: 32) to TfR at pH 5.5.
- Cells expressing SEQ ID NO: 32 were stained with 10 nM of TfR and 10 nM Strep-647 at pH 5.5, representing the endosomal environment.
- the box indicates the “slice” gate used in the quantitation shown in FIG. IOC.
- FIG. IOC illustrates a comparison of the labeling efficiency of the TfR-binding peptide at pH 7.4 measured in FIG. 10A and the labeling efficiency at pH 5.5 measured in FIG. 10B.
- the results show that the binding of the TfR-binding cystine-dense peptide (CDP, SEQ ID NO: 32) is robust and comparable both at physiologic extracellular and endosomal conditions.
- CDP cystine-dense peptide
- FIG. 11A schematically illustrates a workflow for developing compositions for selective depletion of a target molecule.
- Target-binding peptides are identified by staining an expression library containing target-binding peptide candidates with labeled target molecule.
- Targetbinding peptides from the library are distinguished by accumulation of signal from bound target molecules.
- identified target-binding peptides are selected and further matured for binding, for example using point mutation screens.
- the identified target-binding peptides are modified for pH-dependent binding, for example by performing histidine point mutation scans as illustrated in FIG. 11D.
- FIG. 11B schematically illustrates in vitro validation of the ability of the selective depletion complex to deplete the target, such as from the cell surface or the media.
- FIG. llC schematically illustrates phenotypic screening of selective depletion complexes.
- the selective depletion complexes can be validated by testing target depletion in cells expressing the selective depletion complexes. Complexes can be further tested in healthy cells and in transformed cell lines to measure disease-specific functionalities of the selective depletion complexes. Specificity of the complexes can be measured by testing for changes in a target-specific cellular function, such as cancer-specific growth inhibition upon depletion of an apoptosis inhibitor.
- FIG. 11D illustrates an example of a histidine substitution scan to introduce pH- dependent binding affinity into a target-binding peptide.
- a histidine substitution scan of a PD- Ll-binding CDP (SEQ ID NO: 187) is shown.
- the peptide sequence is provided above and to the side, and each black box represents a first and second site in which His could be substituted. Those falling along the diagonal from the top-left to the bottom-right represent single His substitutions.
- a peptide library containing the identified histidine-containing peptides may be generated and screened, for example using the workflow shown in FIG. 11 A.
- FIG. 12A schematically illustrates a method for selectively depleting a soluble target molecule using a composition comprising a target-binding peptide with pH-dependent binding and a TfR-binding peptide, such as a TfR-binding peptide with pH-independent binding.
- the composition binds to TfR and to the soluble target molecule and is endocytosed via transferrin receptor-mediated endocytosis.
- the target molecule is released upon acidification of the endocytic compartment and some or all of the target molecule is degraded in a lysosomal compartment.
- the TfR and the composition are recycled to the cell surface.
- FIG. 12B schematically illustrates a method for selectively depleting a surface target molecule using a composition comprising a target-binding peptide with pH-dependent binding and a TfR-binding peptide, such as a TfR-binding peptide with pH-independent binding.
- the composition binds to TfR and to the surface target molecule and is endocytosed via transferrin receptor-mediated endocytosis.
- the target molecule is released upon acidification of the endocytic compartment and some or all of the target molecule is degraded in a lysosomal compartment.
- the TfR and the composition are recycled to the cell surface.
- FIG. 13A and FIG. 13B illustrate the production and purity of peptides fused to a serum albumin-binding peptide (SA21).
- FIG. 13A shows production and purity of a TfR-binding peptide fused to a serum albumin-binding peptide (SA21) corresponding to SEQ ID NO: 181.
- the peptide of SEQ ID NO: 181 was produced as a siderocalin (SCN, SEQ ID NO: 147) fusion, and then cleaved from SCN by TEV. Purity was verified by SDS-PAGE (left) and RP-HPLC (right) under DTT reducing (“R”) or non-reducing (“NR”) conditions.
- SDS-PAGE was also run on the uncleaved (“U”) siderocalin-CDP fusion peptide. This data indicates that SEQ ID NO: 181 fused to SCN was successfully produced and then cleaved by TEV cleavage, to yield the free CDP fusion of SEQ ID NO: 181.
- FIG. 13B shows production and purity of a peptide fused to SA21 corresponding to SEQ ID NO: 182.
- the peptide of SEQ ID NO: 182 was produced as a SCN fusion, and then cleaved from SCN by TEV. Purity was verified by SDS-PAGE (left) and RP-HPLC (right) under DTT reducing (“R”) or non-reducing (“NR”) conditions. SDS-PAGE was also run on the uncleaved (“U”) siderocalin-CDP fusion peptide. This data indicates that SEQ ID NO: 182 fused to SCN was successfully produced and then cleaved by TEV cleavage, to yield the free CDP fusion of SEQ ID NO: 182.
- FIG. 14A schematically illustrates a CDP-CDP dimer containing a target-binding CDP linked to a TfR-binding CDP via a double-knot toxin (DkTx) peptide linker (SEQ ID NO: 139, KKYKPYVPVTTN).
- DkTx double-knot toxin
- FIG. 14B schematically illustrates a CDP-CDP dimer containing a target-binding CDP linked to a TfR-binding CDP via a poly-GlySer linker (SEQ ID NO: 138, GGGSGGGSGGGS).
- FIG. 14C schematically illustrates a CDP-CDP dimer containing a target-binding CDP linked to a TfR-binding CDP via a human IgG linker with a Cys-to-Ser mutation at position 5 (SEQ ID NO: 140, EPKSSDKTHT).
- FIG. 15 schematically illustrates a TfR-binding peptide non-covalently linked to a target-binding peptide via an Fc bispecific dimer.
- FIG. 16A schematically illustrates a TfR-binding peptide and target-binding peptide fusion containing an albumin binding protein (e.g., SEQ ID NO: 192) in between the targetbinding peptide and the TfR-binding peptide and separated by peptide linkers (e.g., any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218).
- an albumin binding protein e.g., SEQ ID NO: 192
- FIG. 16B schematically illustrates a TfR-binding peptide and target-binding peptide fusion containing an albumin binding protein (e.g., SEQ ID NO: 192) fused to the target-binding peptide by a peptide linker (e.g., any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218).
- a peptide linker e.g., any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218).
- 16C schematically illustrates a TfR-binding peptide and target-binding peptide fusion containing an albumin binding protein (e.g., SEQ ID NO: 192) fused to the TfR-binding peptide by a peptide linker (e.g., any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218).
- an albumin binding protein e.g., SEQ ID NO: 192
- a peptide linker e.g., any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218,.
- FIG. 17A illustrates SDS-PAGE gels of expressed and TEV-cleaved CDP-CDP dimers containing a TfR-binding peptide (SEQ ID NO: 2) fused to an ion channel inhibitory CDP (Z1E- AnTx, ZIP-AnTx, EWSS-ShK, HsTx, Pro-Vm24, or Vm24) via either a DkTx linker (SEQ ID NO: 139) or a GS3 linker (SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218).
- the expression product after TEV cleavage contained SCN-CDP dimer, SCN, and CDP dimer.
- Each gel contained, from left to right, a molecular weight latter (“L”), the peptide sample under non-reducing conditions (“NR”), and the peptide sample under reducing conditions (“R”).
- L molecular weight latter
- NR non-reducing conditions
- R peptide sample under reducing conditions
- FIG. 17B illustrates SDS-PAGE (left), RP-HPLC (center), and channel inhibition assays (right) for a TfR-binding peptide (SEQ ID NO: 32, top), a Vm24 ion channel inhibitory peptide (middle), and a CDP-CDP dimer containing the TfR-binding peptide fused to the Vm25 ion channel inhibitory peptide (bottom). “Folded” indicates the sample was analyzed under nonreducing conditions and “unfolded” indicates the sample was analyzed under reducing conditions.
- FIG. 18A - FIG. 18D shows flow staining data illustrating that TfR-binding peptides are cross-reactive with murine TfR (mTfR) in cell surface binding assays.
- TfR-binding peptides bind both human (hTfR, SEQ ID NO: 190) and murine TfR.
- FIG. 18A illustrates the species specificity of the TfR used in these experiments, in this case human TfR.
- Data is displayed as two topographical density maps and indicates flow cytometry data of transferrin stained with Anti-hTfR (CD71) antibody.
- the upper density map oriented diagonally from lower left to upper right, depicts 293ST+SDGF-hTfR.
- the lower density map oriented horizontally, depicts 293ST+SDGF-mTfR.
- the y-axis shows hTfR + Streptavidin from 0 to 10 7 , in increments of 10 on a log scale.
- the x-axis shows GFP from 0 to 10 6 , in increments of 10 on a log scale.
- FIG.18B illustrates the species specificity of the TfR used in these experiments, in this case murine TfR.
- Data is displayed as two topographical density maps and indicates flow cytometry data of transferrin stained with Anti-mTfR (CD71) antibody.
- the upper density map oriented diagonally from lower left to upper right, depicts 293ST+SDGF-mTfR.
- the lower density map having three lobes, depicts 293ST+SDGF-hTfR.
- the y-axis shows hTfR + Streptavidin from 10 -4 to 10 7 , in increments of 10 on a log scale.
- the x-axis shows GFP from 0 to 10 6 , in increments of 10 on a log scale.
- FIG.18C illustrates quantification of binding of the peptide having a sequence of SEQ ID NO: 1, the peptide having a sequence of SEQ ID NO: 2, the peptide having a sequence of SEQ ID NO: 30, and the peptide having a sequence of SEQ ID NO: 32 to human TfR.
- Data is displayed as four topographical density maps and indicates flow cytometry data using 293ST cells + SDGF-hTFR. Three density maps appear nearly superimposed and are oriented above a fourth density map. The lower density map is oriented horizontally and depicts SEQ ID NO: 1 (1 st gen). The upper three density maps are oriented diagonally from lower left to upper right.
- the density map slightly above the other two corresponds to SEQ ID NO: 32 (3 rd gen).
- the density map slightly below the other two corresponds to SEQ ID NO: 2 (2 nd gen).
- the third density map corresponds to SEQ ID NO: 30 (3 rd gen).
- FIG.18D illustrates quantification of binding of the peptide having a sequence of SEQ ID NO: 1, the peptide having a sequence of SEQ ID NO: 2, the peptide having a sequence of SEQ ID NO: 30, and the peptide having a sequence of SEQ ID NO: 32 to murine TfR.
- Data is displayed as four topographical density maps and indicates flow cytometry data using 293ST cells + SDGF-mTFR.
- the lower density map is oriented horizontally and depicts SEQ ID NO: 1 (1 st gen).
- the upper three density maps are oriented diagonally from lower left to upper right.
- the density map slightly above the other two corresponds to SEQ ID NO: 32 (3 rd gen).
- the density map slightly below the other two corresponds to SEQ ID NO: 2 (2 nd gen).
- the third density map corresponds to SEQ ID NO: 30 (3 rd gen).
- the y-axis shows hTfR + Streptavidin from 0 to 10 7 , in increments of 10 on a log scale.
- the x- axis shows GFP from 0 to 10 6 , in increments of 10 on a log scale.
- FIG.19A and FIG.19B illustrate CDP-NT peptide complexes which induce an IP1 response downstream of the neurotensin receptor (NTSR) both in CRE-Luciferase (CRE-Luc) mice and in mammalian cells.
- FIG.19A illustrates the relevant pathways influencing CRE-driven luciferase in the CRE-Luc mice.
- PLC denotes phospholipase C.
- AC denotes adenylyl cyclase.
- CaMK denotes calmodulin-dependent protein kinase.
- CREB denotes the cAMP response element binding protein.
- PKA denotes protein kinase A.
- PDE denotes cAMP phosphodiesterase.
- FIG.19B shows FRET data illustrating in vitro neurotensin (NT) receptor engagement showing IP 1 accumulation only in response to NT or NT peptide complexes in HEK-293 cells expressing NTSR1.
- IP1 is measured using an assay kit (CisBio 62IPAPEB) with a readout of FRET ratio.
- Horizontal bar indicates sample mean.
- mTF murine transferrin.
- FIG.20A schematically illustrates mechanisms of resistance to tyrosine kinase inhibitors (TKIs) or anti-EGFR antibody therapies (e.g., cetuximab) in EGFR-driven cancer cells.
- TKIs tyrosine kinase inhibitors
- anti-EGFR antibody therapies e.g., cetuximab
- EGFR- driven cancer cells with normal EGFR panel 1 are sensitive to both anti-EGFR antibodies and tyrosine kinase inhibitors, resulting in reduced downstream KRAS and MEK signaling in response to either treatment (indicated by gray dashed arrows).
- Mutations in EGFR that prevent TKI binding are resistant to TKIs, showing little or no change in downstream signaling in response to TKI treatment (indicated by solid black arrows); TKI-resistant EGFR-driven cancer cells may still be sensitive to anti-EGFR antibodies.
- Heterodimerization with and cross- activation by other related growth factor receptors e.g., HER2, ERBB3, or MET
- render EGFR- driven cancer cells in which the dimerization partner is overexpressed render EGFR- driven cancer cells in which the dimerization partner is overexpressed (panel 3) insensitive to one or both of anti-EGFR antibodies and TKIs.
- FIG.20B schematically illustrates use of selective depletion complexes (SDCs) to overcome resistance mechanisms in EGFR-driven cancer cells. This shows that SDCs can be effective against EGFR-driven cancer, including those cancers or cancer cells with normal EGFR as well as those cancers or cancer cells with resistance to TKI or EGFR antibody therapy.
- SDCs selective depletion complexes
- EGFR-driven cancer cells with Normal EGFR (panel 1) in an EGFR-driven cancer cell is effectively depleted by an SDC, resulting in reduced downstream KRAS and MEK signaling (indicated by gray dashed arrows) in response to SDC treatment.
- Mutated EGFR that prevent TKI binding (panel 2) is effectively depleted by an SDC, resulting in reduced downstream KRAS and MEK signaling in response to SDC treatment.
- EGFR heterodimerized with and cross-activated by an overexpressed growth factor receptor (e.g., HER2, ERBB3, or MET, panel 3) is effectively depleted by an SDC, resulting in reduced downstream KRAS and MEK signaling in response to SDC treatment.
- FIG.21 shows flow sorting data illustrating enrichment of peptides with pH-dependent binding to PD-L1. This data shows that pH-dependent binding peptides can be generated through flow sorting.
- the input library was initially screened for high PD-L1 binding at pH 7.4.
- the second and third rounds of screening ( ⁇ Qjmo 1 ⁇ ⁇ i_ ⁇ Qjmo 2, ⁇ m ⁇ nk ⁇ odq ⁇ gt) r ⁇ m ⁇ k ⁇ majmh ⁇ _ ⁇ o kF 5.5 to mimic endosomal pH, enriching for poor PD-L1 binding at this pH.
- Rc ⁇ adi ⁇ g mjpi_ ja n ⁇ m ⁇ idib ( ⁇ Qjmo 3 ⁇ ) r ⁇ n performed at pH 7.4. Differential binding at pH 7.4 and pH 5.5 was observed following n ⁇ m ⁇ idib ( ⁇ Qjmo 4 ⁇ ).
- the areas encompassed by the 5-sided polygon in each graph denotes the population that was selected during sorting. Darker topographical density maps indicate staining with PD-L1 under pH 7.4 conditions and lighter topographical density maps indicate staining with PD-L1 under pH 5.5 conditions.
- FIG.22 shows binding data at pH 7.4 (left bars) and at pH 5.5 (right bars) for pH-dependent PD-L1-binding peptide variants identified in FIG.21.
- ⁇ UTF ⁇ indicates untransfected cells (negative control).
- the parent peptide (SEQ ID NO: 187) exhibited some degree of pH-dependent binding to PD-L1.
- SEQ ID NO: 187 exhibited more pH-dependence in PD-L1 binding than the parent, while some variants of SEQ ID NO: 187 exhibited less pH-dependence in PD-L1 binding than the parent.
- the peptide of SEQ ID NO: 234 was shown to have a high difference in binding at pH 7.4 versus pH 5.5, demonstrating higher binding at pH 7.4 than at pH 5.5.
- the peptide of SEQ ID NO: 233 (black arrow) is shown to have a particularly high difference in binding at pH 7.4 versus pH 5.5, also demonstrating higher binding at pH 7.4 than at pH 5.5.
- FIG.23A schematically illustrates the domain configuration of selective depletion complexes, such as those utilized in assays shown in FIG.23B and FIG.23C.
- Selective depletion complexes contained, from N-terminus to C-terminus, a target-binding peptide, a first peptide linker (GGGGSx4, SEQ ID NO: 224), an albumin binding peptide (SEQ ID NO: 227), a second peptide linker (GGGGSx4, SEQ ID NO: 224), and a TfR-binding peptide.
- FIG.23B shows an SDS-PAGE gel of two purified selective depletion complexes arranged as illustrated in FIG.23A, and two negative controls complexes where the TfR- binding peptide is replaced with a peptide that does not bind TfR.
- Peptide 1 (SEQ ID NO: 367) contained a target-binding peptide that binds EGFR (SEQ ID NO: 244) and a peptide that does not significantly bind TfR corresponding to SEQ ID NO: 232.
- Peptide 2 (SEQ ID NO: 328) contained a target-binding peptide that binds EGFR (SEQ ID NO: 244) and a high affinity TfR- binding peptide corresponding to SEQ ID NO: 96.
- Peptide 3 (SEQ ID NO: 357) contained a target-binding peptide that binds PD-L1 (SEQ ID NO: 187) and a peptide that does not significantly bind TfR corresponding to SEQ ID NO: 232.
- Peptide 4 (SEQ ID NO: 356) contained a target-binding peptide that binds PD-L1 (SEQ ID NO: 187) and a high affinity TfR- binding peptide corresponding to SEQ ID NO: 96.
- FIG.23C shows ternary complex formation of the four peptide complexes shown in FIG.23B with cells expressing EGFR (left) or PD-L1 (right). Cells were stained with fluorescently labeled TfR to detect ternary complex formation between a target protein expressed on the cell surface, the peptide complex, and TfR.
- Peptide 2 (SEQ ID NO: 328), which contained an EGFR-binding peptide and a high affinity TfR-binding peptide, formed ternary complexes with EGFR-expressing cells but not with PD-L1-expressing cells.
- Peptide 4 (SEQ ID NO: 356), which contained a PD-L1-binding peptide and a high affinity TfR-binding peptide, formed ternary complexes with PD-L1-expressing cells but not with EGFR-expressing cells.
- Peptides 1 and 3 which did not contain high affinity TfR-binding peptides, did not form ternary complexes. This data indicates that peptides complexes containing a target-binding peptide and a TfR-binding peptide can form ternary complexes on a cell surface with the target and with TfR.
- FIG.24A schematically illustrates ternary complex formation between a selective depletion complex (SDC, containing a target-binding peptide, a receptor-binding peptide, and a His tag (SEQ ID NO: 228)), a target protein expressed on a cell surface, and a transferrin receptor expressed on a cell surface.
- SDC selective depletion complex
- FIG.24B shows binding data for peptide complexes with (+) or without (-) a target- binding peptide that binds PD-L1 (SEQ ID NO: 187, ⁇ NBJ1 ⁇ ) ⁇ i_ rdoc jm rdocjpo ⁇ m ⁇ kojm- binding peptide that binds TfR (SEQ ID NO: 96, ⁇ RaP ⁇ ) oj ⁇ ggn that express TfR with or without expressing PD-J1 ( ⁇ NBJ1 ⁇ ). All peptide complexes contained a His tag (SEQ ID NO: 228). The 1 st bar corresponds to PBS negative control, no peptide complex.
- the 2 nd and 3 rd bars were measured using a peptide complex of SEQ ID NO: 357.
- the 4 th and 5 th bars were measured using a peptide complex of SEQ ID NO: 356 capable of binding both PD-L1 and TfR.
- a peptide complex that contains both a PD-L1 binding peptide and a TfR-binding peptide can be a selective depletion complex (SDC). Binding was measured using a fluorescent anti-His antibody that bound to the His-tag on the peptide complexes. High levels of binding were observed using an SDC that binds both PD-L1 and TfR on cells that are expressing both PD-L1 and TfR.
- FIG.25A schematically illustrates examples of monovalent selective depletion complexes containing a single target-binding moiety (EGFR-binding nanobodies or PD-L1- binding CDPs in this example) and a single receptor-binding moiety (TfR-binding CDPs or scFvs in this example). These can be arranged in a single protein, where both moieties are separated by a linker, or as a dimeric complex where one monomer contains a TfR-binding moiety, and another contains a target-binding moiety.
- EGFR-binding nanobodies or PD-L1- binding CDPs in this example
- TfR-binding CDPs or scFvs single receptor-binding moiety
- Active catalytic molecules are those for which the TfR-binding moiety binds in a pH-independent fashion and the target-binding moiety binds in a pH-dependent fashion.
- Active non-catalytic molecules are those for which the TfR- binding moiety binds in a pH-dependent fashion and the target-binding moiety binds in a pH- independent fashion. Either active catalytic or active non-catalytic molecules would be expected to cause selective depletion of their target; non-catalytic molecules would travel with the target down the endosomal degradation pathway, while catalytic molecules would follow TfR back to the cell surface to bind another target.
- Representative control molecules are those where both TfR-binding and target-binding moieties bind in a pH-independent fashion but would not be expected to cause a selective depletion of their target either as effectively or to the same degree as the active catalytic or active non-catalytic molecules, or would not cause selective depletion of the target at all or in a significant manner.
- FIG.25B schematically illustrates examples of selective depletion complexes with differing valence for TfR- and/or target-binding.
- the figure illustrates Fc fusions where the TfR- binding moiety (a pH-independent TfR-binding CDP in this case) may be present once in the molecule (monovalent) or twice in the molecule (bivalent), and the target-binding moiety (a pH- dependent EGFR-binding nanobody in this case) may be present once in the molecule (monovalent) or twice in the molecule (bivalent).
- Fc fusions in which the two monomers are not identical can be assembled via knob-in-holes (KIH) dimerization. Multivalent selective depletion complexes can also be expressed as a single polypeptide chain (not shown).
- FIG.26A shows a co-crystal structure of a high-affinity PD-L1-binding CDP (SEQ ID NO: 187, cartoon) binding to or docked with PD-L1 (surface, with lighter shading denoting oxygen and darker shading denoting nitrogen).
- FIG.26B shows relative binding enrichment, shown as absolute value of average SSM enrichment, of PD-L1-binding CDP variants containing amino acid substitutions in resolved (R) residues or unresolved (UR) residues, as seen in the co-crystal structure of FIG.26A.
- FIG.26C shows an overlay of PD-1 (mesh) with SEQ ID NO: 187 (cartoon) at the binding interface with PD-L1 (surface, with lighter shading denoting oxygen and darker shading denoting nitrogen).
- SEQ ID NO: 187 would be expected to compete with PD-1 for binding to PD-L1.
- FIG.26D shows a zoomed in view of the SEQ ID NO: 187 PD-L1 co-crystal structure of FIG.26A from two different angles.
- Residues of SEQ ID NO: 187 that interact with PD-L1, including K5, V9, W12, M13, K16, V39, F40, L43, and D44, are shown as sticks.
- Residues of PD-L1 that interact with SEQ ID NO: 187, including Y56, Q66, R113, M115, A121, and Y123 are also labeled.
- FIG.26E shows isolated side chains of select residues in SEQ ID NO: 187 (gray) at the PD-L1- binding interface relative the parent CDP (black, minimally clashing rotamers). Labeled residues of SEQ ID NO: 187, including M13, V39, F40, and L43, correspond to substitutions relative to parent CDP that improved binding to PD-L1.
- FIG.26F shows a zoomed in view of the binding interface between SEQ ID NO: 187 (cartoon) and PD-L1 (surface).
- FIG.26G shows a co-crystal structure of SEQ ID NO: 187 and PD-L1 in which SEQ ID NO: 187 is illustrated as a wire diagram with side chains of interest shown with thick sticks (top). PD-1 binding to PD-L1 is shown at bottom for comparison.
- compositions and methods for selective depletion of a target molecule using cellular endocytic pathways e.g., transferrin receptor-mediated endocytosis.
- Extracellular, soluble, and cell-surface proteins mediate signaling between cells and organs, including growth, cell death, inflammation, metabolism, and more.
- proteins are regularly cycled through production, use, and degradation, and their degradation is typically within the endosomal-lysosomal pathway.
- endocytic vesicles containing material taken up from extracellular space as well as embedded membrane proteins become acidified and fuse with or enter lysosomes containing enzymes that degrade such proteins.
- Selective removal of certain cell surface or soluble proteins, either from circulation or disease-associated tissues, via selective delivery to the lysosome can be used to treat disease conditions, including diseases resulting from over-expression or accumulation of soluble or cell surface proteins or diseases associated with mutations (e.g., mutations causing constitutive activity, resistance to treatment, or dominant negative activity) in soluble or surface proteins.
- the selective depletion complexes described herein can be used to deliver an administered therapeutic drug to an endosomal or lysosomal compartment, for example to treat lysosomal nojm ⁇ b ⁇ _dn ⁇ n ⁇ n gdf ⁇ E ⁇ p ⁇ c ⁇ m ⁇ n Bdn ⁇ n ⁇ (_ ⁇ ad ⁇ d ⁇ i ⁇ t ja bgp ⁇ j ⁇ m ⁇ ]mjnd_ ⁇ n ⁇ ) jm Njhk ⁇ Bdn ⁇ n ⁇ (_ ⁇ ad ⁇ d ⁇ i ⁇ t ja ⁇ -glucosidase).
- a therapeutic molecule e.g., a lysosomal enzyme for an enzyme replacement therapy
- a selective depletion complex comprising a target-binding peptide that binds the therapeutic molecule, thereby delivering the therapeutic molecule to the endosome or lysosome.
- a selective depletion construct can function as a selective delivery complex and facilitate delivery of active enzymes to an endosome or lysosome.
- a lysosomal enzyme can be delivered using a selective depletion complex and can retain enzymatic activity in the endosome or lysosome.
- lysosomal enzyme in combination with a selective depletion complex comprising a target-binding peptide that binds the lysosomal enzyme can increase the therapeutic response per dose of enzyme administered relative to administration of the lysosomal enzyme alone.
- lysosomal delivery could be accomplished by taking advantage of existing protein uptake and recycling mechanisms, and engineering of pH-dependent binding domains into target-binding molecules.
- TfR transferrin receptor
- TfR transferrin receptor
- Transferrin is known as a serum chaperone for iron ions destined for redox sensitive intracellular enzymes.
- Iron-loaded transferrin holo-transferrin
- the TfR:transferrin complex is natively recycled back to the cell surface, exposing transferrin to neutral pH conditions. Transferrin unbound by iron (apo-transferrin) no longer has TfR affinity under neutral pH conditions at the cell surface, and is released back into circulation to pick up more iron, and repeat the process, in what is essentially a catalytic process for iron delivery to cells.
- compositions and methods of this disclosure exploit the transferrin receptor endocytic and recycling pathways to deliver target molecules (e.g., soluble or cell surface proteins) to endocytic vesicles for lysosomal degradation.
- target molecules e.g., soluble or cell surface proteins
- the compositions and methods of this disclosure can be used to selectively degrade specific target receptor or soluble proteins that are over-expressed in disease via this pathway.
- the compositions and methods described effectively reduce, diminish, eliminate or deplete the target receptors from the cell surface or soluble proteins in circulation, which has many applications in medicine as described herein.
- TfR-binding peptide e.g., a TfR-binding cystine-dense peptide
- target-binding peptide e.g., a target-binding cystine-dense peptide, a target-binding antibody, a target-binding nanobody, a target-binding antibody fragment, or other targeting agent
- TfR-binding peptide e.g., a TfR-binding cystine-dense peptide
- target-binding peptide e.g., a target-binding cystine-dense peptide, a target-binding antibody, a target-binding nanobody, a target-binding antibody fragment, or other targeting agent
- the TfR can carry the selective depletion complex and the target molecule into the endocytic vesicle.
- the TfR-binding peptide of the selective depletion complex can have high affinity for TfR at extracellular pH (about pH 7.4) to endosomal pH (about pH 5.5), inclusive.
- the TfR-binding peptide can maintain its affinity for TfR upon internalization and as the endosomal compartment acidifies.
- the target-binding peptide of the selective depletion complex can have higher affinity for the target molecule at extracellular pH and lower affinity for the target molecule at a lower endosomal pH.
- the selective depletion complex can remain bound to TfR and release the target molecule upon acidification of the endosome. Once the target is released, the selective depletion complex can remain bound to TfR while TfR is recycled to the cell surface to be reloaded with another target molecule, and the target molecule can remain in the endosome where it is delivered to a lysosome and degraded.
- the TfR-binding peptide of the selective depletion complex can have higher affinity for TfR at extracellular pH and lower affinity for the target molecule at a lower endosomal pH.
- the selective depletion complex can release from TfR upon acidification of the endosome.
- the methods of the present disclosure can comprise contacting a cell (e.g., a cell expressing TfR) with a selective depletion complex (e.g., a molecule comprising a TfR-binding peptide and a target-binding peptide).
- a selective depletion complex e.g., a molecule comprising a TfR-binding peptide and a target-binding peptide.
- the selective depletion complex can recruit target molecules into endocytic vesicles via transferrin receptor-mediated (TfR-mediated) endocytosis.
- TfR-mediated transferrin receptor-mediated endocytosis
- the target molecule can be released in the endocytic vesicle where it is delivered to the lysosome and degraded.
- the selective depletion complex can remain bound to the TfR and can remain bound to TfR as TfR is recycled to the cell surface.
- Such methods can be used to deplete a target molecule, such as a molecule associated with a disease or a condition.
- a target molecule such as a molecule associated with a disease or a condition.
- the methods of the present disclosure can be used to selectively deplete a soluble protein or a cell surface protein that is over-expressed, contains a disease-associated mutation (e.g., a mutation causing constitutive activity, resistance to treatment, or dominant negative activity), or accumulates in a disease or a condition.
- a disease-associated mutation e.g., a mutation causing constitutive activity, resistance to treatment, or dominant negative activity
- the presently described selective depletion complex can comprise peptide conjugates, peptide complexes, peptide constructs, fusion peptides, or fusion molecules such as linked by chemical conjugation of any molecule type, such as small molecules, peptides, or proteins, or by recombinant fusions of peptides or proteins, respectively (e.g., a peptide construct or a peptide complex).
- fusion peptide and “peptide fusion” are used interchangeably herein.
- the peptide constructs or peptide complexes can be produced biologically or synthetically.
- a selective depletion complex can comprise a TfR-binding peptide domain linked to another molecule or group of molecules such as small molecules, peptides, or proteins or other macromolecules such as nanoparticles.
- the presently described selective depletion complexes can be peptide complexes comprising one or more TfR-binding peptides as described herein conjugated to, linked to, or fused to one or more target-binding peptides, one or more active agents (e.g., therapeutic agents, detectable agents, or combinations thereof), or combinations thereof.
- Selective depletion complexes as described herein can include chemical conjugates and recombinant fusion molecules.
- a chemical conjugate can comprise a TfR-binding peptide as described herein that is chemically conjugated to or linked to another peptide (e.g., a target-binding peptide), a molecule, an agent, or a combination thereof.
- Molecules can include small molecules, peptides, polypeptides, proteins, or other macromolecules (e.g., nanoparticles) and polymers (e.g., nucleic acids, polylysine, or polyethylene glycol).
- a TfR- binding peptide of the present disclosure is conjugated to another peptide or a molecule via a linker.
- Linker moieties can include cleavable (e.g., pH sensitive or enzyme-labile linkers) or stable linkers.
- a peptide complex is a fusion molecule (e.g., a fusion peptide or fusion protein) that can be recombinantly expressed, and wherein the fusion molecule can comprise one or more TfR-binding peptides fused to one or more other molecules peptides, polypeptides, proteins, or other macromolecules that can be recombinantly expressed.
- the selective depletion complexes of this disclosure can have a therapeutic effect at a lower dose or a longer lasting therapeutic effect as compared to lysosomal delivery molecules that are degraded and not recycled to the cell surface. Rather than being degraded in the lysosome, the selective depletion complexes of this disclosure can be recycled back to the cell surface to “reload” with the target, meaning that the potential for one selective depletion complex of this disclosure can drive the degradation of multiple target molecules with a potentially catalytic effect.
- a lysosomal delivery molecule that is not recycled to the cell surface can itself be degraded or can accumulate in the lysosome without being re-used or “reloaded”.
- the selective depletion complexes of this disclosure e.g., complexes comprising a TfR-binding peptide and a target binding peptide
- can have a wider therapeutic window i.e., the dosage above which a therapeutic pharmacodynamic response is observed but below which toxicity is observed
- the therapeutic window of a drug is the dose range at which the drug is effective without having unacceptable toxic effects.
- the selective depletion complexes of this disclosure can be used with less risk of toxicity.
- the selective depletion complexes of this disclosure e.g., complexes comprising a TfR-binding peptide and a target-binding peptide
- the selectivity and re-usable nature of the selective depletion complexes of this disclosure in the cell because of the selectivity and re-usable nature of the selective depletion complexes of this disclosure in the cell, as therapeutic agents they are advantageously not depleted as rapidly as non-recyclable delivery compositions targeted to lysosomes which are depleted as they are used. Moreover, because of the selectivity and recycling aspect of the selective depletion complexes of this disclosure, as therapeutic agents they are advantageously less toxic than non-selective therapeutic agents. This is particularly advantageous for applications in cancer, where therapeutic agents can be non- selective and highly toxic and exhibit detrimental side effects on normal cells, organs and tissues, or require lower than effective therapeutic doses less able to reduce, cure, ablate disease.
- the selective depletion complexes of this disclosure can have less immunogenicity than an alternative therapy (e.g., a lysosomal delivery molecule) that contains sugars, glycans, polymers containing sugar-like molecules, or other derivatives.
- an alternative therapy e.g., a lysosomal delivery molecule
- a selective depletion complex of this disclosure can have less immunogenicity than an alternative therapy (e.g., a lysosomal delivery molecule) that targets the mannose-6-phosphate receptor or the asialoglycoprotein receptor.
- a selective depletion complex of this disclosure can be manufactured by a single recombinant expression and can have improved manufacturing yield, purity, cost, or manufacturing time than a molecule that has multiple synthetic steps to generate a ligand for mannose-6-phosphate receptor or the asialoglycoprotein receptor.
- a selective depletion complex of this disclosure can have a greater therapeutic effect or a lower therapeutic dose due to the ability to design the linker for maximal ability to bind for the TfR and the target at the same time, including of the target is bound in the cell surface.
- the TfR-binding peptides, TfR-binding peptide conjugates, or TfR-binding fusion peptides of this disclosure can have fewer epitopes to trigger an adaptive immune response, resulting in reduced immunogenicity as compared to TfR-binding antibody-based therapeutics.
- the TfR-binding peptides, TfR-binding peptide conjugates, or TfR-binding fusion peptides of this disclosure can exhibit more facile and less disruptive incorporation of active agents into protein fusion complexes as compared to TfR-binding antibody-based therapeutics.
- the TfR- binding peptides, TfR-binding peptide conjugates, or TfR-binding fusion peptides of this disclosure can have a smaller surface area, resulting in lower risk for off-target binding, as compared to TfR-binding antibody -based therapeutics.
- the TfR-binding peptides, TfR-binding peptide conjugates, or TfR-binding fusion peptides of this disclosure can be formulated at a higher molar concentration than TfR-binding antibody-based therapeutics due to their lower molecule weight, lower hydrodynamic radius, or lower molar solution viscosity.
- the TfR-binding peptides, TfR-binding peptide conjugates, or TfR-binding fusion peptides of this disclosure exhibit lower on-target toxicity than an anti-TfR antibody or other therapeutic agents when administered to a subject at the same molar dose or at a similarly effective dose. In some embodiments, the TfR-binding peptides, TfR-binding peptide conjugates, or TfR-binding fusion peptides exhibit lower off-target toxicity than an antibody or other therapeutic agent when administered to a subject at the same molar dose or a similarly effective dose.
- the TfR-binding peptides, TfR-binding peptide conjugates, or TfR- binding fusion peptides of this disclosure can be administered to a subject at about 1-fold, 2- fold, 3-fold, 4-fold, 5-fold, 10-fold, 15-fold, 20-fold, 25-fold, 30-fold, 40-fold, 50-fold, 60-fold, 70-fold, 80-fold, 90-fold, 100-fold higher molar dose than an antibody while providing similar or lower observed toxicity.
- the TfR-binding peptides, TfR-binding peptide conjugates, or TfR-binding fusion peptides of this disclosure exhibit higher efficacy than an anti-TfR antibody or other therapeutic agent when administered to a subject at the same dose by weight as the anti-TfR antibody or other therapeutic agent.
- the TfR-binding peptides of the present disclosure when fused to a half-life extending moiety (e.g., Fc, SA21, PEG), can be delivered at even lower doses while preserving activity and efficacy and, thus, is far superior to administering an anti-TfR antibody or other therapeutic agent.
- the present disclosure provides peptides (e.g., CDPs, knotted peptides, or hitchins), chemical conjugates (e.g., comprising one or more TfR-binding peptides and one or more active agents), or recombinantly expressed fusion molecules (e.g., comprising one or more TfR-binding peptides and one or more active agents) that bind to TfR.
- the TfR- binding peptides can be cystine-dense peptides (CDPs).
- TfR-binding peptides are used interchangeably herein.
- the binding of peptides described in the present disclosure to TfR can facilitate transcytosis of the selective depletion complex, peptide, peptide complex or peptide construct (e.g., fusion protein, or peptide conjugated to, linked to, or fused to an agent) across a cell barrier (e.g., the BBB).
- a cell barrier e.g., the BBB
- the binding of peptides described in the present disclosure to TfR can facilitate endocytosis of the selective depletion complex, peptide, or peptide complex in any cell that expresses TfR, or in cell that express TfR at higher levels, including some cancer cells, hepatic cells, spleen cells, and bone marrow cells. Also disclosed herein is the use of a mammalian surface display screening platform to screen a diverse library of CDPs and identify CDPs that specifically bind to human TfR.
- Such identified peptides can be modified to improve binding to TfR and used in selective depletion complexes as the peptide or peptide complex that binds TfR and is recycled to the cell surface (e.g., the pH-independent TFR-binding CDP as shown in FIG. 12A and FIG. 12B).
- a mammalian surface display screening platform to screen a diverse library of CDPs and identify CDPs that specifically bind to a target that is desired to be degraded.
- Such identified peptides can be optimized for binding to a selected target and used in selective depletion complexes as the peptide or peptide complex that binds such selected target and is released in the endosome for degradation within the cell (e.g., the pH-dependent targetbinding CDP as shown in FIG. 12A and FIG. 12B).
- Further affinity maturation can be subsequently implemented to produce an allelic series of TfR-binding CDPs or target-binding CDPs as appropriate with varying affinities.
- TfR-binding CDPs or targetbinding CDPs are identified and binding can be determined by crystallography or other methods.
- Peptides of the present disclosure can have cross-reactivity across species.
- the peptides disclosed herein in some cases, bind to human and murine TfR.
- Peptides disclosed herein can accumulate in the CNS and can penetrated the BBB via engagement of the TfR, following intravenous administration.
- TfR-binding CDPs for use as therapeutic delivery agents in oncology, autoimmune disease, acute and chronic neurodegeneration, and pain management. Delivery of active or pharmaceutical agents via TfR- binding CDP can be advantageous over conventional anti-TfR antibodies due to simpler manufacturing (peptides can be made via biologic or synthetic means), improved stability, improved therapeutic window, and smaller size (less potential for steric hindrance of cargo activity).
- the methods and compositions of the present disclosure can provide a solution to the problem of effectively transporting cargo molecules (e.g., therapeutic and/or diagnostic small molecules, peptides or proteins) into the CNS (e.g., the brain).
- cargo molecules e.g., therapeutic and/or diagnostic small molecules, peptides or proteins
- the peptides of the present disclosure aid in drug delivery to tumors located in the brain.
- a diverse library of CDPs, knotted peptides, hitchins, or peptides derived from knotted peptides or hitchins can be used in combination with a mammalian surface display screening platform is used to identify peptides that specifically bind to human TfR desired for recycling or to a target desired for degradation.
- a mammalian surface display screening platform is used to identify peptides that specifically bind to human TfR desired for recycling or to a target desired for degradation.
- a diverse library of CDPs, knotted peptides, hitchins, or peptides derived from knotted peptides or hitchins is mutagenized from endogenous peptide sequences to provide novel peptide sequences.
- affinity maturation e.g., site-saturation mutagenesis
- allelic series of binders with varying (e.g., improved) affinities for TfR or a target can be performed to produce an allelic series of binders with varying (e.g., improved) affinities for TfR or a target.
- peptides of the present disclosure are developed to bind human TfR.
- the engineered peptides of the present disclosure can have a high target binding affinity at physiologic extracellular pH (e.g., a pH from about pH 7.2 to about pH 7.5, a pH of from about pH 6.5 to about 7.5, or a pH of from about pH 6.5 to about pH 6.9) but a significantly reduced binding affinity at lower pH levels such as endosomal pH of about 6.5, about 6.0, or about 5.5.
- Extracellular pH can be, for example pH 7.4. Extracellular pH can also be lower, including in the tumor microenvironment, such as pH 7.2, 7.0, or 6.8.
- extracellular pH can be from about pH 6.5 to about pH 6.9.
- endocytosis the endosome undergoes a decrease in pH.
- Endosomal pH can decrease by the action of proton pumps or by merging with other vesicles with lower pH. The pH can decrease to 7.0, and then to 6.5, and then to 6.0, and then to 5.5 or lower.
- Some endosomes are called early endosomes and can have a pH around 6.5. Some of these endosomes become recycling endosomes.
- Some endosomes are called late endosomes and can have a pH around 5.5. Some endosomes become or merge with lysosomes, where the pH can be 4.5.
- Enzymes and other factors in the lysosome can cause degradation of the contents of the lysosome.
- the target-binding peptides release in the endosome at about pH 7.3, pH 7.2, pH 7.1, pH 7.0, pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH 5.0, pH 4.9, pH 4.8, pH 4.7, pH 4.6, pH 4.5, or lower.
- the target-binding peptide may release at any point during the endosomal maturation process upon a decrease in pH following endocytosis.
- histidine scans and comparative binding experiments can be performed to develop and screen for such peptides.
- an amino acid residue in a peptide of the present disclosure is substituted with a different amino acid residue to alter a pH-dependent binding affinity to the target or to TfR.
- the amino acid substitution can increase a binding affinity at low pH, increase a binding affinity at high pH, decrease a binding affinity at low pH, decrease a binding affinity at high pH, or a combination thereof.
- a peptide that has high affinity to TfR and used in selective depletion complexes as the peptide or peptide complex that binds TfR for recycling to the cell surface can be a pH-independent TfR-binding peptide (e.g., a pH-independent TfR-binding CDP) such that it is not released in the endosome.
- a pH-independent TfR-binding peptide e.g., a pH-independent TfR-binding CDP
- the TfR-binding peptide can remain bound to TfR as the ionic strength of the endosomal compartment increases upon acidification of the endosome.
- the TfR-binding peptides are stable at endosomal pH, and do not release in the endosome for example under acidic conditions, such as pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH 5.0, pH 4.9, pH 4.8, pH 4.7, pH 4.6, pH 4.5, or lower.
- a peptide that has high affinity for binding to a selected target and used in selective depletion complexes as the peptide or peptide complex that binds such selected target and is released in the endosome for degradation within the cell can be a pH-dependent target-binding CDP such that it is released in the endosome.
- a target-binding peptide can release the target as the ionic strength of the endosomal compartment increases upon acidification of the endosome.
- the target-binding peptides are less stable at endosomal pH, and release wholly or in part in the endosome for example under acidic conditions, such as pH 7.3, pH 7.2, pH 7.1, pH 7.0, pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH 5.0, pH 4.9, pH 4.8, pH 4.7, pH 4.6, pH 4.5, or lower.
- acidic conditions such as pH 7.3, pH 7.2, pH 7.1, pH 7.0, pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1,
- the TfR-binding peptides of the present disclosure can be optimized for improved intra-vesicular (e.g., intra-endosomal) function while retaining high TfR binding capabilities.
- Exemplary TfR-binding peptides of the present disclosure are shown in TABLE 1 with amino acid sequences set forth in SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64.
- a protein or molecule of interest such as TfR
- bind to a target molecule for depletion or both.
- the methods and compositions as described herein can provide peptides with improved TfR-binding capabilities, or peptides that exhibit improved transport capabilities across the BBB, or any combination thereof.
- the presently described peptides efficiently transport cargo molecules (e.g., target-binding molecules) across endothelial cell layers (e.g., the BBB) or epithelial layers.
- cargo molecules e.g., target-binding molecules
- the TfR- binding peptides of the present disclosure bind to a TfR and promote vesicular transcytosis.
- the TfR-binding peptides of the present disclosure bind to a cell that overexpress a TfR (e.g., a cancer cell) and promotes uptake of the peptide by the cell.
- a TfR binding peptide or peptide complexes as described herein promotes vesicular transcytosis and uptake by a TfR-overexpressing cell such as a cancer, or a combination thereof.
- the TfR-binding peptides of the present disclosure facilitate TfR-mediated endocytosis of a selective depletion complex and a target molecule.
- the TfR-binding peptides of the present disclosure can bind TfR of different species including human, monkey, mouse, and rat TfR. In some cases, variations or mutations in any of the amino acid residues of a TfR-binding peptide can influence cross-reactivity. In some cases, variations or mutations in any of the amino acid residues of a TfR-binding peptide that interact with the bindings site of TfR can influence cross-reactivity.
- peptides including, but not limited to, designed or engineered peptides, recombinant peptides, and cystine-dense peptides (CDPs)/small disulfide-knotted peptides (e.g., knotted peptides, hitchins, and peptides derived therefrom), that can be large enough to carry a cargo molecule while retaining the ability to bind a target protein with high affinity (e.g., TfR), but yet small enough to access cellular tissues, such as the center of cell agglomerates (e.g., solid tumors).
- the peptides as described herein carry cargo molecules across the BBB into the CNS (e.g., the parenchyma) via vascular transcytosis.
- the transcytosis is TfR-mediated.
- peptide-receptor interactions e.g., using X-ray crystallography
- CNS e.g., brain
- peptides described herein have the ability to target and accumulate in tumor cells.
- the tumor cells overexpress TfR.
- the peptides of the present disclosure have high in vivo stabilities, e.g., high protease stability, high tolerability of reducing agents such as glutathione (GSH), and tolerate elevated temperatures (e.g., up to 95 °C).
- the present disclosure provides, in some embodiments, a peptide or protein design approach based on the 3D protein or receptor structure for identifying peptides or proteins capable of binding such receptor.
- the receptor is a transferrin receptor.
- Xaa can indicate any amino acid.
- X can be asparagine (N), glutamine (Q), histidine
- Some embodiments of the disclosure contemplate D-amino acid residues of any standard or non-standard amino acid or analogue thereof.
- an amino acid sequence is represented as a series of three-letter or one-letter amino acid abbreviations, the left-hand direction is the amino terminal direction and the right-hand direction is the carboxy terminal direction, in accordance with standard usage and convention.
- peptide can be used interchangeably herein to refer to a polymer of amino acid residues.
- peptides”, polypeptides”, and “proteins” can be chains of amino acids whose alpha carbons are linked through peptide bonds.
- the terminal amino acid at one end of the chain e.g., amino terminal, or N-terminal
- the terminal amino acid at the other end of the chain e.g., carboxy terminal, or C-terminal
- the terminal amino acid at the other end of the chain e.g., carboxy terminal, or C-terminal
- amino terminus can refer to the free a-amino group on an amino acid at the amino terminal of a peptide or to the a-amino group (e.g., imino group when participating in a peptide bond) of an amino acid at any other location within the peptide.
- carboxy terminus can refer to the free carboxyl group on the carboxy terminus of a peptide or the carboxyl group of an amino acid at any other location within the peptide.
- Peptides also include essentially any polyamino acid including, but not limited to, peptide mimetics such as amino acids joined by an ether or thioether as opposed to an amide bond.
- the term “peptide construct” can refer to a molecule comprising one or more peptides of the present disclosure that can be conjugated to, linked to, or fused to one or more peptides or cargo molecules.
- cargo molecules are active agents.
- the term “active agent” can refer to any molecule, e.g., any molecule that is capable of eliciting a biological effect and/or a physical effect (e.g., emission of radiation) which can allow the localization, detection, or visualization of the respective peptide construct.
- the term “active agent” refers to a therapeutic and/or diagnostic agent.
- a peptide construct of the present disclosure can comprise a TfR-binding peptide that is linked to one or more active agents via one or more linker moieties (e.g., cleavable or stable linker) as described herein.
- the term “peptide complex” can refer to one or more peptides of the present disclosure that are fused, linked, conjugated, or otherwise connected to form a complex.
- the one or more peptides can comprise a TfR-binding peptide, a target-binding peptide, a half-life modifying peptide, a peptide that modifies pharmacodynamics and/or pharmacokinetic properties, or combinations thereof.
- a peptide complex comprising a TfR-binding peptide and a target-binding peptide can be referred to herein as a selective depletion complex.
- the terms “comprising” and “having” can be used interchangeably.
- the terms “a peptide comprising an amino acid sequence of SEQ ID NO: 32” and “a peptide having an amino acid sequence of SEQ ID NO: 32” can be used interchangeably.
- TfR or “transferrin receptor” is a class of protein used herein and can refer to a transferrin receptor from any species (e.g., human or murine TfR or any human or non-human animal TfR).
- TfR or “transferrin receptor” refers to human TfR (hTfR) and can include TfR or any of the known TfR homologs or orthologs, including TfRl, TfR2, soluble TfR, or any combination or fragment (e.g., ectodomain) thereof.
- endosome As used herein, the terms “endosome,” “endosomal,” “endosomal compartment,” or “endocytic pathway” can be used interchangeably and may refer to any one or more components of the intracellular endosomal network or trans-Golgi network (TGN) that allows for the vesicular transcytosis or trafficking and transfer of peptides and cargoes between distinct membrane-bound compartments within a cell, including lysosomal degradation as well as recycling to the cell surface.
- TGN trans-Golgi network
- vesicles commonly referred to as transport vesicles or early endosomes to late endosomes to lysosomes, and that endosomal compartment acidity increases upon acidification of the endosome throughout the maturation process.
- Lysosomes serving as the last vesicle in the matured endocytic pathway typically contain hydrolytic enzymes which digest the contents of the late endosomes.
- Other endosomes continue to a pathway of recycling endosomes, where the contents are recycled back to the cell surface.
- pH-independent when used in reference to a molecule or moiety, refer means that as the endosomal compartment is acidified, the binding affinity of the molecule or moiety to its target does not change sufficiently to enable dissociation in the endosome with the target.
- the referenced molecule or moiety has the same or similar affinity to its target at extracellular pH and at an endosomal pH.
- pH-independent molecules or moieties do not include pH-dependent molecules or moieties, since the binding affinity of pH-dependent molecules or moieties to its target changes as it enters and proceeds through the endosomal pathway, for example, to enable dissociation in the endosome with the target to some degree, or the referenced molecule or moiety has a different affinity at extracellular pH and at an endosomal pH.
- engineered when applied to a polynucleotide, denotes that the polynucleotide has been removed from its natural genetic milieu and is thus free of other extraneous or unwanted coding sequences and is in a form suitable for use within genetically engineered protein production systems.
- engineered molecules are those that are separated from their natural environment and include cDNA and genomic clones (i.e., a prokaryotic or eukaryotic cell with a vector containing a fragment of DNA from a different organism).
- Engineered DNA molecules of the present invention are free of other genes with which they are ordinarily associated but can include naturally occurring or non-naturally occurring 5' and 3' untranslated regions such as enhancers, promoters and terminators.
- an “engineered” polypeptide or protein is a polypeptide or protein that is found in a condition other than its native environment, such as apart from blood and animal tissue.
- the engineered polypeptide is substantially free of other polypeptides, particularly other polypeptides of animal origin. It is preferred to provide the polypeptides in a highly purified form, e.g., greater than 90% pure, greater than 95% pure, more preferably greater than 98% pure or greater than 99% pure.
- engineered does not exclude the presence of the same polypeptide in alternative physical forms, such as dimers, heterodimers and multimers, heteromultimers, or alternatively glycosylated, carboxylated, modified, or derivatized forms.
- An “engineered” peptide or protein is a polypeptide that is distinct from a naturally occurring polypeptide structure, sequence, or composition.
- Engineered peptides include non- naturally occurring, artificial, isolated, synthetic, designed, modified, or recombinantly expressed peptides.
- Provided herein are engineered TfR-binding peptides, variants, or fragments thereof. These engineered TfR-binding peptides can be further linked to a target-binding moiety or a half-life extending moiety, or can be further linked to an active agent or detectable agent, or any combination of the foregoing.
- Polypeptides of the disclosure include polypeptides that have been modified in any way, for example, to: (1) reduce susceptibility to proteolysis, (2) reduce susceptibility to oxidation,
- a conserved amino acid substitution can comprise a non-natural amino acid.
- polypeptide fragment and “truncated polypeptide” as used herein can refer to a polypeptide that has an amino-terminal and/or carboxy-terminal deletion as compared to a corresponding full-length peptide or protein.
- fragments are at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 450, at least 500, at least 600, at least 700, at least 800, at least 900 or at least 1000 amino acids in length.
- fragments can also be, e.g., at most 1000, at most 900, at most 800, at most 700, at most 600, at most 500, at most 450, at most 400, at most 350, at most 300, at most 250, at most 200, at most 150, at most 100, at most 50, at most 45, at most 40, at most 35, at most 30, at most 25, at most 20, at most 15, at most 10, or at most 5 amino acids in length.
- a fragment can further comprise, at either or both of its ends, one or more additional amino acids, for example, a sequence of amino acids from a different naturally-occurring protein (e.g., an Fc or leucine zipper domain) or an artificial amino acid sequence (e.g., an artificial linker sequence).
- peptide or polypeptide in conjunction with “variant” “mutant” or “enriched mutant” or “permuted enriched mutant” can refer to a peptide or polypeptide that can comprise an amino acid sequence wherein one or more amino acid residues are inserted into, deleted from and/or substituted into the amino acid sequence relative to another polypeptide sequence.
- the number of amino acid residues to be inserted, deleted, or substituted is at least 1, at least 2, at least 3, at least 4, at least 5, at least 10, at least 25, at least 50, at least 75, at least 100, at least 125, at least 150, at least 175, at least 200, at least 225, at least 250, at least 275, at least 300, at least 350, at least 400, at least 450 or at least 500 amino acids in length.
- Variants of the present disclosure include peptide conjugates or fusion molecules (e.g., peptide constructs or peptide complexes).
- a “derivative” of a peptide or polypeptide can be a peptide or polypeptide that can have been chemically modified, e.g., conjugation to another chemical moiety such as, for example, polyethylene glycol, albumin (e.g., human serum albumin), phosphorylation, and glycosylation.
- % sequence identity can be used interchangeably herein with the term “% identity” and can refer to the level of amino acid sequence identity between two or more peptide sequences or the level of nucleotide sequence identity between two or more nucleotide sequences, when aligned using a sequence alignment program. For example, as used herein,
- 80% identity means the same thing as 80% sequence identity determined by a defined algorithm, and means that a given sequence is at least 80% identical to another length of another sequence.
- the % identity is selected from, e.g., at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99% or more up to 100% sequence identity to a given sequence.
- the % identity is in the range of, e.g, about 60% to about 70%, about 70% to about 80%, about 80% to about 85%, about 85% to about 90%, about 90% to about 95%, or about 95% to about 99%.
- the terms “% sequence homology” or “percent sequence homology” or “percent sequence identity” can be used interchangeably herein with the terms “% homology,” “% sequence identity,” or “% identity” and can refer to the level of amino acid sequence homology between two or more peptide sequences or the level of nucleotide sequence homology between two or more nucleotide sequences, when aligned using a sequence alignment program.
- 80% homology means the same thing as 80% sequence homology determined by a defined algorithm, and accordingly a homologue of a given sequence has greater than 80% sequence homology over a length of the given sequence.
- the % homology is selected from, e.g, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or more up to 100% sequence homology to a given sequence.
- the % homology is in the range of, e.g, about 60% to about 70%, about 70% to about 80%, about 80% to about 85%, about 85% to about 90%, about 90% to about 95%, or about 95% to about 99%.
- a protein or polypeptide can be “substantially pure,” “substantially homogeneous”, or “substantially purified” when at least about 60% to 75% of a sample exhibits a single species of polypeptide.
- the polypeptide or protein can be monomeric or multimeric.
- a substantially pure polypeptide or protein can typically comprise about 50%, 60%, 70%, 80% or 90% W/W of a protein sample, more usually about 95%, and e.g., will be over 98% or 99% pure.
- Protein purity or homogeneity can be indicated by a number of means well known in the art, such as polyacrylamide gel electrophoresis of a protein sample, followed by visualizing a single polypeptide band upon staining the gel with a stain well known in the art.
- higher resolution is provided by using high-pressure liquid chromatography (e.g., HPLC) or other high-resolution analytical techniques (e.g., LC-mass spectrometry).
- the term “pharmaceutical composition” can generally refer to a composition suitable for pharmaceutical use in a subject such as an animal (e.g., human or mouse).
- a pharmaceutical composition can comprise a pharmacologically effective amount of an active agent and a pharmaceutically acceptable carrier.
- pharmacologically effective amount can refer to that amount of an agent effective to produce the intended biological or pharmacological result.
- the term “pharmaceutically acceptable carrier” can refer to any of the standard pharmaceutical carriers, vehicles, buffers, and excipients, such as a phosphate buffered saline solution, or a buffered saline solution, 5% aqueous solution of dextrose, and emulsions, such as an oil/water or water/oil emulsion, and various types of wetting agents and/or adjuvants.
- Suitable pharmaceutical carriers and formulations are described in Remington's Pharmaceutical Sciences, 21st Ed. 2005, Mack Publishing Co, Easton.
- a “pharmaceutically acceptable salt” can be a salt that can be formulated into a compound for pharmaceutical use including, e.g., metal salts (sodium, potassium, magnesium, calcium, etc.) and salts of ammonia or organic amines.
- the terms “treat”, “treating” and “treatment” can refer to a method of alleviating or abrogating a biological disorder and/or at least one of its attendant symptoms.
- to “alleviate” a disease, disorder or condition for example, means reducing the severity and/or occurrence frequency of the symptoms of the disease, disorder, or condition.
- references herein to “treatment” can include references to curative, palliative, and prophylactic or diagnostic treatment.
- a cell of the present disclosure can be a eukaryotic cell or a prokaryotic cell.
- a cell can be an epithelial cell.
- a cell can be a microorganism, bacterial, yeast, fungal or algae cell.
- a cell can be an animal cell or a plant cell.
- An animal cell can include a cell from a marine invertebrate, fish, insects, amphibian, reptile, or mammal.
- a mammalian cell can be obtained from a primate, ape, equine, bovine, porcine, canine, feline, or rodent.
- a mammal can be a primate, ape, dog, cat, rabbit, ferret, or the like.
- a rodent can be a mouse, rat, hamster, gerbil, hamster, chinchilla, or guinea pig.
- a bird cell can be from a canary, parakeet or parrots.
- a reptile cell can be from a turtles, lizard or snake.
- a fish cell can be from a tropical fish.
- the fish cell can be from a zebrafish (e.g., Danino rerid).
- a worm cell can be from a nematode (e.g., C. elegans).
- An amphibian cell can be from a frog.
- An arthropod cell can be from a tarantula or hermit crab.
- a mammalian cell can also include cells obtained from a primate (e.g., a human or a non-human primate).
- a mammalian cell can include a blood cell, a stem cell, an epithelial cell, connective tissue cell, hormone secreting cell, a nerve cell, a skeletal muscle cell, or an immune system cell.
- the term “vector,” generally refers to a DNA molecule capable of replication in a host cell and/or to which another DNA segment can be operatively linked so as to bring about replication of the attached segment.
- a plasmid is an exemplary vector.
- the term “subject,” generally refers to a human or to another animal.
- a subject can be of any age, for example, a subject can be an infant, a toddler, a child, a preadolescent, an adolescent, an adult, or an elderly individual.
- Ranges can be expressed herein as from “about” one particular value, and/or to “about” another particular value. When such a range is expressed, another embodiment includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent “about,” it will be understood that the particular value forms another embodiment. It will be further understood that the endpoints of each of the ranges are in relation to the other endpoint, and independently of the other endpoint. The term “about” as used herein refers to a range that is 15% plus or minus from a stated numerical value within the context of the particular usage. For example, about 10 can include a range from 8.5 to 11 5
- the selective depletion complexes of the present disclosure can comprise one or more peptides.
- a selective depletion complex of the present disclosure can comprise a TfR-binding peptide and a target binding peptide.
- two or more peptides can be connected via a linker.
- the peptides of the present disclosure e.g., TfR-binding peptide, a target-binding peptide, or a peptide comprising a TfR-binding peptide linked to a targetbinding peptide
- TfR-binding peptide e.g., TfR-binding peptide, a target-binding peptide, or a peptide comprising a TfR-binding peptide linked to a targetbinding peptide
- the peptides of the present disclosure can be recycled to the cell surface following endocytosis.
- a peptide as disclosed herein can contain only one lysine residue, or no lysine residues. In some instances, one or more or all of the lysine residues in the peptide are replaced with arginine residues. In some instances, one or more or all of the methionine residues in the peptide are replaced by leucine or isoleucine. One or more or all of the tryptophan residues in the peptide can be replaced by phenylalanine or tyrosine. In some instances, one or more or all of the asparagine residues in the peptide are replaced by glutamine.
- one or more or all of the aspartic acid residues can be replaced by glutamic acid residues. In some instances, one or more or all of the lysine residues in the peptide are replaced by alanine or arginine.
- the N-terminus of the peptide is blocked or protected, such as by an acetyl group or a tert- butyloxycarbonyl group. Alternatively or in combination, the C-terminus of the peptide can be blocked or protected, such as by an amide group or by the formation of an ester (e.g., a butyl or a benzyl ester).
- the peptide is modified by methylation on free amines. For example, full methylation is accomplished through the use of reductive methylation with formaldehyde and sodium cyanoborohydride.
- the dipeptide GS can be added as the first two N-terminal amino acids, as shown in SEQ ID NO: 1 - SEQ ID NO: 64, or such N-terminal dipeptide GS can be absent as shown in SEQ ID NO: 65- SEQ ID NO: 128, or can be substituted by any other one or two amino acids.
- the dipeptide GS is used as a linker or used to couple to a linker to form a peptide conjugate or fusion molecules such as a peptide construct or peptide complex.
- the linker comprises a G x S y (SEQ ID NO: 130) peptide, wherein x and y independently are any whole number, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10 and the G and S residues are arranged in any order.
- the peptide linker comprises (GS)x (SEQ ID NO: 131), wherein x can be any whole number, such as 1, 2, 3, 4, 5,
- the peptide linker comprises GGSSG (SEQ ID NO: 132), GGGGG (SEQ ID NO: 133), GSGSGSGS (SEQ ID NO: 134), GSGG (SEQ ID NO: 135), GGGGS (SEQ ID NO: 136), GGGS (SEQ ID NO: 129), GGS (SEQ ID NO: 137), GGGSGGGSGGGS (SEQ ID NO: 138), or a variant or fragment thereof or any number of repeats and combinations thereof.
- KKYKPYVPVTTN (SEQ ID NO: 139) from DkTx
- EPKSSDKTHT (SEQ ID NO: 140) from human IgG3
- the peptide linker comprises GGGSGGSGGGS (SEQ ID NO: 141) or a variant or fragment thereof or any number of repeats and combinations thereof. It is understood that any of the foregoing linkers or a variant or fragment thereof can be used with any number of repeats or any combinations thereof. It is also understood that other peptide linkers in the art or a variant or fragment thereof can be used with any number of repeats or any combinations thereof.
- the linker between the TfR-binding and target-binding peptides within the selective depletion complex is at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 31, at least 32, at least 33, at least 34, at least 35, at least 36 at least 37, at least 38, at least 39, at least 40, at least 41, at least 42, at least 43, at least 44, at least 45, at least 46, at least 47, at least 48, at least 49, at least 50, at least 51, at least 52, at least 53, at least 54, at least 55, at least 56, at least 57,
- a peptide or peptide complex as described herein comprises an amino acid sequence set forth in any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64.
- a peptide as disclosed herein can be a fragment comprising a contiguous fragment of any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64 that is at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 31, at least 32, at least 33, at least 34, at least 35, at least 36 at least 37, at least 38, at least 39, at least 40, at least 41, at least 42, at least 43, at least 44, at least 45, at least 46, at least 47, at least 48, at least 49, at least 50, at least 51, at least
- the peptides as described herein that are capable of targeting and binding to a TfR comprise no more than 80 amino acids in length, or no more than 70, no more than 60, no more than 40, no more than 35, no more than 30, no more than 25, no more than 20, no more than 15, or no more than 10 amino acids in length.
- the peptides as described herein that are capable of targeting and binding to a target molecule comprise no more than 80 amino acids in length, or no more than 70, no more than 60, no more than 50, no more than 40, no more than 35, no more than 30, no more than 25, no more than 24, no more than 23, no more than 22, no more than 21, no more than 20, no more than 19, no more than 18, no more than 17, no more than 16, no more than 15, no more than 14, no more than 13, no more than 12, no more than 11, or no more than 10 amino acids in length.
- peptides can be conjugated to, linked to, or fused to a carrier or a molecule with targeting or homing function for a cell of interest or a target cell.
- peptides can be conjugated to, linked to, or fused to a molecule that extends half- life or modifies the pharmacodynamic and/or pharmacokinetic properties of the peptides, or any combination thereof.
- a peptide comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 positively charged residues, such as Arg or Lys, or any combination thereof.
- one or more lysine residues in the peptide are replaced with arginine residues.
- peptides comprise one or more Arg patches.
- a peptide comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 histidine residues.
- the peptides of the present disclosure can further comprise neutral amino acid residues.
- the peptide has 35 or fewer neutral amino acid residues.
- the peptide has 81 or fewer neutral amino acid residues, 70 or fewer neutral amino acid residues, 60 or fewer neutral amino acid residues, 50 or fewer neutral amino acid residues, 40 or fewer neutral amino acid residues, 36 or fewer neutral amino acid residues, 33 or fewer neutral amino acid residues, 30 or fewer neutral amino acid residues, 25 or fewer neutral amino acid residues, or 10 or fewer neutral amino acid residues.
- the peptides of the present disclosure can further comprise negative amino acid residues.
- the peptide has 6 or fewer negative amino acid residues, 5 or fewer negative amino acid residues, 4 or fewer negative amino acid residues, 3 or fewer negative amino acid residues, 2 or fewer negative amino acid residues, or 1 or fewer negative amino acid residues.
- negative amino acid residues can be selected from any negatively charged amino acid residues, in some embodiments, the negative amino acid residues are either E, or D, or a combination of both E and D.
- a three-dimensional or tertiary structure of a peptide is primarily comprised of beta-sheets and/or alpha-helix structures.
- designed or engineered TfR-binding peptides or target-binding of the present disclosure are small, compact peptides or polypeptides stabilized by intra-chain disulfide bonds (e.g., mediated by cysteines) to form cystine and a hydrophobic core.
- engineered TfR-binding peptides have structures comprising helical bundles with at least one disulfide bridge between each of the alpha helices, thereby stabilizing the peptides.
- the engineered TfR-binding peptides or target-binding peptides comprise structures with three alpha helices and three intra-chain disulfide bonds, one between each of the three alpha helices in the bundle of alpha helices.
- peptide sequences capable of binding to a receptor (e.g., a transferrin receptor or programmed death-ligand 1).
- the peptide capable of binding a receptor may be referred to as a receptor-binding peptide.
- a receptor-binding peptide may bind to a recycled receptor that undergoes recycling via a recycling pathway.
- the recycled receptor may be endocytosed into an early endosome and packaged into a recycling endosome prior to maturation of the early endosome into a late endosome.
- the recycling endosome containing the recycled receptor may fuse with a cell membrane and return the recycled receptor to the cell surface.
- a receptor-binding peptide of the present disclosure may remain bound to the receptor during the recycling process, thereby recycling the receptor-binding peptide as well.
- recycled receptors that may be targeted by a receptor-binding peptide include transferrin receptor and programmed death-ligand 1.
- a receptor-binding peptide of the present disclosure may comprise a miniprotein, a nanobody, an antibody, an IgG, an antibody fragment, a Fab, a F(ab)2, an scFv, an (scFv)2, a DARPin, or an affibody.
- the receptor-binding peptide may comprise a cystine-dense peptide, an affitin, an adnectin, an avimer, a Kunitz domain, a nanofittin, a fynomer, a bicyclic peptide, a beta-hairpin, or a stapled peptide.
- a receptor-binding peptide of the present disclosure can bind to the receptor (e.g., a recycled receptor) with an affinity that is pH-independent.
- a receptor-binding peptide can bind the receptor at an extracellular pH (about pH 7.4) with an affinity that is substantially the same the binding affinity at an endocytic pH (such as about pH 5.5 or about pH 6.5).
- a receptor-binding peptide can bind the receptor at an extracellular pH (about pH 7.4) with an affinity that is lower than the binding affinity at an endocytic pH (such as about pH 5.5 or about pH 6.5).
- a receptor-binding peptide can bind the receptor at an extracellular pH (about pH 7.4) with an affinity that is higher than the binding affinity at an endocytic pH (such as about pH 5.5 or about pH 6.5).
- the binding affinity of a receptor-binding peptide for the receptor at extracellular pH (about pH 7.4) and the binding affinity of a receptor-binding peptide for the receptor at endocytic pH (about pH 5.5) can differ by no more than about 1%, no more than about 2%, no more than about 3%, no more than about 4%, no more than about 5%, no more than about 6%, no more than about 7%, no more than about 8%, no more than about 9%, no more than about 10%, no more than about 12%, no more than about 15%, no more than about 17%, no more than about 20%, no more than about 25%, no more than about 30%, no more than about 35%, no more than about 40%, no more than about 45%, or no more than about
- the affinity of the receptor-binding peptide for the receptor at pH 7.4 and at pH 5.5 can differ by no more than 2-fold, no more than 5-fold, no more than 10-fold, no more than 15-fold, no more than 20-fold, no more than 25-fold, no more than 30-fold, no more than 40- fold, or no more than 50-fold.
- a receptor-binding peptide e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, SEQ ID NO: 1 - SEQ ID NO: 64, SEQ ID NO: 187, SEQ ID NO: 233 - SEQ ID NO: 239, SEQ ID NO: 400 - SEQ ID NO: 456, or SEQ ID NO: 241) can be modified to remove one or more histidine amino acids in the TfR binding interface, thereby reducing the pH-dependence of the binding affinity of the receptor-binding peptide for the receptor.
- a receptor-binding peptide e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, SEQ ID NO: 1 - SEQ ID NO: 64, SEQ ID NO: 187, SEQ ID NO: 233 - SEQ ID NO: 239, SEQ ID NO: 400 - SEQ ID NO: 456, or SEQ ID NO: 241) can lack histidine amino acids in the receptor-binding interface.
- a receptor-binding peptide with pH-independent binding can bind to the receptor with a dissociation constant (K D ) of less than 50 mM, less than 5 pM, less than 500 nM, less than 100 nM, less than 40 nM, less than 30 nM, less than 20 nM, less than 10 nM, less than 5 nM, less than 2 nM, less than 1 nM, less than 0.5 nM, less than 0.4 nM, less than 0.3 nM, less than 0.2 nM, or less than 0.1 nM at extracellular pH (about pH 7.4).
- K D dissociation constant
- a receptor-binding peptide with pH-independent binding can bind to the receptor with a dissociation constant (K D ) of less than 50 mM, less than 5 mM, less than 500 nM, less than 100 nM, less than 40 nM, less than 30 nM, less than 20 nM, less than 10 nM, less than 5 nM, less than 2 nM, less than 1 nM, less than 0.5 nM, less than 0.4 nM, less than 0.3 nM, less than 0.2 nM, or less than 0.1 nM at endosomal pH (about pH 5.5).
- K D dissociation constant
- the receptor-binding peptide can bind to the receptor with an affinity that is pH-dependent.
- the receptor-binding molecule can bind to the receptor with higher affinity at extracellular pH (about pH 7.4) and with lower affinity at endosomal pH (about pH 5.5), thereby releasing the selective depletion complex from receptor upon internalization and acidification of the endosomal compartment.
- the recycling receptor may be TfR.
- a peptide capable of binding transferrin receptor may bind TfR or any of the known TfR homologs, including TfRl, TfR2, soluble TfR, or any combination or fragment (e.g., ectodomain) thereof.
- a peptide capable of binding a transferrin receptor or a TfR homolog can be referred to herein as a transferrin receptor-binding peptide or a TfR-binding peptide.
- peptides disclosed herein can penetrate, cross, or enter target cells in a TfR-mediated manner.
- These cell layers or cells can include TfR-expressing endothelial cells, epithelial cells, and TfR-expressing cells of various tissues or organs such as tumor cells, brain cells, cancerous or tumor cells, liver cells (e.g., hepatocytes (HCs), hepatic stellate cells (HSCs), Kupffer cells (KCs), or liver sinusoidal endothelial cells (LSECs)), pancreas cells, colon cells, ovarian cells, breast cells, spleen cells, bone marrow cells, and/or lung cells, or any combination thereof.
- liver cells e.g., hepatocytes (HCs), hepatic stellate cells (HSCs), Kupffer cells (KCs), or liver sinusoidal endothelial cells (LSECs)
- pancreas cells colon cells, ovarian cells, breast cells, spleen cells, bone marrow cells, and/or lung cells, or any combination thereof.
- a TfR-binding peptide of the present disclosure may comprise a miniprotein, a nanobody, an antibody, an IgG, an antibody fragment, a Fab, a F(ab)2, an scFv, an (scFv)2, a DARPin, or an affibody.
- the TfR-binding peptide may comprise a cystine-dense peptide, an affitin, an adnectin, an avimer, a Kunitz domain, a nanofittin, a fynomer, a bicyclic peptide, a beta-hairpin, or a stapled peptide.
- the peptides as discloses herein can cross cellular layers or barriers (e.g., BBB) or cell membranes via, for example, TfR-mediated vesicular transcytosis and TfR-mediated endocytosis, respectively.
- BBB cellular layers or barriers
- the peptides of the present disclosure can also bind to additional target proteins on cells such as cancer cells.
- a peptide is a peptide or peptide complex comprising a TfR-binding peptide conjugated to, linked to, or fused to a targeting moiety or an active agent (e.g., a therapeutic or diagnostic agent) such as a small molecule or a peptide that has an affinity for an additional target protein (e.g., receptor or enzyme).
- an active agent e.g., a therapeutic or diagnostic agent
- the TfR-binding peptide is linked to a target-binding peptide and enables or promotes TfR-mediated transcytosis of the target-binding peptide across the BBB or TfR-mediated endocytosis into a cell.
- a peptide complex comprising the TfR-binding peptide and a target-binding peptide can target a specific cell or tissue in the CNS and exert a biological effect (e.g., binding a target protein) upon reaching said cell or tissue.
- a peptide complex of the present disclosure exerts a biological effect that is mediated by the TfR-binding peptide, the target-binding peptide, an active agent, or a combination thereof.
- a TfR-binding peptide complex of the present disclosure comprising one target-binding peptides can transport and/or deliver target molecules into cells that express TfR (e.g., deliver target molecules into endosomes).
- the TfR-binding peptide accumulates in tissues in the CNS. In some cases, off-target effects are reduced due to CNS-specific accumulation. In some cases, the TfR-binding peptide accumulates in tissue outside of the CNS (e.g., liver, kidney, spleen, or skin).
- the cells expressing TfR are tumor cells and the TfR-binding peptide complex delivers anti-tumor agents to these tumor cells.
- the anti-tumor agents alone show no or only very limited therapeutic efficacy against the tumor cells; however, when the anti-tumor agents are combined with the TfR-binding peptides of the present disclosure as, for example, a peptide complex, the therapeutic efficacy of these anti-tumor agents is significantly improved.
- the TfR-binding peptides of the present disclosure can induce a biologically relevant response.
- a TfR-binding peptide conjugated to a target-binding peptide can selectively deplete a soluble target molecule or a cell surface target molecule.
- the biologically relevant response can be induced after intravenous, subcutaneous, peritoneal, intracranial, or intramuscular dose, and in some embodiments, after a single intravenous, subcutaneous, peritoneal, intracranial, or intramuscular dose.
- the TfR-binding peptides can be used in combination with various other classes of therapeutic compounds used to treat and/or prevent pain, neuropathic pain or other neurological disorders such as neurodegenerative disorders, infectious diseases, immunological disorders (e.g., autoimmune diseases) or lysosomal storage diseases.
- Binding of the herein described peptides and peptide complexes e.g., peptide conjugates, fusion peptides, or recombinantly produced peptide complexes
- TfR a cell layer or barrier
- BBB e.g., via TfR-mediated vesicular transcytosis
- a cell membrane e.g., via TfR- mediated endocytosis
- diseases associated with mutations e.g., mutations causing constitutive activity, resistance to treatment, or dominant negative activity in soluble or surface proteins in a subject (e.g., a human).
- Binding of the herein described peptides and peptide complexes e.g., peptide conjugates, fusion peptides, or recombinantly produced peptide complexes
- TfR a cell layer or barrier
- BBB e.g., via vesicular transcytosis
- a cell membrane e.g., via endocytosis
- Neurodegenerative diseases that can treated, prevented, or diagnosed with the herein described selective depletion complexes comprising TfR-binding peptides can include Alzheimer's disease, Amyotrophic lateral sclerosis, Friedreich's ataxia, Huntington's disease, Lewy body disease, Parkinson's disease, Spinal muscular atrophy, Motor neuron disease, Lyme disease, Ataxia-telangiectasia, Autosomal dominant cerebellar ataxia, Batten disease, Corticobasal syndrome, Creutzfeldt- Jakob disease, Fragile X-associated tremor/ataxia syndrome, Kufor-Rakeb syndrome, Machado-Joseph disease, multiple sclerosis, chronic traumatic encephalopathy, or frontotemporal dementia.
- Alzheimer's disease Amyotrophic lateral sclerosis, Friedreich's ataxia, Huntington's disease, Lewy body disease, Parkinson's disease, Spinal muscular atrophy, Motor neuron disease, Lyme disease, Ataxia
- TfR-binding peptides of the present disclosure can bind to any of the known TfR homologs, including TfRl, TfR2, soluble TfR, or any combination or fragment (e.g., ectodomain) thereof.
- TfR can refer to any known homolog, derivative, fragment, or member of the TfR family including TfRl, TfR2, and a soluble TfR.
- peptides are capable of binding to one, one or more, or all TfR homologs.
- peptides of the present disclosure can bind to a TfR and promote a particular biological effect such as vesicular transcytosis.
- TfR-binding peptides of the present disclosure including peptides and peptide complexes with amino acid sequences set forth in SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, and SEQ ID NO: 1 - SEQ ID NO: 64, and any derivatives or variant thereof, prevent or decrease the binding of endogenous TfR binders (e.g., transferrin or any derivatives such as apo-transferrin or holo-transferrin) to TfR.
- endogenous TfR binders e.g., transferrin or any derivatives such as apo-transferrin or holo-transferrin
- peptides or peptide complexes of the present disclosure comprise derivatives and variants with at least 40% homology, at least 50% homology, at least 60% homology, at least 70% homology, at least 75% homology, at least 80% homology, at least 85% homology, at least 90% homology, at least 91% homology, at least 92% homology, at least 93% homology, at least 94% homology, at least 95% homology, at least 96% homology, at least 97% homology, at least 98% homology, or at least 99% homology or at least 100% homology to amino acid sequences set forth in SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, and SEQ ID NO: 1 - SEQ ID NO: 64.
- the interface residues of the TfR-binding peptides of the present disclosure can be divided between two largely helical domains of the peptide.
- the interface residues can comprise residues corresponding to residues 5-25 (e.g., and comprising corresponding residues G5, A7, S8, Ml 1, N14, L17, E18, and E21), with reference to SEQ ID NO: 32, or corresponding to residues 35-51 (e.g., and comprising corresponding residues L38, L41, L42, L45, D46, H47, H49, S50, and Q51), with reference to SEQ ID NO: 32, or both.
- residues corresponding to residues 5-25 e.g., and comprising corresponding residues G5, A7, S8, Ml 1, N14, L17, E18, and E21
- residues 35-51 e.g., and comprising corresponding residues L38, L41, L42, L45, D46, H47, H49, S50, and Q51
- the interface residues can comprise residues corresponding to residues 5-25 (e.g., and comprising corresponding residues G5, A7, S8, Mil, N14, L17, E18, and E21), with reference to SEQ ID NO: 32, or corresponding to residues 35-51 (e.g., and comprising corresponding residues L38, L41, L42, L45, D46, H47, H49, S50, and Q51), with reference to SEQ ID NO: 32.
- residues corresponding to residues 5-25 e.g., and comprising corresponding residues G5, A7, S8, Mil, N14, L17, E18, and E21
- residues 35-51 e.g., and comprising corresponding residues L38, L41, L42, L45, D46, H47, H49, S50, and Q51
- a TfR-binding peptide can comprise a fragment of a peptide provided herein, wherein the fragment comprises the minimum interface residues for binding, for example residues corresponding to residues 5-25 (e.g., and comprising corresponding residues G5, A7,
- S8 Ml 1, N14, L17, E18, and E21), with reference to SEQ ID NO: 32, or corresponding to residues 35-51 (e.g., and comprising corresponding residues L38, L41, L42, L45, D46, H47, H49, S50, and Q51), with reference to SEQ ID NO: 32.
- the TfR-binding peptide is a peptide having the sequence set forth in SEQ ID NO: 32 comprising the TfR-binding residues corresponding to residues G5, A7, S8, Mil, N14, L17, E18, and E21 of the domain and corresponding to residues L38, L41, L42, L45, D46, H47, H49, S50, and Q51 of the second domain, with reference to SEQ ID NO: 32.
- TfR-binding peptides bind to TfR with equal, similar, or greater affinity (e.g., lower dissociation constant K D ) as compared to endogenous molecules (e.g., transferrin, holotransferrin (iron-bound transferrin), apotransferrin (transferrin not bound to iron), or any other endogenous TfR ligands) or other exogenous molecules.
- endogenous molecules e.g., transferrin, holotransferrin (iron-bound transferrin), apotransferrin (transferrin not bound to iron), or any other endogenous TfR ligands
- the peptide can have a K D of less than 50 mM, less than 5 pM, less than 500 nM, less than 100 nM, less than 40 nM, less than 30 nM, less than 20 nM, less than 10 nM, less than 5 nM, less than 2 nM, less than 1 nM, less than 0.5 nM, less than 0.4 nM, less than 0.3 nM, less than 0.2 nM, or less than 0.1 nM.
- peptide transport by TfR is improved by having a lower affinity (e.g., a higher dissociation constant K D ) as compared to endogenous molecules.
- peptide transport by TfR is improved by having a faster off rate or higher k 0ff than endogenous molecules.
- the off rate or k 0ff is similar to that of transferrin.
- peptide transport is improved by having a faster on rate or a higher k on , optionally such as higher than that of transferrin.
- one or more conserved residues at the transferrin (Tf)-TfR-binding interface are also present in the amino acid sequences of the peptides described herein.
- a TfR-binding peptide has an off rate that is slower than the recycling rate of TfR, such that the TfR-binding peptide is likely to remain bound to TfR during the recycling process.
- the TfR-binding peptide may have an off rate that is no faster than 1 minute, no faster than 2 minutes, no faster than 3 minutes, no faster than 4 minutes, no faster than 5 minutes, no faster than 7 minutes, no faster than 10 minutes, no faster than 15 minutes, or no faster than 20 minutes.
- the TfR-binding peptide may have an off rate that is from about 1 minute to about 20 minutes, from about 2 minutes to about 15 minutes, from about 2 minutes to about 10 minutes, or from about 5 minutes to about 10 minutes.
- TfR-binding peptides that exhibit an improved TfR receptor binding show improved transcytosis function, improved endocytosis function, improved recycling, or combinations thereof. In some embodiments, TfR-binding peptides that exhibit an improved TfR receptor binding show no or small changes in transcytosis function, endocytosis function, recycling, or combinations thereof. In some embodiments, TfR-binding peptides that exhibit an improved TfR receptor binding show reduced transcytosis function, reduced endocytosis function, reduced recycling, or combinations thereof.
- the TfR-binding peptide binds at a site of high homology between human and murine TfR, including one or more, or all, of the amino acid domains corresponding to residues 506-510, 523-531, and 611-662 of the human TfR (SEQ ID NO: 190,
- the regions of TfR to which the peptides disclosed herein or variants thereof bind all or in part to such TfR domains In some embodiments, the peptides disclosed herein bind to any one, any two, or all three of the TfR regions of high homology including the amino acid domains corresponding to residues 506-510, 523-531, and 611-662 of the human TfR (SEQ ID NO: 190). In some embodiments the peptides disclosed herein bind at least to the domain corresponding to residues 611-662 of the human TfR.
- the K A and KD values of a TfR-binding peptide can be modulated and optimized (e.g., via amino acid substitutions) to provide an optimal ratio of TfR-binding affinity and efficient transcytosis function.
- peptides disclosed herein or variants thereof bind to TfR at residues found in the binding interface (e.g., the binding domain or the binding pocket) of TfR with other exogenous or endogenous ligands (e.g., transferrin (Tf), Tf derivatives, or Tf-like peptides or proteins).
- Tf transferrin
- Tf derivatives Tf derivatives
- Tf-like peptides or proteins Tf-like peptides or proteins
- a peptide disclosed herein or a variant thereof, which binds to TfR comprises at least 70% homology, at least 75% homology, at least 80% homology, at least 85% homology, at least 90% homology, at least 95% homology, at least 96% homology, at least 97% homology, at least 98% homology, or at least 99% homology or at least 100% homology to a sequence that binds residues of TfR, which makeup the binding pocket.
- a peptide disclosed herein or a variant thereof, which binds to TfR comprises at least 70% homology, at least 75% homology, at least 80% homology, at least 85% homology, at least 90% homology, at least 95% homology, at least 96% homology, at least 97% homology, at least 98% homology, or at least 99% homology or at least 100% homology to an endogenous or exogenous polypeptide known to bind TfR, for example, endogenous Transferrin or any one of the peptides listed in TABLE 1.
- a peptide described herein binds to a protein of interest, which comprises at least 70% homology, at least 75% homology, at least 80% homology, at least 85% homology, at least 90% homology, at least 95% homology, at least 96% homology, at least 97% homology, at least 98% homology, or at least 99% homology or at least 100% homology to TfR, a fragment, homolog, or a variant thereof.
- peptides disclosed herein or variants thereof bind regions of TfR that comprise the amino acid residues corresponding to residues 506-510, 523-531, and 611-662 (the numbering of these amino acid residues is based on the following Uniprot reference protein sequence of endogenous human TFRC UniProtKB - P02786 (SEQ ID NO: 190, TFR1 HUMAN)).
- the regions of TfR to which the peptides disclosed herein or variants thereof bind overlap with those of Tf, a fragment, homolog, or a variant thereof.
- a nucleic acid, vector, plasmid, or donor DNA comprises a sequence that encodes a peptide, peptide construct, a peptide complex, or variant or functional fragment thereof, as described in the present disclosure.
- certain parts or fragments of TfR-binding motifs e.g., conserved binding motifs
- TfR-binding motifs can be grafted onto a peptide or peptide complex with a sequence of any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64.
- peptides can cause TfR to be degraded, prevent TfR from localizing to a cell’s nucleus, or prevent TfR from interacting with transferrin or transferrin-like proteins.
- a peptide can be selected for further testing or use based upon its ability to bind to the certain amino acid residue or motif of amino acid residues.
- the certain amino acid residue or motif of amino acid residues in TfR can be identified an amino acid residue or sequence of amino acid residues that are involved in the binding of TfR to Tf.
- a certain amino acid residue or motif of amino acid residues can be identified from a crystal structure of the TfR:Tf complex.
- peptides e.g., CDPs
- the peptides, peptide complexes e.g., peptide conjugates or fusion peptides
- selective delivery complexes comprising one or more of the amino acid sequences set forth in SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64 can bind to a protein of interest.
- the protein of interest is a TfR.
- the peptides and peptide complexes that bind to a TfR comprise at least one of the amino acid sequences set forth in SEQ ID NO: 96, SEQ ID NO: 65
- peptides, peptide complexes (e.g., peptide conjugates and fusion molecules) of the present disclosure that bind to a TfR comprise peptide derivatives or variants having at least 70% homology, at least 75% homology, at least 80% homology, at least 85% homology, at least 90% homology, at least 95% homology, at least
- peptides or peptide complexes e.g., peptide conjugates and fusion molecules
- peptide derivatives or variants having at least 70% homology, at least 75% homology, at least 80% homology, at least 85% homology, at least 90% homology, at least 95% homology, at least
- TABLE 1 lists exemplary peptide sequences according to the methods and compositions of the present disclosure.
- a TfR-binding peptide disclosed herein comprises GSREGCAX1RCX2KYX4DEX2X3KCX3ARMMSMSNTEEDCEQEX2EDX2X2YCX2X3X5CX5 X 1 X 4 (SEQ ID NO: 148) or
- Xi can be independently selected from S, T, D, or N
- X 2 can be independently selected from A, M, I, L, or V
- X 3 can be independently selected from D, E, N, Q, S, or T
- X 4 can be independently selected from D, E, H, K, R, N, Q, S, or T
- X 5 can be independently selected from H, K, R, N, Q, S, or T.
- a TfR-binding peptide disclosed herein comprises GSREX1CX2X3RCX4KYX5DEX6X7KCX8ARMMSMSNTEEDCEQELEDLLYCLDHCHSQ (SEQ ID NO: 149) or REX 1 CX 2 X 3 RCX 4 KYX 5 DEX 6 X 7 KCX 8 ARMMSMSNTEEDCEQELEDLLYCLDHCHSQ (SEQ ID NO: 168), wherein X1, X2, X3, X4, X5, X6, X7 and X8 are TfR binding interface residues and can independently be any amino acid.
- a TfR-binding peptide disclosed herein comprises GSREGCASRCMKYNDELEKCEARMMSMSNTEEDCEQEX1EDX2X3YCX4X5X6CX7X8X9 (SEQ ID NO: 150) or REGCASRCMKYNDELEKCEARMMSMSNTEEDCEQEX 1 EDX 2 X 3 YCX 4 X 5 X 6 CX 7 X 8 X 9 (SEQ ID NO: 169), wherein X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , and X 9 are TfR binding interface residues and can independently be any amino acid.
- a TfR-binding peptide disclosed herein comprises GSREX 1 CX 2 X 3 RCX 4 KYX 5 DEX 6 X 7 KCX 8 ARMMSMSNTEEDCEQEX 9 EDX 10 X 11 YCX 12 X 13 X 1 3CX15X16X17 (SEQ ID NO: 151) or REX 1 CX 2 X 3 RCX 4 KYX 5 DEX 6 X 7 KCX 8 ARMMSMSNTEEDCEQEX 9 EDX 10 X 11 YCX 12 X 13 X 13 C X 15 X 16 X 17 (SEQ ID NO: 170), wherein X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X15, X16 and X17 are TfR
- a TfR-binding peptide disclosed herein comprises GSREGCASRCMKYNDELEKCEARMMSMSNTEEDCEQELEDLLYCLDHCHSQ (SEQ ID NO: 32).
- a TfR-binding peptide disclosed herein comprises X 1 X 2 X 3 X 4 GX 5 ASX 6 X 7 MX 8 X 9 NX 10 X 11 LEX 12 X 13 EX 14 X 15 X 16 X 17 X 18 X 19 X 20 X 21 X 22 X 23 X 24 X 25 X 26 X 27 X 28 X 29 X 30 X 31 X 32 X 33 X 34 X 35 X 36 X 37 X 38 X 39 X 40 X 41 X 42 X 43 (SEQ ID NO: 152), wherein X 1 , X 2 , X3, X4, X5, X6, X7, X8, X9, X10
- a TfR-binding peptide disclosed herein comprises X1X2X3X4X5X6X7X8X9X10X11X12X13X14X15X16X17X18X19X20X21X22X23X24X25X26X27X28X29X30 X 31 X 32 X 33 X 34 X 35 X 36 X 37 LX 38 X 39 LLX 40 X 41 LDHX 42 HSQ (SEQ ID NO: 153), wherein X 1 , X 2 , X 3 , X4, X5, X6, X7, X8, X9, X10, X11, X12, X13, X14, X15, X16, X17, X18, X19, X20, X21, X22, X23, X24, X25, X26, X27, X28, X29, X30
- a TfR-binding peptide disclosed herein comprises X1X2X3X4GX5ASX6X7MX8X9NX10X11LEX12X13EX14X15X16X17X18X19X20X21X22X23X24X25X26 X 27 X 28 X 29 LX 30 X 31 LLX 32 X 33 LDHX 34 HSQ (SEQ ID NO: 154), wherein X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , X 17 , X 18 , X 19 , X 20 , X 21 , X 22 , X 23 , X 24 , X 25 , X 26 , X
- a TfR-binding peptide or peptide complex disclosed herein comprises at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 100% sequence homology to any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64, or any variant, homolog, or functional fragment thereof.
- a TfR-binding peptide or peptide complex disclosed herein comprises any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64, or any variant, homolog, or functional fragment thereof.
- a peptide that binds to a TfR comprises the amino acid sequence set forth in SEQ ID NO: 32.
- a TfR-binding peptide comprises canonical amino acid residues as surface interface residues at any one of the corresponding positions 5, 7, 8, 14, 17, 18, 21, 38, 42, 45, 46, 47, 50, 51, with reference to SEQ ID NO: 32 or a combination thereof.
- a TfR-binding peptide comprises canonical amino acid residues as surface interface residues at any one of the corresponding positions G5, A7, S8, N14, L17, E18, E21, L38, L42, L45, D46, H47, S50, Q51, with reference to SEQ ID NO: 32 or a combination thereof.
- the peptide or peptide complex of the present disclosure comprises at least one or more of these corresponding residues in SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64.
- Such peptides can accordingly be engineered with enhanced binding to TfR.
- a TfR-binding peptide disclosed herein comprises X1X2X3X4GX5ASX6X7X8X9X10NX11X12LEX13X14EX15X16X17X18X19X20X21X22X23X24X25X26X2 7 X 28 X 29 X 30 LX 31 X 32 X 33 LX 34 X 35 LDHX 36 X 37 SQ (SEQ ID NO: 155), wherein X 1 , X 2 , X 3 , X 4 , X 5 , X6, X7, X8, X9, X10, X11, X12, X13, X14, X15, X16, X17, X18, X19, X20, X21, X22, X23, X24, X25, X26, X27, X28, X29, X30, X31, X32
- surface-distal hydrophilic amino acid residues e.g., D, E, H, K, R, N, Q, S, or T
- a peptide as disclosed herein comprises a hydrophilic amino acid residue at any one of the corresponding positions 3, 4, 9, 11, 15, 16, 19, 23, 26, 28, 29, 30, 31, 32, 33, 35, 36, 37, 39, 40, with reference to SEQ ID NO: 32, or any combination thereof.
- a peptide of the present disclosure comprises hydrophilic amino acid residues at the following corresponding positions: R3, E4, R9, K12, D15, E16, K19, R23, S26, S28, N29, T30, E31, E32, D33, E35, Q36, E37, E39, D40, with reference to SEQ ID NO: 32, or any combination thereof.
- any one of or any combination of corresponding positions R3, E4, R9, K12, D15, E16, K19, R23, S26, S28, N29, T30, E31, E32, D33, E35, Q36, E37, E39, D40 with reference to SEQ ID NO: 32, can be mutated to another hydrophilic residue without significantly impacting solubility or TfR-binding.
- a TfR-binding peptide disclosed herein comprises X 1 X 2 REX 3 X 4 X 5 X 6 RX 7 X 8 KX 9 X 10 DEX 11 X 12 KX 13 X 14 X 15 RX 16 X 17 SX 18 SNTEEDX 19 EQEX 20 EDX 21X22X23X24X25X26X27X28X29X30X31 (SEQ ID NO: 156), wherein X1, X2, X3, X4, X5, X6, X7, X8, X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , X 17 , X 18 , X 19 , X 20 , X 21 , X 22 , X 23 , X 24 , X 25 , X 26 , X 27 , X 28 , X 29 , X 30 ,
- a TfR-binding peptide disclosed herein comprises GSX1X2GCASX3CMX4YNX5X6LEX7CEAX8MMX9MX10X11X12X13X14X15CX16X17X18LX19X2 0 LLYCLDHCHSQ (SEQ ID NO: 157) or X1X2GCASX3CMX4YNX5X6LEX7CEAX8MMX9MX10X11X12X13X14X15CX16X17X18LX19X20L LYCLDHCHSQ (SEQ ID NO: 171), wherein X1, X2, X3, X4, X5, X6, X7, X8, X9, X10, X11, X12, X 13 , X 14 , X 15 , X 16 , X 17 , X 18 , X 19 , and X 20 can be independently selected from D, E, H,
- a peptide of the present disclosure comprises cysteine amino acid residues at corresponding positions 4, 8, 18, 32, 42, and 46 with reference to SEQ ID NO: 96. In some embodiments, a peptide of the present disclosure comprises cysteine amino acid residues at corresponding positions 6, 10, 20, 34, 44, and 48 with reference to SEQ ID NO: 32. In some embodiments, a peptide of the present disclosure comprises hydrophilic residues (e.g., D, E, H, K, R, N, Q, S, or T) at corresponding positions 15, 35, 39, 49, with reference to SEQ ID NO: 32, or any combination thereof.
- hydrophilic residues e.g., D, E, H, K, R, N, Q, S, or T
- a peptide of the present disclosure comprises hydrophilic amino acid residues at the following corresponding positions: D15, E35, E39, H49, with reference to SEQ ID NO: 32, or any combination thereof.
- any one of or any combination of corresponding positions D15, E35, E39, H49 with reference to SEQ ID NO: 32 can be mutated to another hydrophilic residue without significantly impacting solubility or TfR-binding.
- a TfR-binding peptide disclosed herein comprises.
- a TfR-binding peptide disclosed herein comprises X1X2X3X4X5X6X7X8X9X10X11X12X13X14DX15X16X17X18X19X20X21X22X23X24X25X26X27X28X29X 30 X 31 X 32 X 33 EX 34 X 35 X 36 EX 37 X 38 X 39 X 40 X 41 X 42 X 43 X 44 X 45 HX 46 X 47 (SEQ ID NO: 158), wherein X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 , X 17 , X 18 , X 19 , X 20 , X 21 , X 22 ,
- a TfR- binding peptide disclosed herein comprises GSREGCASRCMKYNX 1 ELEKCEARMMSMSNTEEDCX 2 QELX 3 DLLYCLDHCX 4 SQ (SEQ ID NO: 159) or REGCASRCMKYNX 1 ELEKCEARMMSMSNTEEDCX 2 QELX 3 DLLYCLDHCX 4 SQ (SEQ ID NO: 172), wherein X 1 , X 2 , X 3 , and X 4 can be independently selected from D, E, H, K, R, N, Q, S, or T.
- a peptide of the present disclosure comprises hydrophobic residues (e.g., A, M, I, L, V, F, W, or Y) at corresponding positions 15, 35, 39, 49, with reference to SEQ ID NO: 32, or any combination thereof.
- hydrophobic residues e.g., A, M, I, L, V, F, W, or Y
- a TfR-binding peptide disclosed herein comprises GSREGCASRCMKYNX 1 ELEKCEARMMSMSNTEEDCX 2 QELX 3 DLLYCLDHCX 4 SQ (SEQ ID NO: 160) or REGCASRCMKYNX1ELEKCEARMMSMSNTEEDCX2QELX3DLLYCLDHCX4SQ (SEQ ID NO: 173), wherein X 1 , X 2 , X 3 , and X 4 can be independently selected from A, M, I, L, V, F, W, or Y.
- hydrophilic amino acid residues at any one of the corresponding positions 15, 35, 39, and 49, with reference to SEQ ID NO: 32 are associated with higher binding affinity for TfR (e.g., target engagement) and higher solubility.
- mutation of an amino acid residue at any one of the corresponding positions 15, 35, 39, and 49, with reference to SEQ ID NO: 32, from a hydrophobic to a hydrophilic residue can lead to higher binding affinity for TfR (e.g., target engagement) and higher solubility.
- a peptide of the present disclosure comprises hydrophobic residues (e.g., A, M, I, L, V, F, W, or Y) at corresponding positions 11, 25, 27, with reference to SEQ ID NO: 32, or any combination thereof.
- a peptide of the present disclosure comprises hydrophilic residues (e.g., D, E, H, K, R, N, Q, S, or T) at corresponding positions 11, 25, 27, with reference to SEQ ID NO: 32, or any combination thereof.
- hydrophobic amino acid residues at any one of the corresponding positions 11, 25, and 27, with reference to SEQ ID NO: 32 are associated with higher binding affinity for TfR (e.g., target engagement) and higher solubility.
- mutation of an amino acid residue at any one of the corresponding positions 11, 25, and 27, with reference to SEQ ID NO: 32, from a hydrophilic residue to a hydrophobic residue can lead to higher binding affinity for TfR (e.g., target engagement) and higher solubility.
- a peptide of the present disclosure comprises hydrophobic amino acid residues at the corresponding positions M11, M25, M27, with reference to SEQ ID NO: 32, or any combination thereof.
- a peptide comprises the hydrophobic amino acid residues at the corresponding positions M11, M25, and M27, with reference to SEQ ID NO: 32.
- any combination of the corresponding positions M11, M25, and M27, with reference to SEQ ID NO: 32 can be mutated to another hydrophobic residue without significantly impacting solubility or TfR-binding.
- a TfR-binding peptide disclosed herein comprises X1X2X3X4X5X6X7X8X9X10MX11X12X13X14X15X16X17X18X19X20X21X22X23MX24MX25X26X27X28 X 29 X 30 X 31 X 32 X 33 X 34 X 35 X 36 X 37 X 38 X 39 X 40 X 41 X 42 X 43 X 44 X 45 X 46 X 47 X 48 (SEQ ID NO: 161), wherein X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , X 16 ,X 17 , X 18 , X 19 , X 20 , X 21 ,
- a TfR-binding peptide disclosed herein comprises GSREGCASRCX1KYNDELEKCEARMX2SX3SNTEEDCEQELEDLLYCLDHCHSQ (SEQ ID NO: 162) or REGCASRCX 1 KYNDELEKCEARMX 2 SX 3 SNTEEDCEQELEDLLYCLDHCHSQ (SEQ ID NO: 174), wherein X 1 , X 2 , and X 3 can be independently selected from A, M, I, L, V, F, W, or Y.
- a TfR-binding peptide disclosed herein comprises GSREGCASRCX 1 KYNDELEKCEARMX 2 SX 3 SNTEEDCEQELEDLLYCLDHCHSQ (SEQ ID NO: 163) or REGCASRCX1KYNDELEKCEARMX2SX3SNTEEDCEQELEDLLYCLDHCHSQ (SEQ ID NO: 175), wherein X1, X2, and X3 can be independently selected from D, E, H, K, R, N, Q, S, or T.
- a peptide of the present disclosure comprises an aliphatic amino acid residue (e.g., A, M, I, L, or V) at corresponding position 45, with reference to SEQ ID NO: 32.
- a peptide of the present disclosure comprises an aromatic amino acid residue (e.g., F, W, or Y) at corresponding position 45.
- an aliphatic amino acid residue at corresponding position 45 is associated with higher binding affinity to TfR.
- a peptide comprises the aliphatic amino acid residue corresponding to L45, with reference to SEQ ID NO: 32.
- mutation of an amino acid residue at corresponding position 45 from an aromatic residue to an aliphatic reside can lead to higher binding affinity for TfR (e.g., target engagement) and higher solubility.
- mutating corresponding position L45 to another aliphatic residue may not significantly impact solubility or TfR-binding.
- a TfR-binding peptide disclosed herein comprises X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 X 15 X 16 X 17 X 18 X 19 X 20 X 21 X 22 X 23 X 24 X 25 X 26 X 27 X 28 X 29 X 30 X 31 X 32 X 33 X 34 X 35 X 36 X 37 X 38 X 39 X 40 X 41 X 42 X 43 X 44 LX 45 X 46 X 47 X 48 X 49 X 50 (SEQ ID NO: 164), wherein X1, X2, X3, X4, X5, X6, X7, X8, X9, X10, X11, X12, X13, X14, X15, X16,X17, X18, X19, X20, X
- a TfR-binding peptide disclosed herein comprises GSREGCASRCMKYNDELEKCEARMMSMSNTEEDCEQELEDLLYCX 1 DHCHSQ (SEQ ID NO: 165) or REGCASRCMKYNDELEKCEARMMSMSNTEEDCEQELEDLLYCX 1 DHCHSQ (SEQ ID NO: 176), wherein X1 can be independently selected from A, M, I, L, or V.
- a peptide of the present disclosure comprises GSREGCASRCMX 1 YNDELEX 2 CEARMMSMSNTEEDCEQELEDLLYCLDHCHSQ (SEQ ID NO: 166) or REGCASRCMX1YNDELEX2CEARMMSMSNTEEDCEQELEDLLYCLDHCHSQ (SEQ ID NO: 177), wherein X 1 and X 2 can be independently selected from K or R.
- these residues at corresponding position 12 and 19, with reference to SEQ ID NO: 32 can be used for chemical conjugation to another molecule (e.g., an active or a detectable agent).
- X 1 and X 2 are both R and chemical conjugation occurs at the N-terminus of the peptide.
- a receptor-binding peptide may be derived from an antibody or antibody fragment.
- a receptor-binding peptide may be derived from a single chain antibody fragment (scFv).
- scFv single chain antibody fragment
- TfR-binding peptides that may be incorporated into a selective depletion complex of the present disclosure include SEQ ID NO: 220 .
- a TfR-binding peptide may have a sequence of any one of SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or a fragment thereof.
- a TfR-binding peptide may have a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or a fragment thereof.
- a peptide of SEQ ID NO: 220 or SEQ ID NO: 221 may function as a pH- independent TfR-binding peptide.
- a peptide of SEQ ID NO: 222 may function as a pH-dependent TfR-binding peptide.
- mutations in any one or more of the amino acid residues of a peptide of the present disclosure can improve binding affinity of the peptide to TfR.
- mutations in 5-80% of amino acid residues of a peptide of the present disclosure improve the binding affinity of the peptide to TfR.
- mutations in 1-100%, 5-100%, or 5-50% of amino acid residues of a peptide of the present disclosure improve binding affinity of the peptide to TfR.
- mutations in 15-50% of amino acid residues of a peptide of the present disclosure improve binding affinity of the peptide to TfR.
- mutations in 15-30% of amino acid residues of a peptide of the present disclosure improve binding affinity of the peptide to TfR. In some embodiments, mutations in 25-30% of amino acid residues of a peptide of the present disclosure improve binding affinity of the peptide to TfR. For example, mutations in 14 of the 51 amino acid residues (27.5%) of a peptide having a sequence of SEQ ID NO: 32 can improve binding affinity of the peptide to TfR. [0200] In some embodiments, mutations in any one or more of the amino acid residues of a peptide of the present disclosure can lie at the binding interface of TfR.
- a mutation to a peptide can improve binding affinity, which can be beneficial to binding and transcytosis of a peptide or peptide complex disclosed herein.
- the peptides provided herein can have many mutations or few mutations to obtain optimal activity, wherein optimal activity is sufficient binding for engagement of the TfR, but not necessarily binding that is so strong as to preclude release of the peptide and/or peptide complex after transcytosis.
- peptides of the present disclosure can comprise a number of mutations (also referred to as % mutated amino acid residues) that tune binding affinity and off rate to obtain optimal binding, function (e.g., transcytosis, BBB-penetration, cell membrane penetration, transport across a biological barrier, endocytosis, recycling, or combinations thereof), and release of the peptide or peptide complex.
- mutations that result in the highest possible affinity may not necessarily correlate to a superior peptide having optimal binding and transcytosis.
- 1-100% or 5-100% of amino acid residues of a peptide of the present disclosure lie at the binding interface of TfR.
- 10-90% of amino acid residues of a peptide of the present disclosure lie at the binding interface of TfR. In some embodiments, 20-80% of amino acid residues of a peptide of the present disclosure lie at the binding interface of TfR. In some embodiments, 30-70% of amino acid residues of a peptide of the present disclosure lie at the binding interface of TfR. In some embodiments, 40-60% of amino acid residues of a peptide of the present disclosure lie at the binding interface of TfR. In some embodiments, 30-35% of amino acid residues of a peptide of the present disclosure lie at the binding interface of TfR.
- 17 of the 51 amino acid residues (33%) of a peptide having a sequence of SEQ ID NO: 32 can lie at the binding interface of TfR.
- mutations in any one or more of the amino acid residues of a peptide of the present disclosure that lie at the binding interface of TfR can improve binding affinity of the peptide to TfR.
- mutations in 1-100% or 5-100% of amino acid residues of a peptide of the present disclosure that lie at the binding interface of TfR improve binding affinity of the peptide to TfR.
- mutations in 5-80% of amino acid residues of a peptide of the present disclosure that lie at the binding interface of TfR improve binding affinity of the peptide to TfR. In some embodiments, mutations in 10-70% of amino acid residues of a peptide of the present disclosure that lie at the binding interface of TfR improve binding affinity of the peptide to TfR. In some embodiments, mutations in 15-60% of amino acid residues of a peptide of the present disclosure that lie at the binding interface of TfR improve binding affinity of the peptide to TfR.
- mutations in 20-50% of amino acid residues of a peptide of the present disclosure that lie at the binding interface of TfR improve binding affinity of the peptide to TfR. In some embodiments, mutations in 25-30% of amino acid residues of a peptide of the present disclosure that lie at the binding interface of TfR improve binding affinity of the peptide to TfR. For example, mutations in 5 of the 17 amino acid residues (29%) of a peptide having a sequence of SEQ ID NO: 32 that lie at the binding interface of TfR and can improve binding affinity of the peptide to TfR.
- mutations in any one or more of the amino acid residues of a peptide of the present disclosure are distal to the binding interface of TfR. In some embodiments, 1-100% or 5-100% of amino acid residues of a peptide of the present disclosure are distal to the binding interface of TfR. In some embodiments, 10-90% of amino acid residues of a peptide of the present disclosure are distal to the binding interface of TfR. In some embodiments, 20-80% of amino acid residues of a peptide of the present disclosure are distal to the binding interface of TfR. In some embodiments, 30-70% of amino acid residues of a peptide of the present disclosure are distal to the binding interface of TfR.
- 40- 60% of amino acid residues of a peptide of the present disclosure are distal to the binding interface of TfR. In some embodiments, 65-70% of amino acid residues of a peptide of the present disclosure are distal to the binding interface of TfR. For example, 34 of the 51 amino acid residues (66%) of a peptide having a sequence of SEQ ID NO: 32 can lie at the binding interface of TfR. [0204] In some embodiments, mutations in any one or more of the amino acid residues of a peptide of the present disclosure are distal to the binding interface of TfR improve binding affinity of the peptide to TfR.
- mutations in 1-100% or 5-100% of amino acid residues of a peptide of the present disclosure that are distal to the binding interface of TfR improve binding affinity of the peptide to TfR.
- mutations in 5-80% of amino acid residues of a peptide of the present disclosure that are distal to the binding interface of TfR improve binding affinity of the peptide to TfR.
- mutations in 10- 70% of amino acid residues of a peptide of the present disclosure that are distal to the binding interface of TfR improve binding affinity of the peptide to TfR.
- mutations in 15-60% of amino acid residues of a peptide of the present disclosure that are distal to the binding interface of TfR improve binding affinity of the peptide to TfR. In some embodiments, mutations in 20-50% of amino acid residues of a peptide of the present disclosure that are distal to the binding interface of TfR improve binding affinity of the peptide to TfR. In some embodiments, mutations in 25-30% of amino acid residues of a peptide of the present disclosure that are distal to the binding interface of TfR improve binding affinity of the peptide to TfR.
- mutations in 5 of the 17 amino acid residues that are distal to the binding interface of TfR can improve binding affinity of the peptide to TfR.
- mutations in 9 of the 34 amino acid residues (26.5%) of a peptide having a sequence of SEQ ID NO: 32 that are distal to the binding interface of TfR can improve binding affinity of the peptide to TfR.
- one or more mutations in the amino acid residues of the peptide that are distal to the binding interface of TfR can improve protein folding, enhance protein solubility, and/or alter the backbone geometry that can improve binding through an optimized interface shape complementarity.
- a receptor-binding peptide of the present disclosure may be a PD- L1-binding peptide.
- the PD-L1-binding peptide may be incorporated into a selective depletion complex of the present disclosure to facilitate selective depletion of a target molecule via PD- L1-mediated endocytosis.
- the PD-L1-binding peptide that is a receptor- binding peptide may bind PD-L1 with an affinity that is pH-independent (for example, a similar affinity at extracellular pH and at an endosomal pH) or may bind PD-L1 with an affinity that is pH-dependent (for example, a higher affinity at extracellular pH and a lower affinity at an endosomal pH).
- pH-independent for example, a similar affinity at extracellular pH and at an endosomal pH
- pH-dependent for example, a higher affinity at extracellular pH and a lower affinity at an endosomal pH
- a PD-L1-binding peptide disclosed herein comprises a sequence of X 1 X 2 X 3 CX 4 X 5 X 6 CX 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 X 15 CX 16 X 17 X 18 X 19 X 20 X 21 X 22 X 23 X 24 X 25 X 26 X 27 X 28 C X 29 X 30 X 31 X 32 X 33 X 34 X 35 X 36 X 37 CX 38 X 39 X 40 CX 41 X 42 X 43 (SEQ ID NO: 392), wherein X 1 can independently be selected from E, M, V, or W; X 2 can independently be selected from G, E, L, or F; X 3 can independently be selected from D, E, or S; X 4 can independently be selected from K, R, or V;
- X 24 can independently be selected from G, A, E, N, Q, T, I, V, or P;
- X 25 can independently be selected from G, D, N, Q, T, L, V, F, or P;
- X 26 can independently be selected from G, A, E, K, R, N, Q, S, T, I, Y, or P;
- X 27 can independently be selected from A, D, N, or I;
- X 28 can independently be selected from G, D, E, H, N, F, or W;
- X 29 can independently be selected from G, A, E, N, S, Y, or P;
- X 30 can independently be selected from G, M, or L;
- X 31 can independently be selected from G, A, D, K, N, Q, or W;
- X 32 can independently be selected from D, E, H, K, N, Q, S, T, L, V, F,
- a binding peptide disclosed herein comprises a sequence of
- X 1 can independently be selected from any noncysteine amino acid
- X 2 can independently be selected from M, I, L, or V
- X 3 can independently be selected from Y, A, H, K, R, N, Q, S, or T
- X 4 can independently be selected from D, E, N,
- X 5 can independently be selected from K or P; and X 6 can independently be selected from D or K.
- a PD-L1 -binding peptide may comprise a PD-L1 -binding motif that forms part or all of a binding interface with PD-L1.
- One or more residues of a PD-L1 -binding motif may interact with one or more residues of PD-L1 at the binding interface between the PD-L1 -binding peptide and PD-L1.
- multiple PD-Ll-binding motifs may be present in a PD-L1- binding peptide.
- a PD-Ll-binding motif may comprise a sequence of CX 1 X 2 X 3 CX 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 C (SEQ ID NO: 394), wherein X 1 can independently be selected from K, R, or V; X 2 can independently be selected from E, Q, S, M, L, or V; X 3 can independently be selected from D, E, H, K, R, N, Q, S, or Y; X 4 can independently be selected from D, M, or V; X 5 can independently be selected from A, K, R, Q, S, or T; X 6 can independently be selected from A, D, E, H, Q, S, T, M, I, L, V, or W; X 7 can independently be selected from A, E, R, Q, S, T, W, or P; X 8 can independently be selected from A, E, K, R, N, Q, T, M, I, L, V, or W
- a PD-Ll-binding motif may comprise a sequence of CKVX 1 CVX 1 X 1 X 1 X 1 X 2 X 3 KX 1 C (SEQ ID NO: 396), wherein X 1 can independently be selected from any non-cysteine amino acid; X 2 can independently be selected from M, I, L, or V; and X 3 can independently be selected from Y, A, H, K, R, N, Q, S, or T.
- a PD-Ll-binding motif may comprise a sequence of CKVHCVKEWMAGKAC (SEQ ID NO: 398).
- a PD-Ll-binding motif may comprise at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% identity to SEQ ID NO: 398.
- a PD-Ll-binding motif may comprise a sequence of X 1 X 2 X 3 X 4 X 5 X 6 CX 7 X 8 X 9 C (SEQ ID NO: 395), wherein X 1 can independently be selected from D, E, H, K, N, Q, S, T, L, V, F, Y, or P; X 2 can independently be selected from G, E, Q, or F; X 3 can independently be selected from D or K; X 4 can independently be selected from G, V, or P; X 5 can independently be selected from G, H, R, V, F, W, or P; X 6 can independently be selected from A, D, or K; X 7 can independently be selected from E, H, Q, L, or F; X 8 can independently be selected from D, E, R, S, T, M, L, or F; and X 9 can independently be selected from G, A, D, E, H, K, R, M, L, or P.
- a PD-Ll-binding motif may comprise a sequence of X 1 FX 2 VFX 2 CLX 3 X 3 C (SEQ ID NO: 397), wherein X 1 can independently be selected from K or P; X 2 can independently be selected from D or K; and X 3 can independently be selected from any noncysteine amino acid.
- a PD-Ll-binding motif may comprise a sequence of KFDVFKCLDHC (SEQ ID NO: 399).
- a PD-Ll-binding motif may comprise at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% identity to SEQ ID NO: 399.
- a PD-Ll-binding peptide (e g., any one of SEQ ID NO: 187, SEQ ID NO: 233 - SEQ ID NO: 239, SEQ ID NO: 400 - SEQ ID NO: 456, or SEQ ID NO: 240, or a pH-independent variant thereof) with high affinity PD-Ll-binding at endosomal pH may be complexed with a target-binding peptide as described herein to form a selective depletion complex for selective depletion of the target molecule.
- the selective depletion complex can be used to selectively deliver a target molecule across a cellular layer or membrane.
- the selective depletion complex can be used to selectively deliver the target molecule to an endocytic compartment via PD-L1-mediated endocytosis.
- the target molecule can be selectively depleted upon binding to the target-binding peptide of the selective depletion complex and endocytosis via PD-L1-mediated endocytosis as described.
- Selective depletion of a target molecule using PD-L1-mediated endocytosis may be used to selectively deplete the target molecule specifically in tissues that express PD-L1.
- a selective depletion complex comprising a receptor-binding peptide that binds PD-L1 may be used to selectively deplete a target molecule in a PD-L1 positive cancer, a lung tissue, a pancreatic islet tissue, a lymphoid tissue, a gastrointestinal tissue, a bone marrow tissue, a reproductive tissue, a muscle tissue, an adipose tissue, or any other PD-L1 positive tissue.
- a selective depletion complex comprising a PD-L1-binding peptide and an ACE2- binding peptide may be used to selectively deplete ACE2 in lung tissue to prevent a viral infection (e.g., a SARS-CoV-2 infection).
- a selective depletion complex comprising a PD-L1-binding peptide and an HLA-binding peptide may be used to selectively deplete HLA in pancreatic islet cells to prevent T-cell attack of insulin-expressing cells in type I diabetes.
- a PD-L1-binding peptide e.g., any one of SEQ ID NO: 187, SEQ ID NO: 233 ⁇ SEQ ID NO: 239, SEQ ID NO: 400 ⁇ SEQ ID NO: 456, or SEQ ID NO: 240
- a selective depletion complex to selectively deplete PD-L1 may comprise a receptor-binding peptide that does not bind PD-L1 (e.g., a TfR-binding peptide) and a PD-L1- binding peptide (e.g., a pH dependent PD-L1-binding peptide).
- a receptor-binding peptide that does not bind PD-L1 e.g., a TfR-binding peptide
- a PD-L1- binding peptide e.g., a pH dependent PD-L1-binding peptide
- a selective depletion complex to selective deplete a target that is not PD-L1 may comprise a target-binding peptide that binds the target (e.g., an EGFR-binding peptide) and a PD-L1- binding peptide (e.g., a pH-independent PD-L1-binding peptide).
- Target-Binding Peptides [0213] Peptides, peptide complexes, or selective depletion complexes of the present disclosure can comprise a target-binding peptide.
- the target-binding peptide can be capable of binding a target molecule (e.g., a target protein).
- the target-binding peptide can bind to the target molecule with an affinity that is pH dependent
- the target binding peptide can bind the target molecule with a higher affinity at an extracellular pH (such as about pH 7.4) than at an endosomal pH (such as about pH 5.5).
- a target-binding peptide can be conjugated to a receptor-binding peptide of the present disclosure (e.g., a TfR-binding peptide any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64 or a PD- L1 -binding peptide of any one of SEQ ID NO: 187, SEQ ID NO: 233 - SEQ ID NO: 239, SEQ ID NO: 400 - SEQ ID NO: 456, or SEQ ID NO: 241) to form a selective depletion complex.
- a receptor-binding peptide of the present disclosure e.g., a TfR-binding peptide any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ
- the selective depletion complex can be used to selectively deliver a target molecule across a cellular layer or membrane (e.g., BBB or cell membrane).
- the selective depletion complex can be used to selectively deliver the target molecule to an endocytic compartment via receptor-mediated endocytosis (e.g., PD-L1 -mediated endocytosis or TfR-mediated endocytosis).
- the target molecule can be selectively depleted upon binding to the target-binding peptide of the selective depletion complex and endocytosis via receptor-mediated endocytosis.
- the target molecule can be a soluble molecule.
- the target molecule can be a secreted peptide or protein, a cell signaling molecule, an extracellular matrix macromolecule (e.g., collagen, elastin, microfibrillar protein, or proteoglycan), a neurotransmitter, a cytokine, a growth factor, a tumor associated antigen, a tumor specific antigen, or a hormone.
- the target molecule can be a cell surface molecule.
- the target molecule can be a transmembrane protein, a receptor, including a growth factor receptor, a checkpoint inhibitor, an immune checkpoint inhibitor, an inhibitory immune receptor, a ligand of an inhibitory immune receptor, a macrophage surface protein (e.g., CD14 or CD16), a lipopolysaccharide, or an antibody.
- An inhibitory immune receptor may be CD200R, CD300a, CD300f, CEACAM1, FcgRiib, ILT-2, ILT-3, ILT-4, ILT-5, LAIR-1, PEC AM-1, PILR-alpha, SIRL-1, and SIRP- alpha, CLEC4A, Ly49Q, MICL.
- a selective depletion complex of the present disclosure can comprise two or more target-binding peptides to promote dimerization of a target molecule. Promoting dimerization can increase internalization of the target molecule, resulting in selective depletion of the target molecule.
- a selective depletion complex comprising two copies of a target-binding peptide can promote homodimerization of the target molecule.
- a target-binding peptide of the present disclosure may comprise a miniprotein, a nanobody, an antibody, an IgG, an antibody fragment, a Fab, a F(ab)2, an scFv, an (scFv)2, a DARPin, or an affibody.
- the target-binding peptide may comprise a cystine-dense peptide, an affitin, an adnectin, an avimer, a Kunitz domain, a nanofittin, a fynomer, a bicyclic peptide, a beta-hairpin, or a stapled peptide.
- a target-binding peptide of the present disclosure can bind to the target molecule with an affinity that is pH-dependent.
- the target-binding peptide can bind the target molecule at an extracellular pH (such as about pH 7.4) with an affinity that is higher than the binding affinity at an endocytic pH (such as about pH 7.0, pH 6.5, pH 6.0, or pH 5.5).
- the binding affinity of the target-binding peptide for the target molecule at an extracellular pH can be at least about 1.1-fold, at least about 1.2- fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 1.6-fold, at least about 1.7-fold, at least about 1.8-fold, at least about 1.9-fold, at least about 2-fold, at least about 2.5-fold, at least about 3-fold, at least about 3.5-fold, at least about 4-fold, at least about 4.5-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8- fold, at least about 9-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 25-fold, at least about 30-fold, at least about 35-fold, at least about 40-fold, at least about 45-fold, at least about 50-fold, at least about 60-fold, at least about 70-fold, at
- the affinity of the target-binding peptide for the target at pH 6.5 or pH 5.5 is no greater than about 0.1%, about 0.5%, about 1%, about 5%, about 10%, about 20%, about 30%, about 40%, or about 50% the affinity of the target binding peptide for the target at pH 7.4.
- the affinity of the target-binding peptide for the target at pH 7.4 is at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, at least 10-fold, at least 15-fold, or at least 20-fold greater than the affinity of the target-binding peptide for the target at pH 6.5 or pH 5.5
- a target-binding peptide with pH-dependent binding can bind a target molecule with a dissociation constant (K D ) of less than 50 mM, less than 5 pM, less than 500 nM, less than 100 nM, less than 40 nM, less than 30 nM, less than 20 nM, less than 10 nM, less than 5 nM, less than 2 nM, less than 1 nM, less than 0.5 nM, less than 0.4 nM, less than 0.3 nM, less than
- K D dissociation constant
- a target-binding peptide with pH-dependent binding can bind a target molecule with a dissociation constant (K D ) of at least 1 nM, at least 2 nM, at least 5 nM, at least 10 nM, at least 20 nM, at least 50 nM, at least 100 nM, at least 200 nM, at least 500 nM, at least 1 ⁇ M, at least 2 ⁇ M, at least 5 ⁇ M, at least 10 ⁇ M, at least 20 ⁇ M, at least 50 ⁇ M, at least 100 ⁇ M, at least 500 ⁇ M, at least 1 mM, at least 2 mM, at least 5 mM, at least 10 mM, at least 20 mM, at least 50 mM, at least 100 mM, at least 200 mM, at least 500 mM, or at least 1 M at endosomal pH (about pH 5.5 or about pH 6.5).
- K D dissociation constant
- the target-binding molecule can release the target molecule upon internalization into an endosomal compartment and acidification of the endosome.
- Such release the target molecule upon acidification of the endosome can occur at about pH 7.3, pH 7.2, pH 7.1, pH 7.0, pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH 5.0, pH 4.9, pH 4.8, pH 4.7, pH 4.6, pH 4.5, or lower.
- release of the target molecule can occur at a pH of from about pH 7.0 to about pH 4.5, from about pH 6.5 to about pH 5.0, or from about pH 6.0 to about pH 5.5 or lower.
- Target-binding peptides with pH-dependent binding affinity can be engineered by selective integration of histidine (His) amino acid residues in the target binding interface.
- a target-binding peptide with pH-dependent binding affinity comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 histidine residues in the target binding interface.
- a target-binding peptide (e.g., a target-binding peptide with pH-dependent binding affinity) can comprise a cystine-dense peptide (CDP), an affibody, a DARPin, a centyrin, a nanofittin, or an adnectin.
- CDP cystine-dense peptide
- a target-binding CDP, a target-binding affibody, a target-binding adnectin can be stable at low pH (e.g., at endosomal pH).
- a target-binding peptide can comprise an antibody (e.g., IgG or other antibody), an antibody fragment, (e.g., scFv, scFv2, Fab, F(ab)2, or other antibody fragment), or a nanobody (e.g., a VHH-domain nanobody or VNAR-domain nanobody from camelids or sharks), which can be stable at a low pH.
- an antibody e.g., IgG or other antibody
- an antibody fragment e.g., scFv, scFv2, Fab, F(ab)2, or other antibody fragment
- a nanobody e.g., a VHH-domain nanobody or VNAR-domain nanobody from camelids or sharks
- the ionic strength of the endosomal compartment is higher than the ionic strength of the extracellular physiologic environment.
- Ionic strength which varies with salt concentration, may depend on the concentrations of various electrolytes in solution, for example hydrogen (H + ), hydroxide (OH-), hydronium (H 3 O + ), sodium (Na + ), potassium (K + ), calcium (Ca 2+ ), magnesium (Mg 2+ ), manganese (Mn 2+ ), chloride (Cl-), carbonate (CO 3 2- ), cobalt (Co 2+ ), phosphate (PO 4 3- ), or nitrate (NO 3 -).
- target- binding peptides with salt-dependent or ionic strength-dependent binding affinity can be engineered by selective integration of salt labile moieties (e.g., polar or charged amino acid side chains) in the target binding interface that would enable dissociation of the target-binding molecule in the endosome.
- salt labile moieties e.g., polar or charged amino acid side chains
- the target binding interface of the target-binding peptide may form one or more polar or charge-charge interactions with the target-binding peptide that can be disrupted as the ionic strength of the environment increases.
- a target-binding peptide with a binding affinity dependent on ionic strength could dissociate over a range of ionic strengths, for example ionic strengths from about 30 mM to about 1 M.
- an ionic strength-dependent target-binding peptide with a binding affinity dependent on ionic strength could dissociate at an ionic strength of from about 50 mM to about from about 50 mM to about 1 M, from about 60 mM to about 950 mM, from about 70 mM to about 900 mM, from about 80 mM to about 850 mM, from about 90 mM to about 800 mM, from about 100 mM to about 750 mM, from about 110 mM to about 700 mM, from about 120 mM to about 650 mM, from about 130 mM to about 600 mM, from about 140 mM to about 550 mM, from about 150 mM to about 500 mM, from about 160 mM to about 450 mM, from about 170 mM to about 400 mM, from about 180 mM to about 350 mM, from about 190 mM to about 300 mM, or from about 200
- the ionic strength-dependent target-binding peptide comprises at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 polar or charge-charge interactions in the target binding interface.
- a target-binding peptide of the present disclosure may bind to a target molecule, such as a target molecule with clinical relevance.
- a target molecule may be a soluble molecule, extracellular molecule, or cell-surface molecule.
- the target molecule is a protein, peptide, lipid, carbohydrate, a nucleic acid, or glycan.
- a target molecule may be a protein that is over-expressed or over-activated in a disease or condition.
- a target molecule may be a transmembrane protein involved in oncogenic signaling, immune suppression, or pro-inflammatory signaling.
- target molecules that may be targeted by a target-binding peptide of the present disclosure include but are not limited to CD3, CD47, CD28, CD137, CD89, CD16, CD29, CD44, CD71, CD73, CD90, CD105, CD166, CD27, CD39, CD24, CD25, CD74, CD40L, MUC1 , MUC16, MUC2, MUC5AC, MUC4, OX40, 4-1BB, HLA-G, LAG3, Tim3, TIGIT, GITR, TCR, TNF- ⁇ , EGFR, EGFRvIII, TKI-resistant EGFR, HER2, ERBB3, PDGFR, FGF, VEGF, VEGFR, IGFR1, CTLA4, STRO1, complement factor C4, complement factor C1q, complement factor C1s, complement factor C1r, complement factor C3, complement factor C3a, complement factor C3b, complement factor C5, complement factor C5a, RED ⁇ , PCSK9, P2Y6, HER3, RANK
- target molecules include mannose-6-phosphate glycans, glucose-6-phosphate, and sugar-specific receptors (e.g., lectins).
- target molecules include autoantibodies, such as rheumatoid factor, antinuclear antibody, antineutrophil cytoplasmic antiboides, anti-dsDNA, anticentromere antibodies, anithistone antibodies, cyclic citriullinated peptide antibodies, extractable nuclear antigen antibodies, cardiolipin antibodies, beta-2 glycoprotein 1 antibodies, antiphospholipid antibodies, lupus anticoagulants, diabetes-related autoantibodies, anti-tissue translugtaminase, anti-gliadin antibodies, intrinsic factor antibodies, parietal cell antibodies, thyroid autoantibodies, smooth muscle antibodies, antimitochronrial antibodies, liver kidney microsome type 1 antibodies, anti-glomerular basement membrane, acetylcholine receptor antibodies.
- autoantibodies such as rheumatoid factor, antinuclear antibody, antineutrophil
- the target molecule e.g., CD3, CD47, CD28, CD137, CD89, CD16, CD29, CD44, CD71, CD73, CD90, CD105, CD166, CD27, CD39, CD24, CD25, CD74, CD40L, MUC1 , MUC16, MUC2, MUC5AC, MUC4, OX40, 4-1BB, HLA-G, LAG3, Tim3, TIGIT, GITR, TCR, TNF- ⁇ , EGFR, EGFRvIII, TKI-resistant EGFR, HER2, ERBB3, PDGFR, FGF, VEGF, VEGFR, IGFR1, CTLA4, STRO1, complement factor C4, complement factor C1q, complement factor C1s, complement factor C1r, complement factor C3, complement factor C3a, complement factor C3b, complement factor C5, complement factor C5a, RED ⁇ , PCSK9, P2Y6, HER3, RANK, o ⁇ p, ⁇ htgjd_ y,
- a target molecule may be a transmembrane protein, such as a receptor tyrosine kinase.
- receptor tyrosine kinases that may be targeted using a selective depletion complex include EGF receptor, ErbB, Insulin receptor, PDGF receptor, VEGF receptor, FGF receptor, CCK receptor, NGF receptor, HGF receptor, Eph receptor, AXL receptor, TIE receptor, RYK receptor, DDR receptor, RET receptor, ROS receptor, LTK receptor, ROR receptor, MuSK receptor, and LMR receptor.
- a target molecule may be a pathogen (e.g., a virus or a bacteria) or a pathogen surface molecule (e.g., a protein or a glycoprotein).
- the target molecule may be a coronavirus spike protein, an influenza virus hemagglutinin, or a herpes simplex virus glycoprotein M.
- Targeting the pathogen or the pathogen surface protein using a selective depletion complex may lead to internalization and degradation of the pathogen, thereby treating or preventing an infection caused by the pathogen.
- Endocytosis and subsequent degradation of the target molecule may treat (e.g., eliminate, reduce, slow progression of, or treat symptoms of) a disease or condition associated with the target molecule.
- targeting and degradation of a receptor tyrosine kinase with a selective depletion complex may be beneficial in treating a variant of cancers.
- targeting and degrading EGFR with a selective depletion complex comprising an EGFR-binding peptide may be beneficial in treating cancers, such as non-small-cell lung cancer, primary non-small-cell lung cancer, metastatic non-small-cell lung cancer, head and neck cancer, head and neck squamous cell carcinoma, glioblastoma, brain cancer, metastatic brain cancer, colorectal cancer, colon cancer, tyrosine kinase inhibitor (TKI)-resistant cancer, cetuximab-resistant cancer, necitumumab -resistant cancer, panitumumab-resistant cancer, local cancer, regionally advanced cancer, recurrent cancer, metastatic cancer, refractory cancer,
- TKI tyrosine kinase inhibitor
- targeting and degrading TNF-a with a selective depletion complex comprising a TNF-a-binding peptide may be beneficial in treating inflammatory or neurological conditions, including those in the CNS, such as neuroinflammation, neuroinflammatory disease, stroke, traumatic brain injury, Alzheimer’s disease, or other tauopathies including neurofibrillary tangle dementia, chronic traumatic encephalopathy (CTE), aging-related tau astrogliopathy, frontotemporal dementia, parkinsonism, progressive supranuclear palsy, corticobasal degeneration, lytico-bodig disease, ganglioglioma, meningioangiomatosis, or subacute sclerosing panencephalitis.
- CTE chronic traumatic encephalopathy
- aging-related tau astrogliopathy frontotemporal dementia
- parkinsonism progressive supranuclear palsy
- corticobasal degeneration corticobasal degeneration
- lytico-bodig disease gangli
- targeting and degrading TNF- ⁇ rdoc ⁇ n ⁇ g ⁇ odq ⁇ depletion complex comprising a TNF- ⁇ -binding peptide may also be beneficial in treating inflammatory conditions that may not be localized to the CNS (e.g., ankylosing spondylitis, antiphospholipid antibody syndrome, gout, inflammatory arthritis center, myositis, rheumatoid arthritis, scleroderma, Sjogren ⁇ s disease, systemic lupus erythematosus (lupus), vasculitis, knjmd ⁇ ndn, diag ⁇ hh ⁇ ojmt ]jr ⁇ g _dn ⁇ n ⁇ , Amjci ⁇ n _dn ⁇ n ⁇ , jm pg ⁇ m ⁇ odq ⁇ ⁇ jgdodn).
- inflammatory conditions e.g., ankylosing spondylitis, antiphospholipid antibody syndrome, gout, inflammatory arthritis center, myosit
- a selective depletion complex of the present disclosure can be used to target pathogenic immune complexes, such as those in circulation. Circulating antigen-antibody complexes can be involved in autoimmune and inflammatory diseases as well as in malignancy. This can include glomerulonephritis, systemic lupus erythematosus (lupus), rheumatoid arthritis, and cutaneous vasculitis.
- a selective depletion complex of the present disclosure can be used to target a complement pathway in a complement-mediated disease, such as facioscapulohumeral muscular dystrophy (FSHD) or schizophrenia.
- FSHD facioscapulohumeral muscular dystrophy
- targeting and degrading complement factor C4, or factors upstream (e.g., complement factor C1q, complement factor C1s, or complement factor C1r) or downstream (e.g., complement factor C3, complement factor C3a, complement factor C3b, complement factor C5, or complement factor C5a) of C4 in the complement pathway, in the CNS may treat schizophrenia.
- C4 is subsequently used as an exemplar of this pathway with the understanding that other complement components regulating the activation of C4 or executing the continuation of this pathway have equal standing for regulating the biological consequences of the increased activity of this pathway.
- a composition comprising a selective depletion complex to treat schizophrenia would be beneficial.
- the complement pathway may serve as a common pathway in schizophrenia, and therapies comprising the selective depletion complexes of the present disclosure promoting degradation of C4 or a downstream complement pathway would be beneficial to patients.
- a selective depletion complex of the present disclosure may be used to target complement-mediated diseases in the central nervous system.
- a selective depletion complex comprising a peptide that binds one or more C4A forms could be used to target C4A long (e.g., including HERV incorporation) or short forms for degradation as described herein.
- Additional target molecules that may be targeted and depleted using a selective depletion complex for treatment of schizophrenia include molecules encoded by the extended MHC complex on chromosome 6, molecules encoded by the complement C4 locus (e.g., encoded by the C4Along locus or the c4Ashort locus), molecules encoded by sequences containing a single nucleotide polymorphisms in CUB and Sushi multiple domains 1 (CSMD1) gene on chromosome 8, complement factor C4, complement factor C3, or C3 receptor.
- CSMD1 Sushi multiple domains 1
- a selective depletion complex of the present disclosure may treat schizophrenia by reducing excessive synaptic pruning, preventing reduction in gray matter, and preventing psychotic symptoms in patients that are predisposed to schizophrenia by polymorphisms in C4, CSMD1 or other genes.
- a selective depletion complex for treatment of schizophrenia e.g., comprising a complement factor C4-binding peptide
- a selective depletion complex for treatment of schizophrenia may be administered in combination with an additional drug (e.g., minocycline, doxycycline, steroids, an inhibitor of C4 degradation, or an anti-psychotic agent).
- an additional drug e.g., minocycline, doxycycline, steroids, an inhibitor of C4 degradation, or an anti-psychotic agent.
- the selective depletion complexes of the present disclosure may be well-suited for treatment of CNS-associated disorders such a schizophrenia due to the ability of the selective depletion complexes to penetrate the blood-brain barrier (BBB) and access the CNS via TfR-binding.
- BBB blood-brain barrier
- a selective depletion complex (e.g., comprising a TfR-binding peptide) may facilitate higher BBB [0224]
- binding and subsequently depleting a target molecule using a selective depletion complex of the present disclosure comprising a target-binding peptide may be used to treat a disease or condition wherein the target molecule is a cell-based or soluble moiety associated with a disease or condition and is expressed or present in diseased tissues or cells.
- depletion of the target molecule may be cell type or tissue dependent.
- a target-binding peptide may comprise a sequence of any one of SEQ ID NO: 187, SEQ ID NO: 219, SEQ ID NO: 233 ⁇ SEQ ID NO: 244, or SEQ ID NO: 400 ⁇ SEQ ID NO: 456.
- a target-binding peptide may comprise a sequence having at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with any one of SEQ ID NO: 233, SEQ ID NO: 187, or SEQ ID NO: 234 ⁇ SEQ ID NO: 244, or a fragment thereof.
- a target binding peptide may comprise a sequence having at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ ID NO: 233, or the target binding peptide may comprise a sequence of SEQ ID NO: 233.
- target-binding peptides and their corresponding target molecules are provided in TABLE 3. TABLE 3 i Exemplary Target-Binding Peptides
- TfR-binding peptides or target-binding peptides of the present disclosure comprise one or more Cys, or one or more disulfide bonds.
- the TfR-binding peptides or the target-binding peptides are derived from cystine-dense peptides (CDPs), knotted peptides, or hitchins.
- CDPs cystine-dense peptides
- hitchins As used herein, the term “peptide” is considered to be interchangeable with the terms “knotted peptide”, “cystine-dense peptide”, “CDP”, and “hitchin”. (See e.g., Correnti et al. Screening, large-scale production, and structure-based classification for cystine-dense peptides. Nat Struct Mol Biol. 2018 Mar; 25(3): 270-278).
- the TfR-binding peptides of the present disclosure, or derivatives, fragments, or variants thereof, can be have an affinity and selectively for TfR, or a derivative or analog thereof.
- the target-binding peptides of the present disclosure, or derivatives, fragments, or variants thereof, can be have an affinity and selectively for a target molecule.
- the TfR-binding peptides of the present disclosure can be engineered using site-saturation mutagenesis (SSM) to exhibit improved TfR-binding properties or promote transcytosis or endocytosis more effectively.
- SSM site-saturation mutagenesis
- the target-binding peptides of the present disclosure can be engineered using site- saturation mutagenesis (SSM) to exhibit improved target-binding properties.
- the peptides of the present disclosure are cystine-dense peptides (CDPs), related to knotted peptides or hitchin-derived peptides or knottin-derived peptides.
- the TfR-binding peptides can be cystine-dense peptides (CDPs).
- Hitchins can be a subclass of CDPs wherein six cysteine residues form disulfide bonds according to the connectivity [1-4], 2-5, 3-6 indicating that the first cysteine residue forms a disulfide bond with the fourth residue, the second with the fifth, and the third cysteine residue with the sixth.
- the brackets in this nomenclature indicate cysteine residues form the knotting disulfide bond.
- Knottins can be a subclass of CDPs wherein six cysteine residues form disulfide bonds according to the connectivity 1-4, 2-5, [3-6], Knottins are a class of peptides, usually ranging from about 20 to about 80 amino acids in length that are often folded into a compact structure. Knottins are typically assembled into a complex tertiary structure that is characterized by a number of intramolecular disulfide crosslinks and can contain beta strands and other secondary structures. The presence of the disulfide bonds gives knottins and hitchins remarkable environmental stability, allowing them to withstand extremes of temperature and pH and to resist the proteolytic enzymes of the blood stream.
- the peptides described herein can be derived from knotted peptides.
- the amino acid sequences of peptides as disclosed herein can comprise a plurality of cysteine residues. In some cases, at least cysteine residues of the plurality of cysteine residues present within the amino acid sequence of a peptide participate in the formation of disulfide bonds. In some cases, all cysteine residues of the plurality of cysteine residues present within the amino acid sequence of a peptide participate in the formation of disulfide bonds.
- the term “knotted peptide” can be used interchangeably with the terms “cystine-dense peptide”, “CDP”, or “peptide”.
- CDPs that bind the transferrin receptor and allow selection, optimization and characterization of CDP-TfR binding peptides that can be used in selective depletion complexes, including for use as bioactive molecules at therapeutically relevant concentrations in a subject (e.g., a human or non-human animal).
- This disclosure demonstrates the utility of CDPs as a diverse scaffold family that can be screened for applicability to modern drug discovery strategies.
- CDPs comprise alternatives to existing biologies, primarily antibodies, which can bypass some of the liabilities of the immunoglobulin scaffold, including poor tissue permeability, immunogenicity, and long serum half-life that can become problematic if toxicities arise.
- Peptides of the present disclosure in the 20-80 amino acid range represent medically relevant therapeutics that are midsized, with many of the favorable binding specificity and affinity characteristics of antibodies but with improved stability, reduced immunogenicity, and simpler manufacturing methods.
- the intramolecular disulfide architecture of CDPs provides particularly high stability metrics, reducing fragmentation and immunogenicity, while their smaller size could improve tissue penetration or cell penetration and facilitate tunable serum half-life.
- peptides representing candidate peptides that can serve as vehicles for delivering target molecules to endocytic compartments.
- TfR-binding peptides can be engineered peptides.
- An engineered peptide can be a peptide that is non-naturally occurring, artificial, isolated, synthetic, designed, or recombinantly expressed.
- the TfR-binding peptides of the present disclosure comprise one or more properties of CDPs, knotted peptides, or hitchins, such as stability, resistance to proteolysis, resistance to reducing conditions, and/or ability to cross the blood brain barrier.
- the target-binding peptides of the present disclosure comprise one or more properties of CDPs, knotted peptides, or hitchins, such as stability, resistance to proteolysis, or resistance to reducing conditions.
- CDPs can be advantageous for delivery to the CNS, as compared to other molecules such as antibodies due to smaller size, greater tissue or cell penetration, lack of Fc function, and quicker clearance from serum, and as compared to smaller peptides due to resistance to proteases (both for stability and for immunogenicity reduction).
- the TfR-binding peptides or target-binding peptides of the present disclosure e.g., CDPs, knotted peptides, or hitchins
- selective depletion complexes e.g., comprising one or more TfR-binding peptides and one or more target-binding peptides
- engineered TfR-binding fusion peptides e.g., comprising one or more TfR-binding peptides and one or more peptides
- the peptides and complexes described herein can provide superior, deeper, and/or faster tissue or cell penetration to cells and targeted tissues (e.g., brain parenchyma penetration, solid tumor penetration) and faster clearance from non-targeted tissues and serum.
- the TfR-binding peptides, target-binding peptides, selective depletion complexes, or TfR-binding fusion peptides of this disclosure can have lower molecular weights than TfR-binding antibodies or targetbinding antibodies.
- the lower molecular weight can confer advantageous properties on the TfR- binding peptides, target-binding peptides, selective depletion complexes, or TfR-binding fusion peptides of this disclosure as compared to TfR-binding antibodies or target-binding antibodies.
- the TfR-binding peptides, selective depletion complexes, or TfR-binding fusion peptides of this disclosure can penetrate a cell or tissue more readily than an anti-TfR antibody or can have lower molar dose toxicity than an anti-TfR antibody.
- the TfR-binding peptides, target-binding peptides, selective depletion complexes, or TfR-binding fusion peptides of this disclosure can be advantageous for lacking the Fc function of an antibody.
- the TfR-binding peptides, target-binding peptides, selective depletion complexes, or TfR-binding fusion peptides of this disclosure can be advantageous for allowing higher concentrations, on a molar basis, of formulations.
- CDPs or knotted peptides can be conjugated to, linked to, or fused to the TfR-binding peptides of the present disclosure, such as those described in TABLE 1, to selectively deliver a target molecule to an endocytic compartment of cell.
- the cell can be a cancer cell, pancreatic cell, liver cell, colon cell, ovarian cell, breast cell, lung cell, spleen cell, bone marrow cell, or any combination thereof.
- the cell can be any cell that expresses TfR.
- An engineered peptide can be a peptide that is non-naturally occurring, artificial, synthetic, designed, or recombinantly expressed.
- a TfR-binding peptide of the present disclosure or a complex comprising a TfR-binding peptide (e.g., a selective depletion complex)
- a TfR-binding peptide of the present disclosure enables TfR-mediated transcytosis and/or cellular endocytosis, and the additional CDP or knotted peptide that is conjugated to, linked to, or fused to TfR-binding peptide can selectively target a molecule (e.g., an enzyme or other protein of interest) in a cell associated with a disease or condition.
- the cell is a cancer cell.
- Cancers can include breast cancer, liver cancer, colon cancer, brain cancer, leukemia, lymphoma, non- Hodgkin lymphoma, myeloma, blood-cell-derived cancer, spleen cancer, cancers of the salivary gland, kidney cancer, muscle cancers, ovarian cancer, prostate cancer, pancreatic cancer, gastric cancer, sarcoma, glioblastoma, astrocytoma, glioma, medulloblastoma, ependymoma, choroid plexus carcinoma, midline glioma, diffuse intrinsic pontine glioma, lung cancer, bone marrow cell cancers, or skin cancer, genitourinary cancer, osteosarcoma, muscle-derived sarcoma, melanoma, head and neck cancer, a neuroblastoma, glioblastoma, astrocytoma, glioma, medulloblastoma, ependymo
- CDP or knotted peptides are conjugated to, linked to, or fused to TfR- binding peptides and are capable of localizing TfR-binding peptides across the blood brain barrier to deliver TfR-binding peptides to target cells in the central nervous system.
- CDPs e.g., knotted peptides or hitchins
- CDPs are a class of peptides, usually ranging from about 11 to about 81 amino acids in length that are often folded into a compact structure.
- Knotted peptides are typically assembled into a complex tertiary structure that is characterized by a number of intramolecular disulfide crosslinks and can contain beta strands, alpha helices, and other secondary structures.
- the presence of the disulfide bonds gives knotted peptides remarkable environmental stability, allowing them to withstand extremes of temperature and pH and to resist the proteolytic enzymes of the blood stream.
- the presence of a disulfide knot can provide resistance to reduction by reducing agents.
- the rigidity of knotted peptides also allows them to bind to targets without paying the “entropic penalty” that a floppy peptide accrues upon binding a target.
- binding is adversely affected by the loss of entropy that occurs when a peptide binds a target to form a complex. Therefore, “entropic penalty” is the adverse effect on binding, and the greater the entropic loss that occurs upon this binding, the greater the “entropic penalty.”
- unbound molecules that are flexible lose more entropy when forming a complex than molecules that are rigidly structured, because of the loss of flexibility when bound up in a complex.
- rigidity in the unbound molecule also generally increases specificity by limiting the number of complexes that molecule can form.
- the peptides can bind targets with antibody-like affinity, or with nanomolar or picomolar affinity.
- knotted peptides A wider examination of the sequence structure and sequence identity or homology of knotted peptides reveals that they have arisen by convergent evolution in all kinds of animals and plants. In animals, they are often found in venoms, for example, the venoms of spiders and scorpions and have been implicated in the modulation of ion channels.
- the knotted proteins of plants can inhibit the proteolytic enzymes of animals or have antimicrobial activity, suggesting that knotted peptides can function in molecular defense systems found in plants.
- a peptide of the present disclosure can comprise a cysteine amino acid residue.
- the peptide has at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 cysteine amino acid residues.
- the peptide has at least 6 cysteine amino acid residues.
- the peptide has at least 8 cysteine amino acid residues.
- the peptide has at least 10 cysteine amino acid residues, at least 12 cysteine amino acid residues, at least 14 cysteine amino acid residues or at least 16 cysteine amino acid residues.
- a knotted peptide can comprise disulfide bridges.
- a knotted peptide can be a peptide wherein 5% or more of the residues are cysteines forming intramolecular disulfide bonds.
- a disulfide-linked peptide can be a drug scaffold.
- the disulfide bridges form a knot.
- a disulfide bridge can be formed between cysteine residues, for example, between cysteines 1 and 4, 2 and 5, or, 3 and 6.
- one disulfide bridge passes through a loop formed by the other two disulfide bridges, for example, to form the knot.
- the disulfide bridges can be formed between any two cysteine residues.
- the present disclosure further includes peptide scaffolds that, e.g., can be used as a starting point for generating additional peptides.
- these scaffolds can be derived from a variety of knotted peptides (such as CDPs or knotted peptides or hitchins).
- CDPs e.g., knotted peptides or hitchins
- CDPs are assembled into a complex tertiary structure that is characterized by a number of intramolecular disulfide crosslinks, and optionally contain beta strands and other secondary structures such as an alpha helix.
- CDPs include, in some embodiments, small disulfide-rich proteins characterized by a disulfide through disulfide knot. This knot can be, e.g., obtained when one disulfide bridge crosses the macrocycle formed by two other disulfides and the interconnecting backbone.
- the knotted peptides can include growth factor cysteine knots or inhibitor cysteine knots.
- Other possible peptide structures include peptide having two parallel helices linked by two disulfide bridges without b-sheets (e.g., hefutoxin).
- Some peptides of the present disclosure can comprise at least one amino acid residue in an L configuration.
- a peptide can comprise at least one amino acid residue in D configuration.
- a peptide is 15-75 amino acid residues long. In other embodiments, a peptide is 11-55 amino acid residues long. In still other embodiments, a peptide is 11-65 amino acid residues long. In further embodiments, a peptide is at least 20 amino acid residues long.
- Some CDPs e.g., knotted peptides
- the peptide can be derived or isolated from a class of proteins known to be present or associated with toxins or venoms. In some cases, the peptide can be derived from toxins or venoms associated with scorpions or spiders. The peptide can be derived from venoms and toxins of spiders and scorpions of various genus and species.
- the peptide can be derived from a venom or toxin of the Leiurus quinquestriatus hebraeus, Buthus occitanus tunetanus, Hottentotta judaicus, Mesobuthus eupeus, Buthus occitanus Israelis, Hadrurus gertschi, Androctonus australis, Centruroides noxius, Heteroticians laoticus, Opistophthalmus carinatus, Haplopelma schmidti, Isometrus maculatus, Haplopelma huwenum, Haplopelma hainanum, Haplopelma schmidti, Agelenopsis aperta, Haydronyche versuta, Selenocosmia huwena, Heteropoda venatoria, Grammostola rosea, Ornithoctonus huwena, Hadronyche versuta, Atrax
- a peptide of the present disclosure can comprise a sequence having cysteine residues at one or more of corresponding positions 11, 12, 13, 14, 19, 20, 21, 22, 36, 38, 39, 41, for example with reference to SEQ ID NO: 96.
- a peptide comprises Cys at corresponding positions 11, 12, 19, 20, 36, 39, or any combination thereof.
- a peptide can comprise a sequence having a cysteine residue at corresponding position 11.
- a peptide can comprise a sequence having a cysteine residue at corresponding position 12.
- a peptide can comprise a sequence having a cysteine residue at corresponding position 13. In certain embodiments, a peptide can comprise a sequence having a cysteine residue at corresponding position 14. In certain embodiments, a peptide can comprise a sequence having a cysteine residue at corresponding position 19. In certain embodiments, a peptide can comprise a sequence having a cysteine residue at corresponding position 20. In certain embodiments, a peptide can comprise a sequence having a cysteine residue at corresponding position 21. In certain embodiments, a peptide can comprise a sequence having a cysteine residue at corresponding position 22.
- a peptide can comprise a sequence having a cysteine residue at corresponding position 36. In certain embodiments, a peptide can comprise a sequence having a cysteine residue at corresponding position 38. In certain embodiments, a peptide can comprise a sequence having a cysteine residue at corresponding position 39. In certain embodiments, a peptide can comprise a sequence having a cysteine residue at corresponding position 41.
- the first cysteine residue in the sequence can be disulfide bonded with the 4th cysteine residue in the sequence
- the 2nd cysteine residue in the sequence can be disulfide bonded to the 5th cysteine residue in the sequence
- the 3rd cysteine residue in the sequence can be disulfide bonded to the 6th cysteine residue in the sequence.
- a peptide can comprise one disulfide bridge that passes through a ring formed by two other disulfide bridges, also known as a “two-and-through” structure system.
- the peptides disclosed herein can have one or more cysteines mutated to serine.
- peptides of the present disclosure comprise at least one cysteine residue.
- peptides of the present disclosure comprise at least two cysteine residues.
- peptides of the present disclosure comprise at least three cysteine residues.
- peptides of the present disclosure comprise at least four cysteine residues.
- peptides of the present disclosure comprise at least five cysteine residues.
- peptides of the present disclosure comprise at least six cysteine residues.
- peptides of the present disclosure comprise at least ten cysteine residues. In some embodiments, a peptide of the present disclosure comprises six cysteine residues. In some embodiments, a peptide of the present disclosure comprises seven cysteine residues. In some embodiments, a peptide of the present disclosure comprises eight cysteine residues.
- a peptide of the present disclosure (e.g., a TfR-binding peptide, a target-binding peptide, or a selective depletion complex) comprises an amino acid sequence having cysteine residues at one or more positions, for example with reference to SEQ ID NO:
- the one or more cysteine residues are located at any one of the corresponding amino acid positions 6, 10, 20, 34, 44, 48, or any combination thereof.
- the one or more cysteine (C) residues participate in disulfide bonds with various pairing patterns (e.g., C 10 -C 20 ).
- the corresponding pairing patterns are C6-C48, C10-C44, and C20-C34.
- the peptides as described herein comprise at least one, at least two, or at least three disulfide bonds.
- At least one, at least two, or at least three disulfide bonds are arranged according to the corresponding C 6 -C 48 , C 10 -C 44 , and C 20 -C 34 pairing patterns, or a combination thereof.
- peptides as described herein comprise three disulfide bonds with the corresponding pairing patterns C6-C48, C10-C44, and C20-C34.
- a peptide (e.g., a TfR-binding peptide, a target-binding peptide, or a selective depletion complex) comprises a sequence having a cysteine residue at corresponding position 6. In certain embodiments, a peptide comprises a sequence having a cysteine residue at corresponding position 10. In certain embodiments, a peptide comprises a sequence having a cysteine residue at corresponding position 20. In certain embodiments, a peptide comprises a sequence having a cysteine residue at corresponding position 34. In certain embodiments, a peptide comprises a sequence having a cysteine residue at corresponding position 44.
- a peptide comprises a sequence having a cysteine residue at corresponding position 50.
- the first cysteine residue in the sequence is disulfide bonded with the last cysteine residue in the sequence.
- the second cysteine residue in the sequence is disulfide bonded with the second to the last cysteine residue in the sequence.
- the third cysteine residue in the sequence is disulfide bonded with the third to the last cysteine residue in the sequence and so forth.
- the first cysteine residue in the sequence is disulfide bonded with the 6th cysteine residue in the sequence
- the 2nd cysteine residue in the sequence is disulfide bonded to the 5th cysteine residue in the sequence
- the 3rd cysteine residue in the sequence is disulfide bonded to the 4th cysteine residue in the sequence.
- a peptide can comprise one disulfide bridge that passes through a ring formed by two other disulfide bridges, also known as a “two-and-through” structure system.
- the peptides disclosed herein have one or more cysteines mutated to serine.
- a peptide (e.g., a TfR-binding peptide, a target-binding peptide, or a selective depletion complex) comprises no cysteine or disulfides.
- a peptide comprises 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 11 or more, 12 or more, 13 or more, 14 or more, or 15 or more cysteine or disulfides.
- 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more cysteine residues have been replaced with serine residues. In some embodiments, 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more cysteine residues have been replaced with threonine residues.
- a peptide (e.g., a TfR-binding peptide, a target-binding peptide, or a selective depletion complex) comprises no Cys or disulfides.
- a peptide comprises 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 11 or more, 12 or more, 13 or more, 14 or more, or 15 or more Cys or disulfides.
- 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more Cys residues have been replaced with Ser residues. In some embodiments, 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more Cys residues have been replaced with Thr residues. [0245] In some instances, one or more or all of the methionine residues in the peptide are replaced by leucine or isoleucine. In some instances, one or more or all of the tryptophan residues in the peptide are replaced by phenylalanine or tyrosine.
- one or more or all of the asparagine residues in the peptide are replaced by glutamine.
- the N-terminus of the peptide is blocked, such as by an acetyl group.
- the C-terminus of the peptide is blocked, such as by an amide group.
- the peptide is modified by methylation on free amines. [0246] For example, full methylation can be accomplished through the use of reductive methylation with formaldehyde and sodium cyanoborohydride.
- the peptides or peptide complexes as described herein target and/or penetrate a TfR-expressing cellular layer or barrier and/or the membrane of a TfR- expressing cell.
- a peptide targets and/or penetrates a cell membrane of a cell, wherein said cell is located in the CNS such as the brain.
- a peptide complex comprising a TfR-binding peptide and one or more active agents (e.g., a therapeutic or diagnostic compound) crosses a cellular barrier (e.g., BBB) via vesicular transcytosis, and subsequently targets and/or penetrates the cell membrane of a cell located within the CNS to deliver said one or more active agents to that cell.
- a selective depletion complex comprising a TfR-binding peptide and a target-binding peptide binds a TfR-expressing cell located in the gastrointestinal tract, spleen, liver, kidney, muscle, bone marrow, brain, or skin.
- the TfR- expressing cell is a tumor cell, an immune cell, an erythrocyte, an erythrocyte precursor cell, a stem cell, a bone marrow cell, or stem cell.
- the TfR-binding peptide is responsible for targeting the cell, e.g., in cases where the cell is overexpressing a TfR.
- a peptide complex as described herein comprising a TfR-binding peptide conjugated to, linked to, or fused to a target-binding peptide binds a cell located within various organs such as the spleen, brain, liver, kidney, muscle, bone marrow, gastrointestinal tract, or skin.
- the target-biding peptides promotes endocytosis of a target molecule.
- a peptide or peptide complex e.g., peptide conjugate or fusion peptide
- a selective depletion complex e.g., a complex comprising a TfR-binding peptide and a target-binding peptide
- a certain biological effect e.g., selective depletion of the target molecule.
- the peptides of the presented disclosure can be dimerized in numerous ways.
- a TfR-binding peptide can be dimerized with a target-binding peptide via a peptide linker to form a selective depletion complex.
- a peptide linker does not disturb the independent folding of peptide domains (e.g., a TfR-binding peptide or a target-binding peptide).
- a peptide linker can comprise sufficient length to the peptide complex so as to facilitate contact between a target molecule and a TfR via the peptide complex (e.g., a selective depletion complex).
- a peptide linker does not negatively impact manufacturability (synthetic or recombinant) of the peptide complex (e.g., the selective depletion complex).
- a peptide linker does not impair post-synthesis chemical alteration (e.g. conjugation of a fluorophore or albumin-binding chemical group) of the peptide complex (e.g., the selective depletion complex).
- a peptide linker can connect the C-terminus of a first peptide (e.g., a target-binding peptide, a TfR-binding peptide, or a half-life modifying peptide) to the N- terminus of a second peptide (e.g., a target-binding peptide, a TfR-binding peptide, or a half-life modifying peptide).
- a first peptide e.g., a target-binding peptide, a TfR-binding peptide, or a half-life modifying peptide
- a peptide linker can connect the C-terminus of the second peptide (e.g., a target-binding peptide, a TfR-binding peptide, or a half-life modifying peptide) to the N-terminus of a third peptide (e.g., a target-binding peptide, a TfR-binding peptide, or a half-life modifying peptide).
- a third peptide e.g., a target-binding peptide, a TfR-binding peptide, or a half-life modifying peptide
- a linker e.g., any one of SEQ ID NO: 129 ⁇ SEQ ID NO: 141 or SEQ ID NO: 195 ⁇ SEQ ID NO: 218, can connect the C-terminus of a target-binding peptide to the N-terminus of a TfR-binding peptide (e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64) to form a selective depletion complex.
- a TfR-binding peptide e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID
- a linker e.g., any one of SEQ ID NO: 129 ⁇ SEQ ID NO: 141 or SEQ ID NO: 195 ⁇ SEQ ID NO: 218, can connect the C-terminus of a TfR-binding peptide (e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64) to the N- terminus of a target-binding peptide to form a selective depletion complex.
- a TfR-binding peptide e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID
- a linker eg any one of SEQ ID NO: 129 SEQ ID NO: 141 or SEQ ID NO: 195 SEQ ID NO: 218, can connect the C-terminus of a TfR-binding peptide (e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64) to the N-terminus of a half-life extending peptide (e.g., SEQ ID NO: 178, SEQ ID NO: 179, or SEQ ID NO: 192) and the C- terminus of the half-life extending peptide to the N-terminus of a target binding peptide to form a selective depletion complex.
- a TfR-binding peptide e.g., any one of SEQ ID NO:
- a linker (e.g., any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218) can connect the C-terminus of a target-binding peptide to the N-terminus of a half-life extending peptide (e.g., SEQ ID NO: 178, SEQ ID NO: 179, or SEQ ID NO: 192) and a second linker (e.g., any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218) can connect the C-terminus of the half-life extending peptide to the N-terminus of a TfR-binding peptide (e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - S
- SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218) can connect the C-terminus of a target-binding peptide to the N-terminus of a half-life extending peptide (e.g., SEQ ID NO: 178, SEQ ID NO: 179, or SEQ ID NO: 192) and a second linker (e.g., any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218) can connect the C-terminus of the half-life extending peptide to the N-terminus of a TfR-binding peptide (e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64) to form
- a linker (e.g., any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218) can connect the C-terminus of a half-life extending peptide (e.g., SEQ ID NO: 178, SEQ ID NO: 179, or SEQ ID NO: 192) to the N-terminus of a target-binding peptide and a second linker (e.g., any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218) can connect the C-terminus of the target-binding peptide to the N- terminus of a TfR-binding peptide (e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ
- a linker can comprise a Tau-theraphotoxin-Hsla, also known as DkTx (double-knot toxin), extracted from a native knottin-knottin dimer from Haplopelma schmidti (e.g., SEQ ID NO: 139).
- the linker can lack structural features that would interfere with dimerizing independently functional CDPs (e.g., a TfR-binding CDP and a target-binding CDP).
- a linker can comprise a glycine-serine (Gly-Ser or GS) linker (e g., SEQ ID NO: 129 - SEQ ID NO: 138 or SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218).
- Gly-Ser linkers can have minimal chemical reactivity and can impart flexibility to the linker.
- Serines can increase the solubility of the linker or the peptide complex, as the hydroxyl on the side chain is hydrophilic.
- a linker can be derived from a peptide that separates the Fc from the Fv domains in a heavy chain of human immunoglobulin G (e.g., SEQ ID NO: 140).
- a linker derived from a peptide from the heavy chain of human IgG can comprise a cysteine to serine mutation relative to the native IgG peptide.
- peptides of the present disclosure can be dimerized using an immunoglobulin heavy chain Fc domain.
- Fc domains can be used to dimerize functional domains (e.g., a TfR-binding peptide and a target-binding peptide), either based on antibodies or other otherwise soluble functional domains.
- dimerization can be homodimeric if the Fc sequences are native.
- dimerization can be heterodimeric by mutating the Fc domain to generate a “knob-in-hole” format where one Fc CH3 domain contains novel residues (knob) designed to fit into a cavity (hole) on the other Fc CH3 domain.
- a first peptide domain (e.g., a TfR-binding peptide or a target-binding peptide) can be coupled to the knob, and a second peptide domain (e.g., a TfR-binding peptide or targetbinding peptide) can be coupled to the hole.
- Knob+knob dimers can be highly energetically unfavorable.
- a purification tag can be added to the “knob” side to remove hole+hole dimers and select for knob+hole dimers.
- the peptide peptides of the present disclosure can be linked to another peptide (e.g., a target-binding peptide, a TfR-binding peptide, a selective depletion complex, or a half-life modifying peptide) at the N-terminus or C-terminus.
- one or more peptides can be linked or fused via a peptide linker (e.g., a peptide linker comprising a sequence of any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218).
- a TfR-binding peptide can be fused to a target-binding peptide via a peptide linker of any one of SEQ ID NO: 129 - SEQ ID NO: 141 or SEQ ID NO: 195 - SEQ ID NO: 218.
- a peptide linker (e.g., a linker connecting a TfR-binding peptide, a target-binding peptide, a half- life modifying peptide, or combinations thereof) can have a length of about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about
- a peptide linker (e.g., a linker connecting a TfR-binding peptide, a target-binding peptide, a half-life modifying peptide, or combinations thereof) can have a length of from about 2 to about 5, from about 2 to about 10, from about 2 to about 20, from about 3 to about 5, from about 3 to about 10, from about 3 to about 15, from about 3 to about 20, from about 3 to about 25, from about 5 to about 10, from about 5 to about 15, from about 5 to about 20, from about 5 to about 25, from about 10 to about 15, from about 10 to about 20, from about 10 to about 25, from about 15 to about 20, from about 15 to about 25, from about 20 to about 25, from about 20 to about 30, from about 20 to about 35, from about 20 to about 40, from about 20 to about 45, from about 20 to about 50, from about 3 to about 50, from about 3 to about 40, from about 3 to about 30, from about 10 to about 40, from about 10 to about 10 to
- a first peptide e.g., a TfR-binding peptide
- a second peptide e.g., a target-binding peptide
- a flexible linker can provide rotational freedom between the first peptide and the second peptide and can allow the first peptide and the second peptide to bind their respective targets (e.g., a transferrin receptor and a target molecule) with minimal strain.
- a peptide linker can have a persistence length of no more than 6 A, no more than 7 A, no more than 8 A, no more than 9 A, no more than 10 A, no more than 12 A, no more than 15 A, no more than 20 A, no more than 25 A, no more than 30 A, no more than 40 A, or no more than 50 A.
- a peptide linker can have a persistence length of from about 4 A to about 100 A, from about 4 A to about 50 A, from about 4 A to about 20 A, from about 4 A to about 10 A, from about 10 A to about 20 A, from about 20 A to about 30 A, from about 30 A to about 50 A, or from about 50 A to about 100 A.
- the persistence length of the linker can be a measure of the flexibility of the peptide linker and can be quantified as the peptide length over which correlations in the direction of the tangent are lost.
- a peptide linker can be selected based on a desired linker length, hydrodynamic radius, chromatographic mobility, posttranslational modification propensity, or combinations thereof.
- a linker separating two or more functional domains of a peptide complex e.g., separating a TfR-binding peptide and a target-binding peptide
- a linker separating two or more functional domains of a peptide complex can comprise a small, flexible linker, for example to reduce the hydrodynamic radius of the complex for use in tight spaces like dense-core tumor stroma. Examples of selective depletion complexes formed from a single polypeptide chain comprising a target-binding peptide and a receptor-binding peptide connected via a peptide linker are illustrated in FIG. 25A and FIG. 25B.
- a peptide linker can support independent folding of the two or more functional domains and may not inhibit interactions between the two or more functional domains and their binding targets (e.g., between a TfR-binding peptide and TfR or between a target-binding peptide and a target molecule).
- a peptide can be appended to the N-terminus of any peptide of the present disclosure following an N-terminal GS dipeptide and preceding, for example, a GGGS (SEQ ID NO: 129) spacer.
- a peptide e.g., a target-binding peptide
- the peptide linker comprises (GS)x (SEQ ID NO: 131), wherein x can be any whole number, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10.
- the peptide linker comprises GGSSG (SEQ ID NO: 132), GGGGG (SEQ ID NO: 133), GSGSGSGS (SEQ ID NO: 134), GSGG (SEQ ID NO: 135), GGGGS (SEQ ID NO: 136), GGGS (SEQ ID NO: 129), GGS (SEQ ID NO: 137), GGGSGGGSGGGS (SEQ ID NO: 138), or a variant or fragment thereof.
- KKYKPYVPVTTN (SEQ ID NO: 139) from DkTx
- EPKSSDKTHT (SEQ ID NO: 140) from human IgG3
- the peptide linker comprises GGGSGGSGGGS (SEQ ID NO: 141).
- the peptide linker comprises a linker of any one of SEQ ID NO: 195 - SEQ ID NO: 218. Examples of peptide linkers compatible with the target depletion complexes of the present disclosure are provided in TABLE 4. It is understood that any of the foregoing linkers or a variant or fragment thereof can be used with any number of repeats or any combinations thereof. It is also understood that other peptide linkers in the art or a variant or fragment thereof can be used with any number of repeats or any combinations thereof.
- a tag peptide (e.g., a peptide of any one of SEQ ID NO: 142 - SEQ ID NO: 147) can be appended to the peptide (e.g., a target-binding peptide, a TfR-binding peptide, or a selective depletion complex) at any amino acid residue.
- the tag peptide e.g., a peptide of any one of SEQ ID NO: 142 - SEQ ID NO: 147) can be appended to the peptide at any amino acid residue without interfering with TfR-binding activity, target-binding activity, selective depletion activity, or a combination thereof.
- the tag peptide is appended via conjugation, linking, or fusion techniques.
- a peptide e.g., a target-binding peptide
- a second peptide e.g., a TfR-binding peptide
- the peptide e.g., a target-binding peptide
- the second peptide e.g., a TfR-binding peptide
- a selective depletion complex may comprise two or more polypeptide chains.
- a target-binding peptide and a receptor-binding peptide may be complexed via a dimerization domain to form a selective depletion complex.
- the dimerization domain may be a heterodimerization domain or a homodimerization domain.
- FIG.25A, FIG.25B, and FIG.25C Examples of selective depletion complexes comprising a target-binding peptide and a receptor-binding peptide connected via a dimerization domain (e.g., an Fc homodimerization domain or a knob- in-hole heterodimerization domain) are illustrated in FIG.25A, FIG.25B, and FIG.25C.
- a target-binding peptide and a receptor-binding peptide may be complexed by forming a heterodimer via a heterodimerization domain.
- the target-binding peptide may be linked or fused to a first heterodimerization domain and the receptor-binding peptide may be linked or fused to a second heterodimerization domain.
- the first heterodimerization domain may bind to the second heterodimerization domain to form a heterodimeric complex comprising the target-binding peptide and the receptor-binding peptide.
- the receptor-binding peptide may be gdif ⁇ _ jm apn ⁇ _ oj ⁇ i D ⁇ ⁇ fij] ⁇ k ⁇ kod_ ⁇ ( ⁇ .b., QCO GB LM: 260) and the immune cell targeting ⁇ b ⁇ io h ⁇ t ] ⁇ gdif ⁇ _ jm apn ⁇ _ oj ⁇ i D ⁇ ⁇ cjg ⁇ k ⁇ kod_ ⁇ ( ⁇ .b., QCO GB LM: 261).
- a receptor-binding peptide may form a heterodimer with target-binding peptide via a heterodimerization domain provided in TABLE 5.
- the receptor-binding peptide may be fused to chain 1 of an Fc pair (e.g., SEQ ID NO: 260) and the target-binding peptide may be fused to chain 2 of the Fc pair (e.g., SEQ ID NO: 261).
- the receptor- binding peptide may be fused to chain 2 of an Fc pair (e.g., SEQ ID NO: 263) and the target- binding peptide may be fused to chain 1 of the Fc pair (e.g., SEQ ID NO: 262).
- a selective depletion complex comprising a heterodimerization domain may form a monovalent selective depletion complex, as shown in FIG.25B, or a selective depletion complex comprising a heterodimerization domain may form a multivalent selective depletion complex, as shown in FIG.25C.
- a target-binding peptide and a receptor-binding peptide may form a selective depletion complex comprising a homodimer complexed via a homodimerization domain.
- the target-binding peptide may be linked or fused to the N-terminus of the homodimerization domain and the receptor-binding peptide may be linked or fused to the C- terminus of the homodimerization domain.
- the target-binding peptide may be linked or fused to the C-terminus of the homodimerization domain and the receptor- binding peptide may be linked or fused to the N-terminus of the homodimerization domain. In some embodiments, the target-binding peptide and the receptor-binding peptide may both be fused on the N-terminal, or both be fused on the C-terminal end of the homodimerization domain.
- a selective depletion complex comprising a homodimerization domain may form a multivalent selective depletion complex, as shown in FIG.25C.
- a peptide can be modified (e.g., chemically modified) one or more of a variety of ways. In some embodiments, the peptide can be mutated to add function, delete function, or modify the in vivo behavior.
- One or more loops between the disulfide linkages of a peptide can be modified or replaced to include active elements from other peptides (such as described in Moore and Cochran, Methods in Enzymology, 503, p.223-251, 2012).
- the peptides of the present disclosure e.g., TfR-binding peptides, target-binding peptides, or selective depletion complexes
- an albumin-binding domain from a Finegoldia magna peptostreptococcal albumin-binding protein (SEQ ID NO: 192, (LKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKA) can be added to a peptide of the present disclosure.
- a peptide of the present disclosure can be functionalized with an albumin-binding domain that has been modified for improved albumin affinity, improved stability, reduced immunogenicity, improved manufacturability, or a combination thereof.
- a peptide can be functionalized with a modified albumin- binding domain of SEQ ID NO: 194 thermostability and improved serum half-life compared to the albumin binding domain of SEQ ID NO: 193.
- an albumin-binding peptide may be selected based on a desired off rate for albumin.
- an albumin-binding peptide of SEQ ID NO: 227 may be selected for its faster off rate relative to SEQ ID NO: 194.
- the albumin-binding domain comprises a simple three-helical structure that would be unlikely to disturb the independent folding of the other peptide domains (e.g., CDP domains).
- a functional domain can increase the serum half-life of a peptide or peptide complex of the present disclosure.
- a functional domain e.g., an albumin-binding domain
- a functional domain can be linked to the TfR-binding peptide, the target-binding peptide, or in between the TfR-binding peptide and the target-binding peptide, as illustrated in FIG.16A i FIG.16C.
- an albumin binding peptide (e.g., SEQ ID NO: 194 or SEQ ID NO: 227) may be used to link a target-binding peptide to a receptor-binding peptide.
- An additional functional domain can be linked to one or more peptides (e.g., a TfR-binding peptide or a target-binding peptide) via a linker (e.g., any one of SEQ ID NO: 129 ⁇ SEQ ID NO: 141 or SEQ ID NO: 195 ⁇ SEQ ID NO: 218).
- a peptide of the present disclosure may be modified with a signal peptide to mark the peptide for secretion.
- a peptide may be modified with a signal peptide corresponding to SEQ ID NO: 230 (METDTLLLWVLLLWVPGSTG).
- the signal peptide may be appended to an N-terminus or a C-terminus of the peptide.
- a peptide may be modified for additional stability during translation or secretion.
- a peptide may be modified with a sidrocalin with a furin cleavage site corresponding to NQ V VSQN G S N S S G N V V QC .
- the sidrocalin with the furin cleavage site may be appended to an N-terminus or a C-terminus of the peptide.
- a peptide may be modified with a signal peptide to mark the peptide for secretion and for additional stability during translation or secretion.
- a peptide may be modified with a signal peptide and a sidrocalin with a furin cleavage site corresponding to SEQ ID NO: 231 ).
- the signal peptide and the sidrocalin with the furin cleavage site may be appended to an N-terminus or a C- terminus of the peptide.
- Amino acids of a peptide or a peptide complex e.g., a TfR-binding peptide, a receptorbinding peptide, a target-binding peptide, or a selective depletion complex
- N-methylation is one example of methylation that can occur in a peptide of the disclosure.
- the peptide is modified by methylation on free amines. For example, full methylation can be accomplished through the use of reductive methylation with formaldehyde and sodium cyanoborohydride.
- the peptides can be modified to add function, such as to graft loops or sequences from other proteins or peptides onto peptides of this disclosure.
- domains, loops, or sequences from this disclosure can be grafted onto other peptides or proteins such as antibodies that have additional function.
- a selective depletion complex can comprise a tissue targeting domain and can accumulate in the target tissue upon administration to a subject.
- selective depletion complexes can be conjugated to, linked to, or fused to a molecule (e.g., small molecule, peptide, or protein) with targeting or homing function for a cell of interest or a target protein located on the surface or inside said cell.
- a molecule e.g., small molecule, peptide, or protein
- selective depletion complexes can be conjugated to, linked to, or fused to a molecule that extends the plasma and/or biological half-life, or modifies the pharmacodynamic (e.g., enhanced binding to a target protein) and/or pharmacokinetic properties (e.g., rate and mode of clearance) of the peptides, or any combination thereof.
- pharmacodynamic e.g., enhanced binding to a target protein
- pharmacokinetic properties e.g., rate and mode of clearance
- a chemical modification can, for instance, extend the half-life of a peptide or change the biodistribution or pharmacokinetic profile.
- a chemical modification can comprise a polymer, a poly ether, polyethylene glycol, a biopolymer, a polyamino acid, a fatty acid, a dendrimer, an Fc region, a simple saturated carbon chain such as palmitate or myristolate, or albumin.
- a polyamino acid can include, for example, a poly amino acid sequence with repeated single amino acids (e.g., poly glycine), and a poly amino acid sequence with mixed poly amino acid sequences (e.g., gly-ala-gly-ala; SEQ ID NO: 457) that can or may not follow a pattern, or any combination of the foregoing.
- a poly amino acid sequence with repeated single amino acids e.g., poly glycine
- a poly amino acid sequence with mixed poly amino acid sequences e.gly-ala-gly-ala; SEQ ID NO: 457
- the peptides of the present disclosure can be modified such that the modification increases the stability and/or the half-life of the peptides.
- the attachment of a hydrophobic moiety, such as to the N-terminus, the C-terminus, or an internal amino acid, can be used to extend half-life of a peptide of the present disclosure.
- the peptides can also be modified to increase or decrease the gut permeability or cellular permeability of the peptide.
- the peptides of the present disclosure show high accumulation in glandular cells of the intestine, demonstrating applicability in the treatment and-or prevention of diseases or conditions of the intestines, such as Crohn’s disease or more generally inflammatory bowel diseases.
- the peptide of the present disclosure can include post-translational modifications (e.g., methylation and/or amidation and/or glycosylation), which can affect, e.g., serum half-life.
- post-translational modifications e.g., methylation and/or amidation and/or glycosylation
- simple carbon chains e.g., by myristoylation and/or palmitylation
- the simple carbon chains can render the fusion proteins or peptides easily separable from the unconjugated material.
- methods that can be used to separate the fusion proteins or peptides from the unconjugated material include, but are not limited to, solvent extraction and reverse phase chromatography. Lipophilic moieties can extend half-life through reversible binding to serum albumin.
- Conjugated moieties can, e.g., be lipophilic moieties that extend half-life of the peptides through reversible binding to serum albumin.
- the lipophilic moiety can be cholesterol or a cholesterol derivative including cholestenes, cholestanes, cholestadienes and oxysterols.
- the peptides can be conjugated to, linked to, myristic acid (tetradecanoic acid) or a derivative thereof.
- the peptides of the present disclosure can be coupled (e.g., conjugated, linked, or fused) to a half-life modifying agent.
- half-life modifying agents can include, but is not limited to: a polymer, a polyethylene glycol (PEG), a hydroxyethyl starch, polyvinyl alcohol, a water soluble polymer, a zwitterionic water soluble polymer, a water soluble poly(amino acid), a water soluble polymer of proline, alanine and serine, a water soluble polymer containing glycine, glutamic acid, and serine, an Fc region, a fatty acid, palmitic acid, or a molecule that binds to albumin.
- PEG polyethylene glycol
- a hydroxyethyl starch polyvinyl alcohol
- a water soluble polymer a zwitterionic water soluble polymer
- a water soluble poly(amino acid) a water soluble poly(amino acid)
- proline a water soluble polymer of proline
- alanine and serine a water soluble polymer
- the half-life modifying agent can be a serum albumin binding peptide, for example SA21 (SEQ ID NO: 178, RLIEDICLPRWGCLWEDD).
- SA21 SEQ ID NO: 178, RLIEDICLPRWGCLWEDD
- a SA21 peptide can be conjugated or fused to the CDPs of the present disclosure (e.g., any of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64).
- a SA21 fusion peptide can include the SA21 TfR-binding peptide complexes disclosed herein (e.g., SEQ ID NO: 181 or SEQ ID NO: 184).
- the SA21 peptide can comprise a linker sequence for conjugation to, or fusion between, one or more peptides (e.g., SEQ ID NO: 179, Exemplary SA21 peptides, fusion peptides, and linkers are provided in TABLE 5.
- a control SA21 fusion peptide can comprise a control peptide fused to SA21 (e.g., SEQ ID NO: 180
- conjugation of the peptide to a near infrared dye, such as Cy5.5, or to an albumin binder such as Albu-tag can extend serum half-life of any peptide as described herein.
- immunogenicity is reduced by using minimal non-human protein sequences to extend serum half-life of the peptide.
- the first two N-terminal amino acids (GS) of SEQ ID NO: 1 - SEQ ID NO: 64 serve as a spacer or linker in order to facilitate conjugation or fusion to another molecule, as well as to facilitate cleavage of the peptide from such conjugated to, linked to, or fused molecules.
- the fusion proteins or peptides of the present disclosure can be conjugated to, linked to, or fused to other moieties that, e.g., can modify or effect changes to the properties of the peptides.
- peptides or peptide complexes of the present disclosure can also be conjugated to, linked to, or fused to other affinity handles.
- Other affinity handles can include genetic fusion affinity handles.
- Genetic fusion affinity handles can include 6xHis (HHHHHH (SEQ ID NO: 142) or GGGGSHHHHHH (SEQ ID NO: 228); immobilized metal affinity column purification possible), FLAG (DYKDDDDK (SEQ ID NO: 143); anti-FLAG immunoprecipitation), “shorty” FLAG (DYKDE (SEQ ID NO: 144); anti-FLAG immunoprecipitation), hemagglutinin (YPYDVPDYA (SEQ ID NO: 145); anti-HA immunoprecipitation), and streptavidin binding peptide (DVEAWLGAR (SEQ ID NO: 146); streptavidin-mediated precipitation).
- peptides or peptide complexes of the present disclosure can also be conjugated to, linked to, or fused to an expression tag or sequence to improve protein expression and/or purification.
- expression tags can include genetic fusion expression tags.
- Genetic fusion expression tags can include siderocalin (SEQ ID NO: 1
- more than one peptide sequence can be present on, conjugated to, linked to, or fused with a particular peptide.
- a peptide can be incorporated into a biomolecule by various techniques.
- a peptide can be incorporated by a chemical transformation, such as the formation of a covalent bond, such as an amide bond.
- a peptide can be incorporated, for example, by solid phase or solution phase peptide synthesis.
- a peptide can be incorporated by preparing a nucleic acid sequence encoding the biomolecule, wherein the nucleic acid sequence includes a subsequence that encodes the peptide. The subsequence can be in addition to the sequence that encodes the biomolecule or can substitute for a subsequence of the sequence that encodes the biomolecule.
- one or more peptides of the present disclosure can form a selective depletion complex (SDC).
- a selective depletion complex may comprise a targetbinding peptide that binds a target molecule and a receptor-binding peptide that binds a cellular receptor (e.g., a cell surface receptor).
- the cell surface receptor is a receptor that is endocytosed (e.g., a transferrin receptor or a programmed death-ligand 1).
- the cell surface receptor is a receptor that is recycled back to the cell surface following endocytosis.
- a receptor-binding peptide of the present disclosure may be a transferrin receptor (TfR)-binding peptide or a programmed death ligand 1 (PD-Ll)-binding peptide.
- a selective depletion complex can comprise a TfR-binding peptide and a target-binding peptide.
- the receptor-binding peptide e.g., the TfR-binding peptide or the PD-Ll-binding peptide
- the target-binding peptide can be connected via a linker (e.g., a peptide linker).
- the receptor -binding peptide and the target-binding peptide can be directly connected without a linker. In some embodiments, the receptor-binding peptide and the target-binding peptide can be connected via a heterodimerization domain.
- the receptor-binding peptide can bind the receptor (e.g., TfR or PD-L1) with high affinity at both extracellular pH (such as about pH 7.4) and at endosomal pH (such as about pH 5.5).
- the receptor-binding peptide of a selective depletion complex may be a TfR- binding peptide (e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64).
- TfR- binding peptide e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64).
- the receptor-binding peptide of a selective depletion complex may be a PD-L1 -binding peptide (e.g., any one of SEQ ID NO: 187, SEQ ID NO: 233 - SEQ ID NO: 239, SEQ ID NO: 400 - SEQ ID NO: 456, or SEQ ID NO: 141).
- PD-L1 -binding peptide e.g., any one of SEQ ID NO: 187, SEQ ID NO: 233 - SEQ ID NO: 239, SEQ ID NO: 400 - SEQ ID NO: 456, or SEQ ID NO: 141).
- the target-binding peptide can bind a target molecule with an affinity that is pH- dependent.
- the target-binding molecule can bind to the target molecule with higher affinity at extracellular pH (about pH 7.4) and with lower affinity at a lower endosomal pH (such as about pH 5.5 or about pH 6.5).
- the target-binding molecule can release the target molecule upon internalization into an endosomal compartment and acidification of the endosome.
- Such release of the target molecule upon acidification of the endosome can occur at about pH 7.3, pH 7.2, pH 7.1, pH 7.0, pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH 5.0, pH 4.9, pH 4.8, pH 4.7, pH 4.6, pH 4.5, or lower.
- release of the target molecule can occur at a pH of from about pH 7.0 to about pH 4.5, from about pH 6.5 to about pH 5.0, or from about pH 6.0 to about pH 5.5.
- the receptor-binding peptide binds a receptor (e.g., a receptor that undergoes recycling) with pH-independent binding (e.g., high affinity at extracellular pH and high affinity at endosomal pH) and the target-binding peptide binds the target with pH-dependent binding (e.g., high affinity at extracellular pH and low affinity at endosomal pH).
- a selective depletion complex (SDC) comprising a pH-independent receptor-binding peptide and a pH-dependent target-binding peptide may be catalytic (e.g., reused).
- the SDC may stay bound to the receptor through multiple rounds of endocytosis and has the potential to carry another target molecule in each round and leave the target molecule in the endosome/lysosome for degradation.
- one catalytic SDC molecule may cause the degradation of multiple target molecules.
- the receptor-binding peptide can bind to the receptor with an affinity that is pH dependent.
- the receptor-binding molecule can bind to the receptor with higher affinity at extracellular pH (such as about pH 7.4) and with lower affinity at a lower endosomal pH (such as about pH 5.5 or about pH 6.5), thereby releasing the selective depletion complex from the receptor upon internalization and acidification of the endosomal compartment.
- the receptor-binding peptide can bind the receptor with an affinity that is pH dependent and the target-binding peptide can bind the target with an affinity that is pH dependent or that is pH-independent.
- a selective depletion molecule can be used to selectively deplete a target molecule (e.g., a soluble protein or a cell surface protein).
- a selective depletion complex comprising a receptor-binding peptide and a target- binding peptide can bind to the receptor via the receptor-binding peptide and to a target molecule (e.g., a soluble protein or a cell surface protein).
- the target molecule can be delivered to an endocytic compartment via receptor-mediated endocytosis of the receptor and the selective depletion molecule.
- the selective depletion complex In the endocytic compartment, the selective depletion complex can remain bound to the receptor, and the target molecule can be released from the selective depletion complex as the endocytic compartment acidifies.
- the selective depletion molecule can be recycled to the cell surface along with the receptor, and the target molecule can continue to the lysosome where it is degraded. In some embodiments, the target molecule can remain in the lysosome without being degraded, resulting in enrichment of the target molecule in the lysosome.
- the selective depletion complexes of the present disclosure can have a low molecular weight compared to target-binding antibodies and can be used to bind and deplete a target without requiring a supply and distribution cold chain.
- a receptor-binding peptide may bind to a cellular receptor (e.g., TfR or PD-L1) with an equilibrium dissociation constant (KD) of less than 50 ⁇ M, less than 5 ⁇ M, less than 500 nM, less than 100 nM, less than 40 nM, less than 30 nM, less than 20 nM, less than 10 nM, less than 5 nM, less than 2 nM, less than 1 nM, less than 0.5 nM, less than 0.4 nM, less than 0.3 nM, less than 0.2 nM, or less than 0.1 nM.
- KD equilibrium dissociation constant
- a receptor-binding peptide has an off rate that is slower than the recycling rate of the cellular receptor, such that the receptor-binding peptide is likely to remain bound to receptor during the recycling process.
- the receptor-binding peptide may have an off rate that is no faster than 1 minute, no faster than 2 minutes, no faster than 3 minutes, no faster than 4 minutes, no faster than 5 minutes, no faster than 7 minutes, no faster than 10 minutes, no faster than 15 minutes, or no faster than 20 minutes.
- the receptor-binding peptide may have an off rate that is from about 1 minute to about 20 minutes, from about 2 minutes to about 15 minutes, from about 2 minutes to about 10 minutes, or from about 5 minutes to about 10 minutes.
- the selective depletion complexes of the present disclosure can be used to treat a disease or a condition by selectively depleting a target molecule that is associated with the disease or the condition.
- a selective depletion complex can be used to selectively deplete a soluble or cell surface protein that accumulates, contains a disease-associated mutation (e.g., a mutation causing constitutive activity, resistance to treatment, or dominant negative activity), or is over-expressed in a disease state.
- the selective depletion complexes of the present disclosure can be used for the treatment and prevention of various neurological diseases including but not limited to epilepsy, schizophrenia, depression, anxiety, bipolar disorder, developmental brain disorders (e.g., autism spectrum), or mood disorder.
- Binding of the herein described selective depletion complexes e.g., peptide conjugates, fusion peptides, or recombinantly produced peptide complexes
- TfR a cell layer or barrier
- BBB e.g., via vesicular transcytosis
- a cell membrane e.g., via endocytosis
- Neurodegenerative diseases that can treated or prevented with the herein described selective depletion complexes can include Alzheimer's disease, Amyotrophic lateral sclerosis, Friedreich's ataxia, Huntington's disease, Lewy body disease, Parkinson's disease, multiple system atrophy (MSA), Spinal muscular atrophy, Motor neuron disease, Lyme disease, Ataxia-telangiectasia, Autosomal dominant cerebellar ataxia, Batten disease, Corticobasal syndrome, Creutzfeldt-Jakob disease, Fragile X-associated tremor/ataxia syndrome, Kufor-Rakeb syndrome, Machado- Joseph disease, multiple sclerosis, chronic traumatic encephalopathy, or frontotemporal dementia.
- Alzheimer's disease Amyotrophic lateral sclerosis, Friedreich's ataxia, Huntington's disease, Lewy body disease, Parkinson's disease, multiple system atrophy (MSA), Spinal muscular atrophy, Motor neuron disease, Lyme disease, Ataxia-telangie
- the TfR- binding peptide can be used in combination with BACE inhibitors, galantamine, amantadine, benztropine, biperiden, bromocriptin, carbidopa, donepezil, entacapone, levodopa, pergolie, pramipexole, procyclidine, rivastigmine, ropinirole, selegiline, tacrine, tolcapone, or trihexyphenidyl to treat and/or prevent a neurodegenerative disease.
- BACE inhibitors galantamine, amantadine, benztropine, biperiden, bromocriptin, carbidopa, donepezil, entacapone, levodopa, pergolie, pramipexole, procyclidine, rivastigmine, ropinirole, selegiline, tacrine, tolcapone, or trihexyphenidyl to treat and/or prevent a neurodegenerative disease.
- a selective depletion complex comprising a target-binding peptide that binds a protein associated with neurodegeneration (e.g., tau, amyloid B (AB), huntingtin, or a-synuclein) can be used to treat a neurodegenerative disease.
- a protein associated with neurodegeneration e.g., tau, amyloid B (AB), huntingtin, or a-synuclein
- Binding of the herein described selective depletion complexes e.g., peptide conjugates, fusion peptides, or recombinantly produced peptide complexes
- TfR a cell layer or barrier
- BBB e.g., via vesicular transcytosis
- a cell membrane e.g., via endocytosis
- Cancers that can treated or prevented with the herein described selective depletion complexes can include breast cancer, liver cancer, colon cancer, brain cancer, leukemia, lymphoma, non-Hodgkin lymphoma, myeloma, blood-cell-derived cancer, spleen cancer, lung cancer, pancreatic cancer, prostate cancer, sarcoma, stomach cancer, esophageal cancer, gastrointestinal (GI) cancers, thyroid cancer, endometrial cancer, bladder cancer, cancers of the salivary gland, kidney cancer, muscle cancers, ovarian cancer, glioblastoma, astrocytoma, glioma, medulloblastoma, ependymoma, choroid plexus carcinoma, midline glioma, diffuse intrinsic pontine glioma, lung cancer, bone marrow cell cancers, skin cancer, melanoma, genitourinary cancer, osteosarcoma, muscle- derived sarcoma, mela
- a selective depletion complex comprising a target-binding peptide that binds a protein associated with cancer (e g., HER2, EGFR, FGFR-1, PD-L1, VEGF, PD-1, CD38, GD2, SLAMF7, CTLA-4, CCR4, CD20, PDGFRa, VEGFR2, CD33, CD30, CD22, CD79B, Nectin-4, or TROP2) can be used to treat a cancer.
- a protein associated with cancer e e HER2, EGFR, FGFR-1, PD-L1, VEGF, PD-1, CD38, GD2, SLAMF7, CTLA-4, CCR4, CD20, PDGFRa, VEGFR2, CD33, CD30, CD22, CD79B, Nectin-4, or TROP2
- a protein associated with cancer e HER2, EGFR, FGFR-1, PD-L1, VEGF, PD-1, CD38, GD2, SLA
- a selective depletion complex for treatment of a cancer can comprise a target-binding peptide that binds an extracellular, soluble, or cell surface protein associated with cell growth, cell division, avoidance of cell death, immune evasion, suppression of inflammatory responses, promotion of vascular growth, or protection from hypoxia.
- a selective depletion complex of the present disclosure can be used to deplete anti-inflammatory stimuli (e.g., molecules associated with N2-polarized macrophages or molecules associated with microglia or regulatory T-cells) and promote tumor targeting abilities of abilities of the innate and adaptive immune systems.
- Selective depletion complexes comprising a target-binding peptide that binds molecules associated with the antiinflammatory stimuli can augment therapies that otherwise are prone to immune exhaustion (e.g. ionizing radiation or CAR-T cell therapies).
- the selective depletion complex may be used to reduce immune suppression or suppress pro-inflammatory signaling, such as in immune-mediated diseases.
- a selective depletion complex may comprise a target-binding peptide that binds a protein associated with immune suppression or pro-inflammatory signaling (e.g., CD47, CD39, CD24, CD25, CD74, TNF-a, IL-1, IL-1R, IL-2, IL-2R, IL-6, IL-6R, IL-10, IL-10R, IL-23, IL- 12, PD-1, PD-L1).
- a protein associated with immune suppression or pro-inflammatory signaling e.g., CD47, CD39, CD24, CD25, CD74, TNF-a, IL-1, IL-1R, IL-2, IL-2R, IL-6, IL-6R, IL-10, IL-10R, IL-23, IL- 12, PD-1, PD-L1.
- a selective depletion complex may be used to treat an inflammatory or neurological condition (e.g., neuroinflammation, neuroinflammatory disease, stroke, traumatic brain injury, Alzheimer’s disease, or other tauopathies including neurofibrillary tangle dementia, chronic traumatic encephalopathy (CTE), aging-related tau astrogliopathy, frontotemporal dementia, parkinsonism, progressive supranuclear palsy, corticobasal degeneration, lytico-bodig disease, ganglioglioma, meningioangiomatosis, or subacute sclerosing panencephalitis).
- a selective depletion complex comprising a TNF-a- binding peptide may be used to treat neuroinflammation, neuroinflammatory disease, stroke, traumatic brain injury, or Alzheimer’s disease.
- Binding of the herein described selective depletion complexes e.g., peptide conjugates, fusion peptides, or recombinantly produced peptide complexes
- TfR a cell layer or barrier
- BBB e.g., via vesicular transcytosis
- a cell membrane e.g., via endocytosis
- Harmful inflammation that can be treated or prevented with the herein described selective depletion complexes can include rheumatoid arthritis, psoriasis, multiple sclerosis, lupus, ankylosing spondylitis, antiphospholipid antibody syndrome, gout, inflammatory arthritis center, myositis, scleroderma, Sjogren’s disease, vasculitis, inflammatory bowel disease, ulcerative colitis, Crohn’s disease, graft-vs-host disease, cytokine storms, cystic fibrosis, inflammation-associated neurodegeneration (e.g., age- associated tauopathy or Alzheimer’s Disease), or autoimmune disorders.
- rheumatoid arthritis rheumatoid arthritis
- psoriasis multiple sclerosis
- lupus ankylosing spondylitis
- antiphospholipid antibody syndrome gout
- inflammatory arthritis center myositis, scleroderma, Sjogren’s disease
- a selective depletion complex comprising a target-binding peptide that binds a target associated with acute or chronic inflammation (e.g., apolipoprotein E4, TNF-a, IL-1, IL-6, IL-7, IL-12, and IL-23) to selectively deplete inflammatory cytokines or chemokines.
- a selective depletion complex may target autoantibodies, for example autoantibodies associated with disease, such as diabetes, thyroid disease, inflammatory disease, systemic lupus erythematosus (SLE or lupus), muscular function, skin disease, organ disease, kidney disease, or rheumatoid arthritis.
- a selective depletion complex comprising a targetbinding peptide that binds IL-6 can be used to treat inflammation associated with a coronavirus infection (e.g., SARS-CoV-2).
- a coronavirus infection e.g., SARS-CoV-2
- Selective depletion complexes that selectively deplete IL-6- elimiating can decrease IL-6 signaling.
- Apolipoprotein E4 can be associated with Alzheimer’s disease.
- Binding of the herein described selective depletion complexes e.g., peptide conjugates, fusion peptides, or recombinantly produced peptide complexes
- TfR a cell layer or barrier
- BBB e.g., via vesicular transcytosis
- a cell membrane e.g., via endocytosis
- Lysosomal storage diseases that can treated or prevented with the herein described selective depletion complexes can include Gaucher’s Disease (deficiency of glucocerebrosidase) or Njhk ⁇ Bdn ⁇ n ⁇ (_ ⁇ ad ⁇ d ⁇ i ⁇ t ja ⁇ -glucosidase).
- a lysosomal storage enzyme can be administered to the patient such that it is available in the serum or other extracellular fluids.
- a selective depletion complex of the present disclosure can be used to selectively recruit lysosomal enzymes to the lysosome, thereby treating a lysosomal storage disease associated with decreased expression of a lysosomal enzyme.
- the selective depletion complex comprising a target-binding peptide that binds a lysosomal enzyme (e.g., glucocerebrosidase or ⁇ -glucosidase) can selectively recruit the lysosomal enzyme into an endocytic compartment via TfR-mediated endocytosis.
- the selective depletion complex can be recycled to the cell surface, and the lysosomal enzyme target can be delivered to the lysosome, thereby enriching the lysosomal enzyme in the lysosome and treating the lysosomal storage disease.
- a selective depletion complex (e.g., comprising a target-binding peptide and a cellular receptor-binding peptide) or a selective depletion complex component (e.g., comprising a target-binding peptide or a cellular receptor-binding peptide and a dimerization domain) may comprise a sequence of any one of SEQ ID NO: 288 ⁇ SEQ ID NO: 313, SEQ ID NO: 315 ⁇ SEQ ID NO: 348, SEQ ID NO: 351, SEQ ID NO: 352, SEQ ID NO: 355, SEQ ID NO: 356, SEQ ID NO: 358, SEQ ID NO: 359, SEQ ID NO: 360, SEQ ID NO: 361, SEQ ID NO: 362, SEQ ID NO: 363, SEQ ID NO: 364, SEQ ID NO: 365, SEQ ID NO: 371, SEQ ID NO: 373, SEQ ID NO: 376, SEQ ID NO: 378, SEQ ID NO:
- a selective depletion complex (e.g., comprising a target-binding peptide and a cellular receptor- binding peptide) may comprise a sequence that has at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ ID NO: 96, or at least 80%, at least 90%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any one of SEQ ID NO: 288 ⁇ SEQ ID NO: 313, SEQ ID NO: 315 ⁇ SEQ ID NO: 348, SEQ ID NO: 351, SEQ ID NO: 352, SEQ ID NO: 355, SEQ ID NO: 356, SEQ ID NO: 358, SEQ ID NO: 359, SEQ ID NO: 360, SEQ ID NO: 361,
- Percent (%) sequence identity or homology is determined by conventional methods. (See e.g., Altschul et al. (1986), Bull. Math. Bio.48:603 (1986), and Henikoff and Henikoff (1992), Proc. Natl. Acad. Sci. USA 89:10915). Briefly, two amino acid sequences can be aligned to optimize the alignment scores using a gap opening penalty of 10, a gap extension penalty of 1, ⁇ i_ oc ⁇ ⁇ @JMQSK62 ⁇ n ⁇ jmdib h ⁇ omds ja F ⁇ idfjaa ⁇ i_ F ⁇ idfjaa (G_.).
- Rc ⁇ n ⁇ lp ⁇ i ⁇ d_ ⁇ itity or homology is then calculated as: ([Total number of identical matches]/[length of the longer sequence plus the number of gaps introduced into the longer sequence in order to align the two sequences])(100).
- Various methods and software programs can be used to determine the homology between two or more peptides, such as NCBI BLAST, Clustal W, MAFFT, Clustal Omega, AlignMe, Praline, or another suitable method or algorithm. Pairwise sequence alignment can be used to identify regions of similarity that can indicate functional, structural and/or evolutionary relationships between two biological sequences (e.g., amino acid or nucleic acid sequences).
- multiple sequence alignment is the alignment of three or more biological sequences. From the output of MSA applications, homology can be inferred and the evolutionary relationship between the sequences assessed.
- sequence homology and “sequence identity” and “percent (%) sequence identity” and “percent (%) sequence homology” are used interchangeably to mean the sequence relatedness or variation, as appropriate, to a reference polynucleotide or amino acid sequence.
- the “FASTA” similarity search algorithm of Pearson and Lipman can be a suitable protein alignment method for examining the level of sequence identity or homology shared by an amino acid sequence of a peptide disclosed herein and the amino acid sequence of a peptide variant.
- the FASTA algorithm is described, for example, by Pearson and Lipman, Proc. Nat’l Acad. Sci. USA 85:2444 (1988), and by Pearson, Meth. Enzymol. 183:63 (1990).
- the ten regions with the highest density of identities are then rescored by comparing the similarity of all paired amino acids using an amino acid substitution matrix, and the ends of the regions are “trimmed” to include only those residues that contribute to the highest score.
- the trimmed initial regions are examined to determine whether the regions can be joined to form an approximate alignment with gaps.
- the highest scoring regions of the two amino acid sequences are aligned using a modification of the Needleman-Wunsch-Sellers algorithm (Needleman and Wunsch, ./. Mol. Biol. 48:444 (1970); Sellers, Siam J. Appl. Math. 26:787 (1974)), which allows for amino acid insertions and deletions.
- FASTA can also be used to determine the sequence identity or homology of nucleic acid sequences or molecules using a ratio as disclosed above.
- the ktup value can range between one to six, preferably from three to six, most preferably three, with other parameters set as described herein.
- ⁇ amino acids that are a “conservative amino acid substitution” are illustrated by a substitution among amino acids within each of the following groups: (1) glycine, alanine, valine, leucine, and isoleucine, (2) phenylalanine, tyrosine, and tryptophan, (3) serine and threonine, (4) aspartate and glutamate, (5) glutamine and asparagine, and (6) lysine, arginine and histidine.
- the BLOSUM62 table is an amino acid substitution matrix derived from about 2,000 local multiple alignments of protein sequence segments, representing highly conserved regions of more than 500 groups of related proteins (Henikoff and Henikoff, Proc. Nat'l Acad. Sci.
- the BLOSUM62 substitution frequencies can be used to define conservative amino acid substitutions that can be introduced into the amino acid sequences of the present invention.
- conservative amino acid substitution preferably refers to a substitution represented by a BLOSUM62 value of greater than -1.
- an amino acid substitution is conservative if the substitution is characterized by a BLOSUM62 value of 0, 1, 2, or 3.
- preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 1 (e.g., 1, 2 or 3), while more preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 2 (e.g., 2 or 3).
- Determination of amino acid residues that are within regions or domains that are critical to maintaining structural integrity can be determined. Within these regions one can determine specific residues that can be more or less tolerant of change and maintain the overall tertiary structure of the molecule.
- Methods for analyzing sequence structure include, but are not limited to, alignment of multiple sequences with high amino acid or nucleotide identity or homology and computer analysis using available software (e.g., the Insight II.RTM. viewer and homology modeling tools; MSI, San Diego, Calif.), secondary structure propensities, binary patterns, complementary packing and buried polar interactions (Barton, G.J., Current Opin. Struct. Biol.
- a peptide of the present disclosure e.g., a TfR-binding peptide, a target-binding peptide, or a selective depletion complex
- a peptide can be engineered to improve or alter a property of the peptide.
- a peptide can be modified to alter the affinity of the peptide for a binding partner (e.g., a target molecule or a TfR).
- a peptide can be modified to alter binding affinity in a pH-dependent manner.
- a peptide can be modified my introducing one or more amino acid variations into the peptide sequence and testing the effect of the variation on peptide properties (e.g., binding affinity).
- a peptide or a library of peptides is designed in silico without derivation from a naturally occurring scaffold of a knotted peptide.
- a peptide or a library of peptides is designed in silico by derivation, grafting relevant protein- binding residues, or conserved residues in the protein-binding interface a naturally occurring peptide or protein known to bind to a protein or receptor of interest.
- the peptide (e.g., a TfR-binding peptide of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64) is a simple helix-turn-helix.
- the helix-turn-helix can be used for pharmacophore transfer onto other scaffolds, for example engraftment of the required TfR-engaging surface onto the helix-turn-helix scaffold using fusion tagging.
- a peptide comprising SEQ ID NO: 1 is used as a scaffold or base sequence for further modifications, including addition, deletion, or amino acid substitution.
- short sequences of amino acid residues such as GS are added at the N- terminus of a peptide.
- peptides lack GS at the N-terminus.
- peptides undergo one or more post-translational modifications.
- a peptide capable of binding TfR and transcytosis across a cell membrane comprises a sequence with at least 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with any one of the exemplary peptide sequences listed in TABLE 1 (SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64) or a functional fragment thereof
- Two or more peptides can share a degree of sequence identity or homology and share similar properties in vivo.
- a peptide can share a degree of sequence identity or homology with any one of the peptides of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64.
- one or more peptides of the present disclosure have up to about 20% pairwise sequence identity or homology, up to about 25% pairwise sequence identity or homology, up to about 30% pairwise sequence identity or homology, up to about 35% pairwise sequence identity or homology, up to about 40% pairwise sequence identity or homology, up to about 45% pairwise sequence identity or homology, up to about 50% pairwise sequence identity or homology, up to about 55% pairwise sequence identity or homology, up to about 60% pairwise sequence identity or homology, up to about 65% pairwise sequence identity or homology, up to about 70% pairwise sequence identity or homology, up to about 75% pairwise sequence identity or homology, up to about 80% pairwise sequence identity or homology, up to about 85% pairwise sequence identity or homology, up to about 90% pairwise sequence identity or homology, up to about 95% pairwise sequence identity or homology, up to about 96% pairwise sequence identity or homology, up to about 97% pairwise sequence identity or homology, up to about 98% pairwise sequence identity or homology
- one or more peptides of the disclosure have at least about 20% pairwise sequence identity or homology, at least about 25% pairwise sequence identity or homology, at least about 30% pairwise sequence identity or homology, at least about 35% pairwise sequence identity or homology, at least about 40% pairwise sequence identity or homology, at least about 45% pairwise sequence identity or homology, at least about 50% pairwise sequence identity or homology, at least about 55% pairwise sequence identity or homology, at least about 60% pairwise sequence identity or homology, at least about 65% pairwise sequence identity or homology, at least about 70% pairwise sequence identity or homology, at least about 75% pairwise sequence identity or homology, at least about 80% pairwise sequence identity or homology, at least about 85% pairwise sequence identity or homology, at least about 90% pairwise sequence identity or homology, at least about 95% pairwise sequence identity or homology, at least about 96% pairwise sequence identity or homology, at least about 97% pairwise sequence identity or homology, at least about 98% pairwise sequence identity or homology,
- peptides that exhibit an improved TfR receptor binding show improved transcytosis function. In some cases, peptides that exhibit an improved TfR receptor binding show no or small changes in transcytosis function. In some cases, peptides that exhibit an improved TfR receptor binding show reduced transcytosis function.
- the K A and K D values of a TfR-binding peptide can be modulated and optimized (e.g., via amino acid substitutions) to provide an optimal ratio of TfR-binding affinity and efficient transcytosis function.
- the peptide or peptide complex is any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64, or a functional fragment thereof.
- the peptide or peptide complex of the disclosure further comprises a peptide with 99%, 95%, 90%, 85%, or 80% sequence identity or homology to any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64 or functional fragment thereof.
- the peptide or peptide complex can be a peptide that is homologous to any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64, or a functional fragment thereof.
- oc ⁇ o ⁇ mh ⁇ cjhjgjbjpn ⁇ ⁇ i ] ⁇ pn ⁇ _ c ⁇ m ⁇ di oj denote peptides or peptide complexes having at least 70%, at least 80%, at least 90%, at least 95%, or greater than 95% sequence identity or homology to a sequence of any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64 or a functional fragment thereof.
- a fragment can be least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 450, at least 500, at least 600, at least 700, at least 800, at least 900 or at least 1000 amino acids in length.
- fragments can be at most 1000, at most 900, at most 800, at most 700, at most 600, at most 500, at most 450, at most 400, at most 350, at most 300, at most 250, at most 200, at most 150, at most 100, at most 50, at most 45, at most 40, at most 35, at most 30, at most 25, at most 20, at most 15, at most 10, or at most 5 amino acids in length.
- a fragment can be from about 5 to about 50, from about 10 to about 50, from about 10 to about 40, from about 10 to about 30, or from about 10 to about 20 amino acids in length.
- nucleic acid molecules that encode a peptide or peptide complex of any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64 can be identified by either a determination of the sequence identity or homology of the encoded peptide amino acid sequence with the amino acid sequence of any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64, or by a nucleic acid hybridization assay.
- Such peptide variants or peptide complex variants of any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64 can be characterized as nucleic acid molecules (1) that remain hybridized with a nucleic acid molecule having the nucleotide sequence of any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64 (or its complement) under highly stringent washing conditions, in which the wash stringency is equivalent to 0.1 ⁇ 0.2 ⁇ SSC with 0.1% SDS at 50-65° C., and (2) that encode a peptide having at least 70%, at least 80%
- Affinity Maturation [0297] A peptide of the present disclosure (e.g., a target-binding peptide, TfR-binding peptide, or a selective depletion complex) can be identified or modified through affinity maturation.
- a target-binding peptide that binds a target of interest can be identified by affinity maturation of a binding peptide (e.g., a CDP, a nanobody, an affibody, a DARPin, a centyrin, a nanofittin, an adnectin, or an antibody fragment).
- a binding peptide e.g., a CDP, a nanobody, an affibody, a DARPin, a centyrin, a nanofittin, an adnectin, or an antibody fragment.
- a binding peptide can undergo affinity maturation by generating a library of every possible point mutation, or in the case of a CDP, every possible non-cysteine point mutation.
- the variant library can be expressed via surface display (e.g., in yeast or mammalian cells) and screened for binding to a binding partner (e.g., a target molecule or TfR).
- a binding partner e.g., a target molecule or TfR.
- Library members with increased binding affinity relative to the initial peptide or relative to other members of the variant library can undergo subsequent rounds of maturation During each round a variant library of every possible non cysteine point mutation is generated and screened.
- a peptide can undergo 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 rounds of affinity maturation to identify a peptide with improved binding affinity to the binding partner of interest (e.g., a target molecule or TfR). Variants can be identified by Sanger sequencing, next generation sequencing, or high throughput sequencing (e.g., Illumina sequencing). [0298] In some embodiments, a peptide (e.g., a TfR-binding peptide or a target-binding peptide) can be selected for pH-independent binding.
- a peptide can be selected for high affinity binding to a binding partner (e.g., a target molecule or a TfR) at both extracellular pH (about pH 7.4) and at endosomal pH (such as about pH 5.5).
- a peptide with pH-independent binding can bind to a binding partner with a dissociation constant (K D ) of less than 50 ⁇ M, less than 5 ⁇ M, less than 500 nM, less than 100 nM, less than 40 nM, less than 30 nM, less than 20 nM, less than 10 nM, less than 5 nM, less than 2 nM, less than 1 nM, less than 0.5 nM, less than 0.4 nM, less than 0.3 nM, less than 0.2 nM, or less than 0.1 nM at extracellular pH (about pH 7.4).
- K D dissociation constant
- a target-binding peptide with pH-dependent binding can bind a target molecule with a dissociation constant (KD) of less than 50 ⁇ M, less than 5 ⁇ M, less than 500 nM, less than 100 nM, less than 40 nM, less than 30 nM, less than 20 nM, less than 10 nM, less than 5 nM, less than 2 nM, less than 1 nM, less than 0.5 nM, less than 0.4 nM, less than 0.3 nM, less than 0.2 nM, or less than 0.1 nM at endosomal pH (such as about pH 5.5).
- KD dissociation constant
- the TfR-binding peptides are stable at endosomal pH, and do not release in the endosome for example under acidic conditions, such as pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH 5.0, pH 4.9, pH 4.8, pH 4.7, pH 4.6, pH 4.5, or lower.
- acidic conditions such as pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH 5.0, pH 4.9, pH 4.8, pH 4.7, pH 4.6, pH 4.5, or lower.
- a peptide that has high affinity for binding to a selected target and used in selective depletion complexes as the peptide or peptide complex that binds such selected target and is released in the endosome for degradation within the cell can be a pH-dependent target-binding CDP such that it is released in the endosome.
- the target-binding peptides are less stable at endosomal pH, and release wholly or in part in the endosome for example under acidic conditions, such as pH7.3, pH7.2, pH7.1, pH7.0, pH6.9, pH6.8, pH6.7, pH6.6, pH6.5, pH6.4, pH6.3, pH6.2, pH 6.1, pH6.0, pH5.9, pH5.8, pH5.7, pH5.6, pH5.5, pH5.4, pH5.3, pH5.2, pH5.1, pH5.0, pH4.9, pH4.8, pH4.7, pH4.6, pH4.5, or lower.
- acidic conditions such as pH7.3, pH7.2, pH7.1, pH7.0, pH6.9, pH6.8, pH6.7, pH6.6, pH6.5, pH6.4, pH6.3, pH6.2, pH 6.1, pH6.0, pH5.9, pH5.8, pH5.7, pH5.6, pH5.5, pH5.4, pH5.3, pH5.2, pH5.1, pH5.0, pH4.9, pH4.8, pH4.7, pH4.6, pH4.5, or lower.
- the peptides of the present disclosure can be modified for pH-dependent binding properties. Imparting pH-dependent binding to a target-binding peptide (e.g., a target-binding CDP) can be performed in three stages. First, a library of peptide variant containing histidine (His) point mutations can be designed.
- His histidine
- Histidine amino acids are introduced into the target-binding peptide because His is the only natural amino acid whose side chain has a pK a value between neutral (pH 7.4) and acidic (pH ⁇ 6) endosomal conditions, and this change of charge as pH changes can alter binding, either directly (e.g., changing charge-charge interaction upon formation of a positive charge at low pH) or indirectly (e.g., the change in charge imparts a subtle change in the structure of the target-binding peptide, disrupting an interface between the target molecule and the target-binding peptide).
- a variant screen of the target-binding peptide can be implemented by generating double-His doped libraries.
- a double-His doped library of a target-binding CDP can comprise a library where every non-Cys, non-His residue is substituted with a His amino acid one- or two-at-a-time.
- a variant library can be expressed in cells (e.g., yeast cells or mammalian cells) via surface display, with each target-binding peptide variant containing one or two His substitutions.
- Target-binding peptide variants can be tested for maintenance of binding under neutral pH (about pH 7.4), and for reduced binding under low pH (about pH 6.0 or about pH 5.5). Variants that demonstrated reduced binding affinity under low pH as compared to neutral pH can be identified as target-binding peptides with pH-dependent binding.
- the target-binding peptides of the present disclosure can have a high target binding affinity at physiologic extracellular pH but a significantly reduced binding affinity at lower pH levels such as endosomal pH of 5.5.
- the target-binding peptides of the present disclosure can be optimized for improved intra-vesicular (e.g., intra-endosomal) and/or intracellular delivery function while retaining high target binding capabilities.
- histidine scans and comparative binding experiments can be performed to develop and screen for such peptides.
- an amino acid residue in a peptide of the present disclosure is substituted with a different amino acid residue to alter a pH-dependent binding affinity to a target molecule.
- the amino acid substitution can increase a binding affinity at low pH, increase a binding affinity at high pH, decrease a binding affinity at low pH, decrease a binding affinity at high pH, or a combination thereof.
- a target-binding peptide with pH-dependent binding can bind a target molecule with a dissociation constant (KD) of less than 50 ⁇ M, less than 5 ⁇ M, less than 500 nM, less than 100 nM, less than 40 nM, less than 30 nM, less than 20 nM, less than 10 nM, less than 5 nM, less than 2 nM, less than 1 nM, less than 0.5 nM, less than 0.4 nM, less than 0.3 nM, less than 0.2 nM, or less than 0.1 nM at extracellular pH (such as about pH 7.4).
- KD dissociation constant
- a target-binding peptide with pH-dependent binding can bind a target molecule with a dissociation constant (K D ) at least 1 nM, at least 2 nM, at least 5 nM, at least 10 nM, at least 20 nM, at least 50 nM, of at least 100 nM, at least 200 nM, at least 500 nM, at least 1 ⁇ M, at least 2 ⁇ M, at least 5 ⁇ M, at least 10 ⁇ M, at least 20 ⁇ M, at least 50 ⁇ M, at least 100 ⁇ M, at least 500 ⁇ M, at least 1 mM, at least 2 mM, at least 5 mM, at least 10 mM, at least 20 mM, at least 50 mM, at least 100 mM, at least 200 mM, at least 500 mM, or at least 1 M at endosomal pH (such as about pH 5.5).
- K D dissociation constant
- the TfR-binding peptides are stable at endosomal pH, and do not release in the endosome for example under acidic conditions, such as pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH 5.0, pH 4.9, pH 4.8, pH 4.7, pH 4.6, pH 4.5, or lower.
- acidic conditions such as pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH 5.0, pH 4.9, pH 4.8, pH 4.7, pH 4.6, pH 4.5, or lower.
- a peptide that has high affinity for binding to a selected target and used in selective depletion complexes as the peptide or peptide complex that binds such selected target and is released in the endosome for degradation within the cell can be a pH-dependent target-binding CDP such that it is released in the endosome.
- the target- binding peptides are less stable at endosomal pH, and release wholly or in part in the endosome for example under acidic conditions, such as pH 7.3, pH 7.2, pH 7.1, pH 7.0, pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH 5.0, pH 4.9, pH 4.8, pH 4.7, pH 4.6, pH 4.5, or lower.
- acidic conditions such as pH 7.3, pH 7.2, pH 7.1, pH 7.0, pH 6.9, pH 6.8, pH 6.7, pH 6.6, pH 6.5, pH 6.4, pH 6.3, pH 6.2, pH 6.1, pH 6.0, pH 5.9, pH 5.8, pH 5.7, pH 5.6, pH 5.5, pH 5.4, pH 5.3, pH 5.2, pH 5.1, pH
- the selective depletion complexes of the present disclosure may be used to exert an effect on a cell, tissue, or subject.
- the effect may be a therapeutic, pharmacological, biological, or biochemical effect.
- the effect may result from selective depletion of a target molecule to which the selective depletion complex binds.
- the effect may result from ternary complex formation between a target, a receptor, and a selective depletion complex that binds the target and the receptor.
- a method of the present disclosure can comprise selectively recruiting a molecule to an endocytic compartment via transferrin receptor-mediated endocytosis and enriching the target molecule in the lysosome.
- a selective depletion complex (e.g., a complex comprising a receptor-binding peptide conjugated to a target-binding peptide) can bind to the receptor via the receptor-binding peptide and to a target molecule (e.g., a soluble protein, an extracellular protein, or a cell surface protein).
- the target molecule can be delivered to an endocytic compartment via receptor-mediated endocytosis of the receptor and the selective depletion molecule.
- the selective depletion complex In the endocytic compartment, the selective depletion complex can remain bound to the receptor, and the target molecule can be released from the selective depletion complex as the endocytic compartment acidifies.
- the selective depletion molecule can be recycled to the cell surface along with the the receptor, and the target molecule can continue to the lysosome where it is degraded. In some embodiments, the target molecule can remain in the lysosome without being degraded, resulting in enrichment of the target molecule in the lysosome, such as lysosomal enzymes in lysosomal storage diseases.
- the methods of the present disclosure for selectively depleting a target molecule or for selectively enriching a target molecule in the lysosome can be used to treat a disease or condition associated with the target molecule. For example, selective depletion of a target molecule associated with neurodegeneration can be used to treat a neurodegenerative disease.
- selective depletion of a target molecule associated with cancer can be used to treat the cancer.
- Depletion of a cell surface molecule can allow the cancer cell to be targeted by the immune system, to lose checkpoint inhibition, can disable survival signaling, or remove drug resistance pumps.
- selective depletion of an inflammatory molecule can be used to treat harmful inflammatory signaling.
- selective enrichment in the lysosome of a lysosomal enzyme associated with a lysosomal storage disease can be used to treat the lysosomal storage disease.
- a lysosomal enzyme can be administered in co-therapy with the target-depleting complex, such that the target depleting complex drives the lysosomal enzyme into the lysosomal compartment.
- a method of treating a disease or condition can comprise contacting a cell (e.g., a cell expressing the receptor) with a selective depletion complex of the present disclosure.
- the selective depletion complex can be administered to a subject (e.g., a human subject) having a disease or condition (e.g., a neurodegenerative disease, a cancer, harmful inflammation, or a lysosomal storage disease).
- TfR is a ubiquitous protein, as all mammalian cells require iron and therefore take up transferrin through this constitutive pathway.
- any target tissue would be amenable to the selective depletion methods or selective enrichment methods of the present disclosure comprising a TfR-binding peptide.
- Tumor tissue can be particularly well- suited for the methods of the present disclosure as most tumors are enriched for TfR, which can impart natural tumor selectivity in the selective depletion molecules.
- Liver tissue can also be highly enriched for TfR and thus be a favorable tissue for selective depletion methods.
- the selective depletion complexes of the present disclosure e.g., selective depletion complexes comprising a CDP
- a selective depletion complex of the present disclosure can have a half-life in the liver of at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9, or at least about 10 hours.
- Serum proteins which can already largely be subject to hepatic metabolism as a class, could be targeted for selective depletion with relatively low doses of selective depletion complexes.
- Serum half-life of the selective depletion complexes of the present disclosure could be improved to create a molecule that requires infrequent dosing, for example by addition of a serum half-life extension peptide.
- Selective depletion complexes with a shorter half-life can serve as an acute target elimination drug, for example to treat harmful inflammatory signaling.
- a selective depletion complex can be administered to a subject systemically or peripherally and can accumulate in tissue with high levels of TfR expression (e.g., tumor tissue, kidney tissue, spleen, bone marrow, or liver tissue).
- a selective depletion complex can be administered to a subject systemically or peripherally and can accumulate in kidney tissue or liver tissue.
- a selective depletion complex can comprise a tissue targeting domain and can accumulate in the target tissue upon administration to a subject.
- selective depletion complexes can be conjugated to, linked to, or fused to a molecule (e.g., small molecule, peptide, or protein) with targeting or homing function for a cell of interest or a target protein located on the surface or inside said cell.
- a selective depletion complex can be administered to a subject orally and can reach the gastrointestinal tract.
- Orally administered selective depletion complexes can be used for clearance of disease-associated proteins in the gastrointestinal tract.
- a selective depletion complex of the present disclosure can be genetically encoded into a benign cell with a secretory phenotype.
- the selective depletion complex can be expressed by the secretory cell and administered as a secreted molecule in a localized cellular therapy.
- a gene encoding a selective depletion complex can be delivered as a gene therapy to a tissue of interest (e.g., liver, hematopoietic, kidney, skin, tumor, central nervous system (CNS), or neurons).
- a tissue of interest e.g., liver, hematopoietic, kidney, skin, tumor, central nervous system (CNS), or neurons.
- a target-binding peptide of a selective depletion construct may comprise a miniprotein, a nanobody, an antibody, an IgG, an antibody fragment, a Fab, a F(ab)2, an scFv, an (scFv)2, a DARPin, or an affibody.
- the target-binding peptide may comprise a cystine-dense peptide, an affitin, an adnectin, an avimer, a Kunitz domain, a nanofittin, a fynomer, a bicyclic peptide, a beta-hairpin, or a stapled peptide.
- the target-binding peptide may comprise an antibody single chain variable fragment (scFv) that binds PD-L1, FGFR-1, VEGF, PD-1, EGFR, CD38, GD2, SLAMF7, CTLA-4,
- scFv antibody single chain variable fragment
- a target-binding peptide of a selective depletion complex may bind to a target molecule, such as a target molecule with clinical relevance.
- a target molecule may be a protein that is over-expressed or over-activated in a disease or condition.
- a target molecule may be a transmembrane protein involved in oncogenic signaling, immune suppression, or pro- inflammatory signaling.
- target molecules that may be targeted by a target-binding peptide of the present disclosure include but are not limited to CD3, CD47, CD28, CD 137, CD89, CD 16, CD29, CD44, CD71, CD73, CD90, CD105, CD166, CD27, CD39, CD24, CD25, CD74, CD40L, MUC1 , MUC16, MUC2, MUC5AC, MUC4, 0X40, 4-1BB, HLA-G, LAG3, Tim3, TIGIT, GITR, TCR, TNF-a, EGFR, EGFRvIII, TKI-resistant EGFR, HER2, ERBB3, PDGFR, FGF, VEGF, VEGFR, IGFR1, CTLA4, STROl, complement factor C4, complement factor Clq, complement factor Cls, complement factor Clr, complement factor C3, complement factor C3a, complement factor C3b, complement factor C5, complement factor C5a, TGF[:S, PCSK9, P2Y6, HER3, RAN
- Endocytosis and subsequent degradation of the target molecule by a selective depletion complex may treat (e.g., eliminate, reduce, slow progression of, or treat symptoms of) a disease or condition associated with the target molecule (e.g., CD3, CD47, CD28, CD137, CD89, CD16, CD29, CD44, CD71, CD73, CD90, CD105, CD166, CD27, CD39, CD24, CD25, CD74,
- a disease or condition associated with the target molecule e.g., CD3, CD47, CD28, CD137, CD89, CD16, CD29, CD44, CD71, CD73, CD90, CD105, CD166, CD27, CD39, CD24, CD25, CD74,
- CD40L MUC1 , MUC16, MUC2, MUC5AC, MUC4, 0X40, 4-1BB, HLA-G, LAG3, Tim3, TIGIT, GITR, TCR, TNF-a, EGFR, EGFRvIII, TKI-resistant EGFR, HER2, ERBB3, PDGFR, FGF, VEGF, VEGFR, IGFR1, CTLA4, STROl, complement factor C4, complement factor Clq, complement factor Cls, complement factor Clr, complement factor C3, complement factor C3a, complement factor C3b, complement factor C5, complement factor C5a, TGF[:S, PCSK9, P2Y6, HER3, RANK, tau, amyloid B, huntingtin, a-synuclein, glucocerebrosidase, a-glucosidase, IL-1, IL-IR, , IL-1 a, IL-Ib, IL-2, IL-2R, IL-4,
- the target molecule is over-expressed in the disease or condition and depleting the target molecule reduces the level of the target molecule, thereby treating the disease or condition. In some embodiments, the target molecule accumulates in the disease or condition and depleting the target molecule clears or reduces the accumulation, thereby treating the disease or condition. In some embodiments, the target molecule is hyper- activated or over-stimulated, and depleting the target molecule reduces a level of activity of the target molecule, thereby treating the disease or condition.
- cancers e.g., non-small-cell lung cancer, primary non-small-cell lung cancer, metastatic non-small-cell lung cancer, head and neck cancer, head and neck squamous cell carcinoma, glioblastoma, brain cancer, metastatic brain cancer, colorectal cancer, colon cancer, tyrosine kinase inhibitor (
- KRAS wildtype cancer, KRAS mutant cancers, or exon20 mutant non-small-cell lung cancer inflammation, inflammatory conditions, neurological conditions (e.g., neuroinflammation, neuroinflammatory disease, stroke, traumatic brain injury, Alzheimer’s disease, or other tauopathies including neurofibrillary tangle dementia, chronic traumatic encephalopathy (CTE), aging-related tau astrogliopathy, frontotemporal dementia, parkinsonism, progressive supranuclear palsy, corticobasal degeneration, lytico-bodig disease, ganglioglioma, meningioangiomatosis, or subacute sclerosing panencephalitis).
- CTE chronic traumatic encephalopathy
- aging-related tau astrogliopathy frontotemporal dementia
- parkinsonism progressive supranuclear palsy
- corticobasal degeneration corticobasal degeneration
- lytico-bodig disease ganglioglioma
- Administration of a selective depletion complex of the present disclosure may be combined with an additional therapy to treat a disease or condition.
- administration of a selective depletion complex to treat a cancer may be combined with administration of radiation therapy, chemotherapy, platinum therapy, or anti-metabolic therapy.
- the additional therapy may comprise administering fluorouracil, FOLFIRI, irinotecan, FOLFOX, gemcitabine, or cisplatin to the subject.
- the ternary complex may form through binding of the receptor-binding peptide to the receptor and binding of the target-binding peptide to the target.
- Ternary complex formation between the target, the receptor, and the selective depletion complex may exert a therapeutic, pharmacological, biological, or biochemical effect on a cell, tissue, or subject expressing the target and the receptor.
- formation of a ternary complex between a receptor, a target, and a selective depletion complex may increase recycling or turnover of the target molecule, the receptor, or both. Increased recycling or turnover of the target or the receptor may alter (e.g., increase) activity of the target or the receptor, thereby exerting a therapeutic, pharmacological, biological, or biochemical effect.
- Formation of the ternary complex may exert a therapeutic, pharmacological, biological, or biochemical by recruiting the target molecule to the receptor. Recruitment of the target molecule to the receptor may promote a binding interaction between the receptor and the target. In some embodiments, subsequent recycling of the receptor and the target may facilitate the therapeutic, pharmacological, biological, or biochemical effect. In some embodiments, formation of the ternary complex may stabilize the interaction between the target and the receptor.
- a peptide of the present disclosure can comprise a wide range of physicochemical properties such as molecular size and structure, pH, isoelectric point, and overall molecular net charge. These parameters can have an effect on the peptides ability to bind TfR, bind a target molecule, promote transcytosis, transport of cargo molecules across cell barrier such as the BBB, or combinations thereof.
- a peptide of the present disclosure can comprise at least one amino acid residue in D configuration.
- a peptide is about 5-100 amino acid residues long.
- a peptide is about 10-90 amino acid residues long.
- a peptide is about 15-80 amino acid residues long.
- a peptide is about 15-75 amino acid residues long.
- a peptide is about 15-70 amino acid residues long.
- a peptide is about 20-65 amino acid residues long.
- a peptide is about 20-60 amino acid residues long.
- a peptide is about 25-55 amino acid residues long.
- a peptide is about 25-50 amino acid residues long. In some embodiments, a peptide is about 25-40 amino acid residues long. In some embodiments, a peptide is about 11-35 amino acid residues long. In some embodiments, a peptide is about 10-25 amino acid residues long.
- a peptide is at least 5 amino acid residues long. In some embodiments, a peptide is at least 10 amino acid residues long. In some embodiments, a peptide is at least 15 amino acid residues long. In some embodiments, a peptide is at least 20 amino acid residues long. In some embodiments, a peptide is at least 25 amino acid residues long. In some embodiments, a peptide is at least 30 amino acid residues long. In some embodiments, a peptide is at least 35 amino acid residues long. In some embodiments, a peptide is at least 40 amino acid residues long. In some embodiments, a peptide is at least 45 amino acid residues long.
- a peptide is at least 50 amino acid residues long. In some embodiments, a peptide is at least 55 amino acid residues long. In some embodiments, a peptide is at least 60 amino acid residues long. In some embodiments, a peptide is at least 65 amino acid residues long. In some embodiments, a peptide is at least 70 amino acid residues long. In some embodiments, a peptide is at least 75 amino acid residues long.
- an amino acid sequence of a peptide as described herein comprises at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, at least 30, at least 31, at least 32, at least 33, at least 34, at least 35, at least 36, at least 37, at least 38, at least 39, at least 40, at least 41, at least 42, at least 43, at least 44, at least 45, at least 46, at least 47, at least 48, at least 49, at least 50, at least 51, at least 52, at least 53, at least 54, at least 55, at least 56, at least 57, at least 58 residues, at least 59, at least 60, at least 61, at least 62, at least 63, at least 64, at least 65, at least 66, at least 67, at least 68, at least 69, at least 70,
- a three-dimensional or tertiary structure of a peptide is primarily comprised of beta-sheets and/or alpha-helix structures.
- designed or engineered peptides e.g., target-binding peptides, TfR-binding peptides, or selective depletion complexes
- designed or engineered peptides are small, compact peptides or polypeptides stabilized by intra-chain disulfide bonds (e.g., mediated by cysteines) and a hydrophobic core.
- engineered peptides have structures comprising helical bundles with at least one disulfide bridge between each of the alpha helices, thereby stabilizing the peptides.
- the engineered TfR-binding peptides comprise structures with three alpha helices and three intra-chain disulfide bonds, one between each of the three alpha helices in the bundle of alpha helices.
- peptides as described herein can have an overall molecular net charge, for example, of -5, -4, -3, -2, -1, 0, +1, +2, +3, +4, or +5. When the net charge is zero, the peptide can be uncharged or zwitterionic.
- a peptide contains one or more disulfide bonds and has a positive net charge at physiologic extracellular pH where the net charge can be +0.5 or less than +0.5, +1 or less than +1, +1.5 or less than +1.5, +2 or less than +2, +2.5 or less than +2.5, +3 or less than +3, +3.5 or less than +3.5, +4 or less than +4, +4.5 or less than +4.5, +5 or less than +5, +5.5 or less than +5.5, +6 or less than +6,
- a peptide has a negative net charge at physiologic extracellular pH where the net charge can be -0.5 or less than -0.5, -1 or less than -1, -1.5 or less than -1.5, -2 or less than -2, -2.5 or less than -2.5, -3 or less than -3, -3.5 or less than -3.5, -4 or less than -4, -4.5 or less than -4.5, -5 or less than -5, -5.5 or less than -5.5, -6 or less than -6, -6.5 or less than -6.5, -7 or less than -7, -7.5 or less than -7.5, -8 or less than -8, -8.5 or less than -8.5, -9 or less than -9.5, -10 or less than -10.
- peptides of the present disclosure can have an isoelectric point (pi) value from 3 and 10. In other embodiments, peptides of the present disclosure can have a pi value from 4.3 and 8.9. In some embodiments, peptides of the present disclosure can have a pi value from 3-4. In some embodiments, peptides of the present disclosure can have a pi value from 3-5. In some embodiments, peptides of the present disclosure can have a pi value from 3-6. In some embodiments, peptides of the present disclosure can have a pi value from 3-7. In some embodiments, peptides of the present disclosure can have a pi value from 3-8.
- pi isoelectric point
- peptides of the present disclosure can have a pi value from 3-9. In some embodiments, peptides of the present disclosure can have a pi value from 4-5. In some embodiments, peptides of the present disclosure can have a pi value from 4-6. In some embodiments, peptides of the present disclosure can have a pi value from 4-7. In some embodiments, peptides of the present disclosure can have a pi value from 4-8. In some embodiments, peptides of the present disclosure can have a pi value from 4-9. In some embodiments, peptides of the present disclosure can have a pi value from 4-10. In some embodiments, peptides of the present disclosure can have a pi value from 5-6.
- peptides of the present disclosure can have a pi value from 5-7. In some embodiments, peptides of the present disclosure can have a pi value from 5-8. In some embodiments, peptides of the present disclosure can have a pi value from 5-9. In some embodiments, peptides of the present disclosure can have a pi value from 5-10. In some embodiments, peptides of the present disclosure can have a pi value from 6-7. In some embodiments, peptides of the present disclosure can have a pi value from 6-8. In some embodiments, peptides of the present disclosure can have a pi value from 6-9. In some embodiments, peptides of the present disclosure can have a pi value from 6-10.
- peptides of the present disclosure can have a pi value from 7-8. In some embodiments, peptides of the present disclosure can have a pi value from 7-9. In some embodiments, peptides of the present disclosure can have a pi value from 7-10. In some embodiments, peptides of the present disclosure can have a pi value from 8-9. In some embodiments, peptides of the present disclosure can have a pi value from 8-10. In some embodiments, peptides of the present disclosure can have a pi value from 9-10.
- the engineering of one or more mutations within a peptide of the present disclosure yields a peptide with an altered isoelectric point, charge, surface charge, or rheology at physiologic extracellular pH.
- a mutation to a peptide that can be derived from a scorpion or spider complex can change the net charge of the peptide, for example, by decreasing the net charge by 1, 2, 3, 4, or 5, or by increasing the net charge by 1, 2, 3, 4, or 5.
- the engineered mutation can facilitate the ability of the peptide to bind a target protein, promote transcytosis, and penetrate a cell, an endosome, or the nucleus.
- Suitable amino acid modifications for improving the rheology and potency of a peptide can include conservative or non-conservative mutations.
- a peptide can comprise at most 1 amino acid mutation, at most 2 amino acid mutations, at most 3 amino acid mutations, at most 4 amino acid mutations, at most 5 amino acid mutations, at most 6 amino acid mutations, at most 7 amino acid mutations, at most 8 amino acid mutations, at most 9 amino acid mutations, at most 10 amino acid mutations, or another suitable number as compared to the sequence of the venom or toxin component that the peptide is derived from.
- a peptide, or a functional fragment thereof comprises at least 1 amino acid mutation, at least 2 amino acid mutations, at least 3 amino acid mutations, at least 4 amino acid mutations, at least 5 amino acid mutations, at least 6 amino acid mutations, at least 7 amino acid mutations, at least 8 amino acid mutations, at least 9 amino acid mutations, at least 10 amino acid mutations, or another suitable number as compared to the sequence of the venom or toxin component that the peptide is derived from.
- mutations can be engineered within a peptide to provide a peptide that has a desired charge or stability at physiologic extracellular pH.
- the nuclear magnetic resonance (NMR)solution structures, the X-ray crystal structures, as well as the primary structure sequence alignment of related structural peptide or protein homologs or in silico design can be used to generate mutational strategies that can improve the folding, stability, and/or manufacturability, while maintaining a particular biological function (e.g., TfR affinity /binding).
- a general strategy for producing homologs or in silico designed peptides or polypeptides can include identification of a charged surface patch or conserved residues of a protein, mutation of critical amino acid positions and loops, followed by in vitro and in vivo testing of the peptides.
- the overall peptide optimization process can be of iterative nature to the extent that, for example, information obtained during in vitro or in vivo testing is used for the design of the next generation of peptides.
- the herein disclosed methods can be used to design peptides with improved properties or to correct deleterious mutations that complicate folding and manufacturability.
- Key amino acid positions and loops can be retained while other residues in the peptide sequences can be mutated to improve, change, remove, or otherwise modify function, such as binding, transcytosis, or the ability to penetrate a cell, endosome, or nucleus in a cell, homing, or another activity of the peptide.
- these techniques can be used to predict the 3D pharmacophore of a group of structurally homologous scaffolds, as wells as to predict possible graft regions of related proteins to create chimeras with improved properties (e.g., binding properties). For example, this strategy is used to identify critical amino acid positions and loops that are used to design peptides with improved TfR receptor binding and transcytosis properties, high expression, high stability in vivo , or any combination of these properties.
- the present disclosure also encompasses multimers of the various peptides described herein.
- multimers include dimers, trimers, tetramers, pentamers, hexamers, heptamers, and so on.
- a multimer can be a homomer formed from a plurality of identical subunits or a heteromer formed from a plurality of different subunits.
- a peptide of the present disclosure is arranged in a multimeric structure with at least one other peptide, or two, three, four, five, six, seven, eight, nine, ten, or more other peptides.
- the peptides of a multimeric structure each have the same sequence.
- one or more or all of the peptides of a multimeric structure have different sequences.
- the present disclosure provides peptide scaffolds that can be used as a starting point for generating additional, next-generation peptides with more specific or improved properties.
- these scaffolds are derived from a variety of CDPs or knotted peptides.
- Suitable peptides for scaffolds can include, but are not limited to, chlorotoxin, brazzein, circulin, stecrisp, hanatoxin, midkine, hefutoxin, potato carboxypeptidase dicd]dojm, ]p]]g ⁇ kmjo ⁇ di, ⁇ oom ⁇ odi, ⁇ -GI, ⁇ -GID, ⁇ -NGGG?, ⁇ -KTGG?, ⁇ -CVID, ⁇ -MrIA, ⁇ -TIA, conantokin G, conantokin G, conantokin G, conantokin G, conantokin G, conantokin G, conantokin G, conantokin G, conantokin G, GsMTx4, margatoxin, shK, toxin K, chymotrypsin inhibitor (CTI), and EGF epiregulin core.
- CTI chymotrypsin inhibitor
- the peptide sequence is flanked by additional amino acids.
- One or more additional amino acids can confer a desired in vivo charge, isoelectric point, chemical conjugation site, stability, or physiologic property to a peptide.
- Pharmacokinetics of Peptides [0326] The pharmacokinetics of any of the peptides of the present disclosure can be determined after administration of the peptide via different routes of administration.
- the pharmacokinetic parameters of a peptide of this disclosure can be quantified after intravenous, subcutaneous, intramuscular, rectal, aerosol, parenteral, ophthalmic, pulmonary, transdermal, vaginal, optic, nasal, oral, sublingual, inhalation, dermal, intrathecal, intranasal, peritoneal, buccal, synovial, intratumoral, or topical administration.
- Peptides of the present disclosure can be analyzed by using tracking agents such as radiolabels or fluorophores.
- radiolabeled peptides of this disclosure can be administered via various routes of administration.
- Peptide concentration or dose recovery in various biological samples such as plasma, urine, feces, any organ, skin, muscle, and other tissues can be determined using a range of methods including HPLC, fluorescence detection techniques (TECAN quantification, flow cytometry, iVIS), or liquid scintillation counting.
- HPLC high-density liquid crystal display
- fluorescence detection techniques TECAN quantification, flow cytometry, iVIS
- liquid scintillation counting a range of methods including HPLC, fluorescence detection techniques (TECAN quantification, flow cytometry, iVIS), or liquid scintillation counting.
- the methods and compositions described herein relate to pharmacokinetics of peptide administration via any route to a subject. Pharmacokinetics can be described using methods and models, for example, compartmental models or non-compartmental methods. Compartmental models include but are not limited to monocompartmental model, the two compartmental model, the multicompartmental model or the like.
- Models are often divided into different compartments and can be described by the corresponding scheme
- one scheme is the absorption, distribution, metabolism and excretion (ADME) scheme.
- another scheme is the liberation, absorption, distribution, metabolism and excretion (LADME) scheme.
- metabolism and excretion can be grouped into one compartment referred to as the elimination compartment.
- liberation includes liberation of the active portion of the composition from the delivery system
- absorption includes absorption of the active portion of the composition by the subject
- distribution includes distribution of the composition through the blood plasma and to different tissues
- metabolism which includes metabolism or inactivation of the composition
- excretion which includes excretion or elimination of the composition or the products of metabolism of the composition.
- compositions administered intravenously to a subject can be subject to multiphasic pharmacokinetic profiles, which can include but are not limited to aspects of tissue distribution and metabolism/excretion. As such, the decrease in plasma or serum concentration of the composition is often biphasic, including, for example an alpha phase and a beta phase, occasionally a gamma, delta or other phase is observed.
- Pharmacokinetics includes determining at least one parameter associated with administration of a peptide to a subject.
- parameters include at least the dose (D), dosing dio ⁇ mq ⁇ g ( ⁇ ), ⁇ m ⁇ pi_ ⁇ m ⁇ pmq ⁇ (?SA), h ⁇ sdhph ⁇ ji ⁇ iom ⁇ odji (A max ), minimum concentration reached before a subsequent dose is administered (Cmin), minimum time (Tmin), maximum time to reach Cmax (Tmax), volume of distribution (Vd), steady-state volume of distribution (V ss ), back-extrapolated concentration at time 0 (C 0 ), steady state concentration (Css), elimination rate constant (ke), infusion rate (kin), clearance (CL), bioavailability (f), fluctuation (%PTF) and elimination half-life (t1/2).
- the peptides or peptide complexes of any of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64 exhibit optimal pharmacokinetic parameters after oral administration.
- the peptides or peptide complexes of any of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64 exhibit optimal pharmacokinetic parameters after any route of administration, such as oral administration, inhalation, intranasal administration, topical administration, intravenous administration, subcutaneous administration, intra-articular administration, intramuscular administration, intraperitoneal administration, intra-synovial, or any combination thereof.
- any peptide or peptide complex of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64 exhibits an average T max of 0.5 ⁇ 12 hours, or 1-48 hours at which the C max is reached, an average bioavailability in serum of 0.1% - 10% in the subject after administering the peptide to the subject by an oral route, an average bioavailability in serum of less than 0.1% after oral administration to a subject for delivery to the GI tract, an average bioavailability in serum of 10-100% after parenteral administration, an average t 1 ⁇ 2 of 0.1 hours ⁇ 168 hours, or 0.25 hours ⁇ 48 hours in a subject after administering the peptide to the subject, an average clearance (CL) of 0.5-100 L/hour or 0.5 ⁇ 50 L
- a peptide of the present disclosure can be stable in various biological or physiological conditions, such as physiologic extracellular pH, endosomal or lysosomal pH, or reducing environments inside a cell, in the cytosol, in a cell nucleus, or endosome or a tumor.
- any peptide or peptide complex comprising any of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64 can exhibit resistance to reducing agents, proteases, oxidative conditions, or acidic conditions.
- biologic molecules can provide therapeutic functions, but such therapeutic functions are decreased or impeded by instability caused by the in vivo environment.
- biologic molecules such as peptides and proteins
- the GI tract can contain a region of low pH (e.g.
- protease-rich environment that can degrade peptides and proteins.
- Proteolytic activity in other areas of the body such as the mouth, eye, lung, intranasal cavity, joint, skin, vaginal tract, mucous membranes, and serum, can also be an obstacle to the delivery of functionally active peptides and polypeptides.
- the half-life of peptides in serum can be very short, in part due to proteases, such that the peptide can be degraded too quickly to have a lasting therapeutic effect when administering reasonable dosing regimens.
- proteolytic activity in cellular compartments such as lysosomes and reduction activity in lysosomes and the cytosol can degrade peptides and proteins such that they can be unable to provide a therapeutic function on intracellular targets. Therefore, peptides that are resistant to reducing agents, proteases, and low pH can be able to provide enhanced therapeutic effects or enhance the therapeutic efficacy of co-formulated or conjugated, linked, or fused active agents in vivo.
- Methods of Manufacture [0333] Various expression vector/host systems can be utilized for the recombinant expression of peptides described herein.
- Non-limiting examples of such systems include microorganisms such as bacteria transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing a nucleic acid sequence encoding peptides, peptide complexes, or peptide fusion proteins/chimeric proteins described herein, yeast transformed with recombinant yeast expression vectors containing the aforementioned nucleic acid sequence, insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing the aforementioned nucleic acid sequence, plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus (CaMV), tobacco mosaic virus (TMV)), or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing the aforementioned nucleic acid sequence, or animal cell systems infected with recombinant virus expression vectors (e.g., adenovirus, vac
- a host cell can be adapted to express one or more peptides described herein.
- the host cells can be prokaryotic, eukaryotic, or insect cells.
- host cells are capable of modulating the expression of the inserted sequences or modifying and processing the gene or protein product in the specific fashion desired. For example, expression from certain promoters can be elevated in the presence of certain inducers (e.g., zinc and cadmium ions for metallothionine promoters).
- modifications e.g., phosphorylation
- processing e.g., cleavage
- Host cells can have characteristic and specific mechanisms for the post-translational processing and modification of a peptide.
- the host cells used to express the peptides secrete minimal amounts of proteolytic enzymes.
- the selective depletion complexes of this disclosure can be advantageously made by a single recombinant expression system, with no need for chemical synthesis or modifications.
- a selective depletion complex can be expressed in CHO cells, yeast, pichia, E. coli , or other organisms.
- organisms can be treated prior to purification to preserve and/or release a target polypeptide.
- the cells are fixed using a fixing agent.
- the cells are lysed.
- the cellular material can be treated in a manner that does not disrupt a significant proportion of cells, but which removes proteins from the surface of the cellular material, and/or from the interstices between cells.
- cellular material can be soaked in a liquid buffer, or, in the case of plant material, can be subjected to a vacuum, in order to remove proteins located in the intercellular spaces and/or in the plant cell wall.
- proteins can be extracted from the microorganism culture medium.
- the peptides can be packed in inclusion bodies. The inclusion bodies can further be separated from the cellular components in the medium. In some embodiments, the cells are not disrupted.
- a cellular or viral peptide that is presented by a cell or virus can be used for the attachment and/or purification of intact cells or viral particles.
- peptides can also be synthesized in a cell-free system prior to extraction using a variety of known techniques employed in protein and peptide synthesis.
- a host cell produces a peptide that has an attachment point for a cargo molecule (e.g., a therapeutic agent).
- An attachment point could comprise a lysine residue, an N- terminus, a cysteine residue, a cysteine disulfide bond, a glutamic acid or aspartic acid residue, a C-terminus, or a non-natural amino acid.
- the peptide could also be produced synthetically, such as by solid-phase peptide synthesis, or solution-phase peptide synthesis. Peptide synthesis can be performed by fluorenylmethyloxycarbonyl (Fmoc) chemistry or by butyloxycarbonyl (Boc) chemistry.
- the peptide could be folded (formation of disulfide bonds) during synthesis or after synthesis or both.
- Peptide fragments could be produced synthetically or recombinantly. Peptide fragments can be then be joined together enzymatically or synthetically.
- the peptides of the present disclosure can be prepared by conventional solid phase chemical synthesis techniques, for example according to the Fmoc solid phase peptide synthesis method (“Fmoc solid phase peptide synthesis, a practical approach,” edited by
- the peptides of this disclosure can be more stable during manufacturing.
- peptides of this disclosure can be more stable during recombinant expression and purification, resulting in lower rates of degradation by proteases that are present in the manufacturing process, a higher purity of peptide, a higher yield of peptide, or any combination thereof.
- the peptides can also be more stable to degradation at high temperatures and low temperatures during manufacturing, storage, and distribution.
- peptides of this disclosure can be stable at 25 °C.
- peptides of this disclosure can be stable at 70 °C or higher than 70 °C.
- peptides of this disclosure can be stable at 100 °C or higher than 100 °C.
- a pharmaceutical composition of the disclosure can be a combination of any peptide as described herein with other chemical components, such as carriers, stabilizers, diluents, dispersing agents, suspending agents, thickening agents, antioxidants, solubilizers, buffers, osmolytes, salts, surfactants, amino acids, encapsulating agents, bulking agents, cryoprotectants, and/or excipients.
- the pharmaceutical composition facilitates administration of a peptide described herein to an organism.
- compositions can be administered in therapeutically-effective amounts as pharmaceutical compositions by various forms and routes including, for example, intravenous, subcutaneous, intramuscular, rectal, aerosol, parenteral, ophthalmic, pulmonary, transdermal, vaginal, optic, nasal, oral, sublingual, inhalation, dermal, intrathecal, intratumoral, intranasal, and topical administration.
- a pharmaceutical composition can be administered in a local or systemic manner, for example, via injection of the peptide described herein directly into an organ, optionally in a depot.
- Parenteral injections can be formulated for bolus injection, infusion, or continuous infusion.
- the pharmaceutical compositions can be in a form suitable for parenteral injection as a sterile suspension, solution or emulsion in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- Pharmaceutical formulations for parenteral administration include aqueous solutions of a peptide described herein in water soluble form Suspensions of peptide antibody complexes described herein can be prepared as oily injection suspensions.
- Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes.
- Aqueous injection suspensions can contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran.
- the suspension can also contain suitable stabilizers or agents which increase the solubility and/or reduce the aggregation of such peptide-antibody complexes described herein to allow for the preparation of highly concentrated solutions.
- the peptide described herein can be lyophilized or in powder form for re- constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
- a purified peptide is administered intravenously.
- a peptide described herein can be administered to a subject in order to home, target, migrate to, or be directed to a CNS cell, a brain cell, a cancerous cell, or a tumor.
- a peptide can be conjugated to, linked to, or fused to another peptide that provides a targeting function to a specific target cell type in the central nervous system or across the blood brain barrier.
- Exemplary target cells include a CNS cell, erythrocyte, an erythrocyte precursor cell, an immune cell, a stem cell, a muscle cell, a brain cell, a thyroid cell, a parathyroid cell, an adrenal gland cell, a bone marrow cell, an appendix cell, a lymph node cell, a tonsil cell, a spleen cell, a muscle cell, a liver cell, a gallbladder cell, a pancreas cell, a cell of the gastrointestinal tract, a glandular cell, a kidney cell, a urinary bladder cell, an endothelial cell, an epithelial cell, a choroid plexus epithelial cell, a neuron, a glial cell, an astrocyte, or a cell associated with a nervous system.
- a CNS cell erythrocyte, an erythrocyte precursor cell, an immune cell, a stem cell, a muscle cell, a brain cell, a thyroid cell,
- a peptide of the disclosure can be applied directly to an organ, or an organ tissue or cells, such as brain or brain tissue or cells, during a surgical procedure.
- the recombinant peptide described herein can be administered topically and can be formulated into a variety of topically administrable compositions, such as solutions, suspensions, lotions, gels, pastes, medicated sticks, balms, creams, and ointments.
- Such pharmaceutical compositions can contain solubilizers, stabilizers, tonicity enhancing agents, buffers, and preservatives.
- therapeutically effective amounts of a peptide described herein can be administered in pharmaceutical compositions to a subject suffering from a condition that affects the immune system.
- the subject is a mammal such as a human or a primate.
- a therapeutically effective amount can vary widely depending on the severity of the disease, the age and relative health of the subject, the potency of the compounds used, and other factors.
- a peptide is cloned into a viral or non-viral expression vector.
- Such expression vector can be packaged in a viral particle, a virion, or a non-viral carrier or delivery mechanism, which is administered to patients in the form of gene therapy.
- patient cells are extracted and modified to express a peptide capable of binding TfR ex vivo before the modified cells are returned back to the patient in the form of a cell-based therapy, such that the modified cells will express the peptide once transplanted back in the patient.
- compositions can be formulated using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active compounds into preparations that can be used pharmaceutically. Formulation can be modified depending upon the route of administration chosen.
- Pharmaceutical compositions comprising a peptide described herein can be manufactured, for example, by expressing the peptide in a recombinant system, purifying the peptide, lyophilizing the peptide, mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping, or compression processes.
- the pharmaceutical compositions can include at least one pharmaceutically acceptable carrier, diluent, or excipient and compounds described herein as free-base or pharmaceutically acceptable salt form.
- Methods for the preparation of peptide described herein comprising the compounds described herein include formulating peptide described herein with one or more inert, pharmaceutically acceptable excipients or carriers to form a solid, semi-solid, or liquid composition.
- Solid compositions include, for example, powders, tablets, dispersible granules, capsules, cachets, and suppositories. These compositions can also contain minor amounts of nontoxic, auxiliary substances, such as wetting or emulsifying agents, pH buffering agents, and other pharmaceutically acceptable additives.
- Non-limiting examples of pharmaceutically-acceptable excipients can be found, for example, in Remington: The Science and Practice of Pharmacy, Nineteenth Ed (Easton, Pa.: Mack Publishing Company, 1995); Hoover, John E., Remington ’s Pharmaceutical Sciences, Mack Publishing Co., Easton, Pennsylvania 1975; Liberman, H.A. and Lachman, L., Eds., Pharmaceutical Dosage Forms, Marcel Decker, New York, N.Y., 1980; and Pharmaceutical Dosage Forms and Drug Delivery Systems, Seventh Ed. (Lippincott Williams & Wilkins 1999), each of which is incorporated by reference in its entirety.
- compositions can also include permeation or absorption enhancers
- Permeation enhancers can facilitate uptake of molecules from the GI tract into systemic circulation.
- Permeation enhancers can include salts of medium chain fatty acids, sodium caprate, sodium caprylate, N-(8-[2-hydroxybenzoyl]amino)caprylic acid (SNAC), N-(5- chlorosalicyloyl)-8-aminocaprylic acid (5-CNAC), hydrophilic aromatic alcohols such as phenoxyethanol, benzyl alcohol, and phenyl alcohol, chitosan, alkyl glycosides, dodecyl-2-N,N- dimethylamino propionate (DDAIPP), chelators of divalent cations including EDTA, EGTA, and citric acid, sodium alkyl sulfate, sodium salicylate, lecithin-based, or bile salt-derived agents such as deoxycholates.
- SNAC N-(8-[2-hydroxybenzoyl]amino)caprylic acid
- 5-CNAC N-(5- chlorosalicyloyl)-8-amin
- compositions can also include protease inhibitors including soybean trypsin inhibitor, aprotinin, sodium glycocholate, camostat mesilate, vacitracin, or cyclopentadecalactone.
- protease inhibitors including soybean trypsin inhibitor, aprotinin, sodium glycocholate, camostat mesilate, vacitracin, or cyclopentadecalactone.
- a method of treating a subject using the selective depletion complexes of the present disclosure includes administering an effective amount of a peptide as described herein to a subject in need thereof.
- a method of treating a subject using the selective depletion complexes of the present disclosure includes modifying a cell of a subject to express and secrete a selective depletion complex of the present disclosure.
- the cell is a cell in the subject. In some embodiments, the cell is a cell that has been removed from the subject and is re-introduced following modification. In some embodiments, the cell is modified using a viral vector (e.g., an oncolytic herpes simplex virus). In some embodiments, a gene encoding expression and secretion of a selective depletion complex is engineered into a CAR-T cell or other cellular therapy. [0354] TfR can be expressed in various tissues such as the brain, the stomach, the liver, of the gall bladder.
- the peptides of the present disclosure can be used in the diagnosis and treatment of disease and conditions associated with various tissues and organs.
- drug delivery to these tissues and organs can be improved by using the herein described peptides and peptide complexes carrying a diagnostic and/or therapeutic payload.
- Rc ⁇ o ⁇ mh ⁇ aa ⁇ odq ⁇ ⁇ hjpio, ⁇ ⁇ n pn ⁇ _ c ⁇ m ⁇ di, m ⁇ a ⁇ mn oj ⁇ npaad ⁇ d ⁇ io ⁇ hjpio ja ⁇ i ⁇ b ⁇ io jm a compound being administered which will relieve to some extent one or more of the symptoms of the disease or condition being treated.
- the result can be reduction and/or alleviation of the signs symptoms or causes of a disease or any other desired alteration of a biological system.
- compositions containing such agents or compounds can be administered for prophylactic, ⁇ ic ⁇ i ⁇ dib, ⁇ i_/jm oc ⁇ m ⁇ k ⁇ pod ⁇ om ⁇ oh ⁇ ion. ?i ⁇ kkmjkmd ⁇ o ⁇ ⁇ aa ⁇ odq ⁇ ⁇ hjpio di ⁇ it di_dqd_p ⁇ g case can be determined using techniques, such as a dose escalation study. [0356]
- the methods, compositions, and kits of this disclosure can comprise a method to prevent, treat, arrest, reverse, or ameliorate the symptoms of a condition.
- the treatment can comprise treating a subject (e.g., an individual, a domestic animal, a wild animal, or a lab animal afflicted with a disease or condition) with a peptide of the disclosure.
- the disease can be a cancer or tumor.
- the peptide can contact the tumor or cancerous cells.
- the subject can be a human.
- Subjects can be humans; non-human primates such as chimpanzees, and other apes and monkey species; farm animals such as cattle, horses, sheep, goats, swine; domestic animals such as rabbits, dogs, and cats; laboratory animals including rodents, such as rats, mice and guinea pigs, and the like.
- a subject can be of any age.
- Subjects can be, for example, elderly adults, adults, adolescents, pre-adolescents, children, toddlers, infants, and fetuses in utero.
- Treatment can be provided to the subject before clinical onset of disease.
- Treatment can be provided to the subject after clinical onset of disease.
- Treatment can be provided to the subject after 1 day, 1 week, 6 months, 12 months, or 2 years or more after clinical onset of the disease.
- Treatment can be provided to the subject for more than 1 day, 1 week, 1 month, 6 months, 12 months, 2 years or more after clinical onset of disease.
- Treatment can be provided to the subject for less than 1 day, 1 week, 1 month, 6 months, 12 months, or 2 years after clinical onset of the disease.
- Treatment can also include treating a human in a clinical trial.
- a treatment can comprise administering to a subject a pharmaceutical composition, such as one or more of the pharmaceutical compositions described throughout the disclosure.
- a treatment can comprise a once daily dosing.
- a treatment can comprise delivering a peptide of the disclosure to a subject, either intravenously, subcutaneously, intramuscularly, by inhalation, dermally, topically, by intra-articular injection, orally, sublingually, intrathecally, transdermally, intranasally, via a peritoneal route, directly into a tumor e.g., injection directly into a tumor, directly into the brain, e.g., via and intracerebral ventricle route, or directly onto a joint, e.g.
- a treatment can comprise administering a peptide-active agent complex to a subject, either intravenously, subcutaneously, intramuscularly, by inhalation, by intra-articular injection, dermally, topically, orally, intrathecally, transdermally, intransally, parenterally, orally, via a peritoneal route, nasally, sublingually, or directly onto cancerous tissues.
- a peptide-active agent complex administered to a subject, either intravenously, subcutaneously, intramuscularly, by inhalation, by intra-articular injection, dermally, topically, orally, intrathecally, transdermally, intransally, parenterally, orally, via a peritoneal route, nasally, sublingually, or directly onto cancerous tissues.
- peptides described herein can be provided as a kit.
- peptide complexes described herein can be provided as a kit.
- a kit comprises amino acids encoding a peptide described herein, a vector, a host organism, and an instruction manual.
- a kit includes written instructions on the use or administration of the peptides.
- This example describes the manufacture of the peptides and peptide complexes described herein (e g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64).
- Peptides derived from proteins were generated in mammalian cell culture using a published methodology. (A.D. Bannesayke, C. Correnti, B.Y. Ryu, M. Brault, R.K. Strong, D. Rawlings. 2011. Daedalus: a robust, turnkey platform for rapid production of decigram quantities of active recombinant proteins in human cell lines using novel lentiviral vectors. Nucleic Acids Research. (39)21, el43).
- the peptide sequence was reverse-translated into DNA, synthesized, and cloned in-frame with siderocalin using standard molecular biology techniques (M.R. Green, Joseph Sambrook. Molecular Cloning. 2012 Cold Spring Harbor Press).
- the resulting complex was packaged into a lentivirus, transduced into HEK-293 cells, expanded, isolated by immobilized metal affinity chromatography (IMAC), cleaved with tobacco etch virus (TEV) protease, and purified to homogeneity by reverse-phase chromatography. Following purification, each peptide was lyophilized and stored frozen.
- IMAC immobilized metal affinity chromatography
- TSV tobacco etch virus
- Peptides e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64
- RP- HPLC reversed-phase HPLC
- transferrin receptor (TfR) ectodomain (“soluble TfR”, SEQ ID NO: 188, was cloned into the Daedalus soluble protein production lentivector, and protein was purified from the growth media (a gel of soluble TfR is shown in FIG. 1A). The same strategy was used to produce and purify human apo-transferrin (residues 23-698, SEQ ID NO: 189,
- MaCV was cloned into a mammalian surface display vector SDGF (FIG.9B), and transfected suspension 293 Freestyle (293F) cells with SDGF-MaCV or a control protein (SDGF-Elafin, an inhibitor of elastase known to bind some native CDPs).
- SDGF-Elafin an inhibitor of elastase known to bind some native CDPs.
- Transfected cells were stained with 200 nM each biotinylated TfR (all TfR used in cell binding assays is biotinylated) and Alexa Fluor 647-labeled streptavidin, and then analyzed by flow cytometry (FIG.9C). Cells transfected with MaCV were successfully stained with TfR, while SDGF-Elafin cells were not.
- EXAMPLE 3 Mammalian Surface Display of TfR-binding Peptides
- This example describes mammalian surface display of TfR-binding peptides of the present disclosure including SEQ ID NO: 1 (SEQ ID NO: 65 with an added N- terminal GS), SEQ ID NO: 2 (SEQ ID NO: 2 is SEQ ID NO: 66 with an added N-terminal GS), SEQ ID NO: 30 (SEQ ID NO: 30 is SEQ ID NO: 94 with an added N-terminal GS), and SEQ ID NO: 32 (SEQ ID NO: 32 is SEQ ID NO: 96 with an added N-terminal GS).
- TfR- binding peptides were performed by transfecting or transducing mammalian cells to display candidate peptides (FIG 9B) followed by screening against soluble human transferrin receptor ectodomain (200 nM, FIG. 9C, FIG. IB - FIG. 1G).
- Mammalian cells had improved fidelity in folding disulfide crosslinked proteins, making them a suitable cell type for display of the peptides of the present disclosure.
- FasL-TM is the transmembrane domain of the FasL protein. More specifically, the designed peptides were cloned as a pool into SDGF, which were then made into lentivirus. 293F cells were transduced with this library at a multiplicity of infection of ⁇ 1, and after three days of growth, the pool of transduced cells was incubated with Alexa647-labeled TfR. For these experiments, fluorescent labeling was accomplished by co-staining TfR with fluorescent streptavidin or fluorescent anti- His antibodies.
- SDGF surface display GFP FasL
- Soluble TfR contained both His tag and biotin label. Either Alexa Fluor 647 or iFluor 647 was used for the antibody/ streptavidin fluorescence. A percentage of the highest- staining TfR-positive cells, from GFP and TfR double-positive cells, were sorted and expanded. At every expansion, a portion of the cells were collected, and at the end, the enriched peptides were identified by sequencing. Flow cytometry was used to assess gating criteria to identify GFP+ 293F cells expressing proteins on their surface via the SDGF peptide construct.
- Gating progresses using FSC-H vs SSC-H to gate out debris; FSC-H vs FSC-A to gate out doublets; FSC-H vs Pacific Blue H to gate out DAPI+ dead cells; and an optional FITC-H histogram to identify GFP+ cells.
- Alexa Fluor 647 a co-stain for detecting target binding was used for sorting and analysis.
- Magnetic sorting was performed as follows: 2xl0 8 293F cells were transduced with the SDGF CDP library at an MOI of ⁇ 1 and expanded until 3 days post-transduction. For initial screening, magnetic cell sorting was performed. lxlO 9 transduced cells were resuspended in a binding buffer containing 200 nM biotinylated TfR, 2 mL anti-biotin MicroBeads (UltraPure, Miltenyi 130-105-637), and 21 mL Flow Buffer (PBS + 2 mM EDTA and 0.5% bovine serum albumin) in a final volume of 25 mL. Cells were incubated on ice with agitation (mild inversion every 2-5 min) for 30 mins, and were then diluted 10-fold to 250 mL with Flow Buffer, pelleted (500 x g,
- Eluted cells were pooled, pelleted, and their CDP sequences PCR amplified (TerraTM PCR Direct Polymerase Mix (Takara 639271) for 16 cycles followed by Phusion).
- This sub-library was cloned into SDGF as above, made into lentivirus, and transduced into a new batch of 293F cells (lxlO 7 cells, MOI ⁇ 1) for flow sorting.
- Flow sorting was performed as follows: Flow sorting took place using 2.4xl0 7 cells stained in 3 mL Flow Buffer with 200 nM TfR, 200 nM streptavidin Alexa Fluor 647 conjugate (ThermoFisher S21374), and 1 ⁇ g mL -1 DAPF Cells were diluted 4-fold to 12 mL with Flow Buffer, pelleted (500 x g, 5 mins), and resuspended in 3.6 mL Flow Buffer.
- Cells were sorted on a FACSAria II System (BD), gating based on FSC-A (medium), SSC-A (medium), DAPI-A (negative), GFP-A (positive), and APC-A (top 7% of GFP+) channels.
- BD FACSAria II System
- FSC-A medium
- SSC-A medium
- DAPI-A negative
- GFP-A positive
- APC-A top 7% of GFP+ channels.
- cells were cultured in FreeStyle Media starting at 0.5-1 mL in a suspension 24-well plate, shaking at 300 rpm, expanding to a final volume of 30 mL in a 125 mL baffled flask shaken at 125 RPM. At this point, cells were re-sorted as above.
- the third flow sort cells were expanded and frozen in 1.5xl0 6 cell pellets.
- enriched variants were studied to assemble a compound mutant (peptide of SEQ ID NO: 2 or SEQ ID NO: 32) that showed higher TfR staining than any of the variants containing either 1 or 2 of the individual mutations.
- FIG. IB - FIG. 1G illustrate successive enrichment of cells that bind to TfR from pooled, high diversity library.
- FIG. 1A illustrates a Coomassie stained gel of transferrin receptor (TfR) protein showing successful purification of TfR.
- FIG. IB illustrates a flow cytometry plot of cells displaying candidate TfR-binding peptides after one flow sort. Cells were sorted based on ability to bind to TfR labeled with a fluorescent streptavidin.
- TfR transferrin receptor
- Data points in the upper right region represent cells expressing a candidate peptide, quantified by GFP fluorescence, that bind TfR, quantified by fluorescence of the fluorescent TfR-streptavidin.
- FIG. 1C illustrates a negative control flow cytometry plot of cells displaying candidate TfR-binding peptides after one flow sort. Cells were sorted based on ability to bind to a control protein labeled with a fluorescent streptavidin.
- Data points in the upper right region represent cells expressing a candidate peptide, quantified by GFP fluorescence, that bind to the negative control protein, quantified by fluorescence of the fluorescent control protein-streptavidin.
- FIG.1D illustrates a flow cytometry plot of cells displaying candidate TfR-binding peptides after a second flow sort, following the first cell sort illustrated in FIG.1B.
- Cells were sorted based on ability to bind to TfR labeled with a fluorescent streptavidin. Data points in the upper right region represent cells expressing a candidate peptide, quantified by GFP fluorescence, that bind TfR, quantified by fluorescence of the fluorescent TfR-streptavidin.
- FIG.1E illustrates a negative control flow cytometry plot of cells displaying candidate TfR-binding peptides after a second flow sort, following the first cell sort illustrated in FIG.1C.
- FIG.1F illustrates a flow cytometry plot of cells displaying candidate TfR-binding peptides after a third flow sort, following the second cell sort illustrated in FIG.1D. Cells were sorted based on ability to bind to TfR labeled with a fluorescent streptavidin.
- FIG.1G illustrates a negative control flow cytometry plot of cells displaying candidate TfR- binding peptides after a third flow sort, following the second cell sort illustrated in FIG.1E. Cells were sorted based on ability to bind to a control protein labeled with a fluorescent streptavidin.
- Data points in the upper right region represent cells expressing a candidate peptide, quantified by GFP fluorescence, that bind to the negative control protein, quantified by fluorescence of the fluorescent control protein-streptavidin.
- the box indicates cells expressing peptides that bind to the negative control protein.
- EXAMPLE 4 Identification of TfR-binding Peptides [0372] This example describes identification of TfR-binding peptides using a mammalian surface display system as described in EXAMPLE 3 [0373] Using the mammalian surface display system of EXAMPLE 3, a single clonal peptide was identified having a sequence of SEQ ID NO: 1 (SEQ ID NO: 1 is SEQ ID NO: 65 with an added N-terminal GS). A library of oligonucleotides encoding 10,000 CDPs was amplified and mutagenized. The CDPs were 17-50 amino acids in length, with 4, 6, 8, or 10 cysteines.
- the library contained CDPs from every domain / kingdom of life.
- This library was cloned into SDGF, made into lentivirus, and transduced into suspension 293F cells. The transduced cells were subjected to staining with TfR (200 nM) and co-stain over the course of one round of magnetic cell sorting and three rounds of flow sorting, each round enriching for cells stained with TfR. Binding was validated to specifically bind TfR in the surface display assay using 200 nM of soluble AF647- TfR, which was either biotinylated or attached to a His tag.
- TfR-binding CDP A single TfR-binding CDP, designated SEQ ID NO: 1, was identified by DNA sequencing of the final enriched cell population. It represents a randomly mutated variant of cytochrome BC1 complex subunit 6 from the marine choanoflagellate Monosiga brevicolis (Uniprot ID: A9V0D7, DOI: 10.1093/nar/gku989), is 49 amino acids in length (six cysteines) and has a predicted molecular mass of 5.6 kDa.
- SSM site saturation mutagenesis
- FIG.2D illustrate flow cytometry of cells displaying the single clonal TfR-binding peptide and screened for binding to either TfR or a negative control protein. Flow cytometry of the single TfR-binding peptide was performed to verify that the identified TfR-binding peptide bound specifically TfR and not to the streptavidin label.
- the control protein used in this experiment has an amino acid sequence set forth in SEQ ID NO: 186 ) illustrates a negative control flow cytometry plot of cells expressing a TfR-binding peptide of SEQ ID NO: 1 (x-axis, GFP) screened for binding to a negative control protein labeled (y-axis, stained with a fluorescent anti-His antibody).
- FIG.2B illustrates a flow cytometry plot of cells expressing a peptide of SEQ ID NO: 1 (x-axis, GFP) and TfR (y-axis, stained with a fluorescent anti-His antibody).
- FIG.2C illustrates a negative control flow cytometry plot of cells expressing a TfR-binding peptide of SEQ ID NO: 1 (x-axis, GFP) screened for binding to a negative control protein labeled (y-axis, stained with a fluorescent streptavidin).
- FIG.2D illustrates a flow cytometry plot of cells expressing a TfR-binding peptide of SEQ ID NO: 1 (x-axis, GFP) screened for binding to TfR (y-axis, stained with a fluorescent streptavidin). [0375] TfR staining was observed with cells expressing the identified clone, with no staining seen with a control protein.
- This library was screened with a modified staining protocol, using a lower concentration of target and co-stain (20 nM) and separate staining steps; the latter further increases stringency by eliminating the tetravalent avidity granted by streptavidin. Up to four rounds of flow sorting and enrichment were used to identify variants with improved TfR binding characteristics. Permutation of enriched variants identified an optimal mutant (SEQ ID NO: 2 (SEQ ID NO: 2 is SEQ ID NO: 66 with an added N-terminal GS)), and this process was repeated again (8 nM TfR and co-stain; otherwise, identical protocol) to generate SEQ ID NO: 32 (SEQ ID NO: 32 is SEQ ID NO: 96 with an added N-terminal GS).
- This twice-matured variant contains 14 point mutations from the original library member ( Q Q, Q NO: 191).
- Four point mutations from the parent sequence are found in SEQ ID NO: 1, while SEQ ID NO: 2 and SEQ ID NO: 32 contain 6 and 4 mutations, respectively, from the previous generation.
- SEQ ID NO: 1 and its variants were produced as soluble peptides and validated by reversed-phase HPLC (RP-HPLC), SDS-PAGE, and mass spectrometry. Based on their masses of ⁇ 5-6 kDa, their slower-than-expected mobility in SDS- PAGE was a demonstration of the interesting electrophoretic mobility characteristics that some CDPs possess. All variants showed markedly different mobility upon DTT reduction (10 mM) in both SDS-PAGE and RP-HPLC, confirming disulfide bond stabilization. Their binding to TfR was verified by surface plasmon resonance (FIG.
- the intact, non-reduced peptide of SEQ ID NO: 32 protein demonstrates substantially improved heat tolerance to that of the DTT-reduced protein, with no substantial change in circular dichroism characteristics until well above common ambient temperatures (>50°C) and a failure to observe complete unfolding up to 95°C.
- SSM site saturation mutagenesis
- FIG. 3A and FIG. 3B show the TfR-binding capabilities of TfR-binding peptide variants identified during peptide maturation.
- SSM was employed for affinity maturation of the peptide having a sequence of SEQ ID NO: 1 as identified in the first mammalian surface display experiments (see e.g., FIG. IB - FIG. 1G and FIG. 2A - FIG. 2D).
- a library of every possible non-cysteine point variants was constructed and screened against TfR at higher stringency than first screen. Variants with improved binding were enriched and identified by Sanger sequencing.
- Such enriched variant mutations were combined with one another in various permutations (shown in the data) to identify a composite, improved binder.
- Two rounds of SSM were completed, yielding matured peptides comprising SEQ ID NO: 2, and SEQ ID NO: 32, respectively (SEQ ID NO: 32 is SEQ ID NO: 96 with an added N-terminal GS).
- TfR concentration in the first round of SSM was 20 nM and SSM was carried out using one-step staining.
- TfR concentration in the second round of SSM was 8 nM and SSM was carried out using two-step staining.
- TfR-binding of mammalian cells expressing peptides of the SSM library was performed as described in EXAMPLE 3 and EXAMPLE 4, but with a higher stringency protocol.
- the higher stringency protocol included a lower concentration of TfR (e.g., 20 nM).
- FIG.3A illustrates the results of a first site-saturation mutagenesis screen in SEQ ID NO: 1 (SEQ ID NO: 1 is SEQ ID NO: 65 with an added N-terminal GS), with some variants exhibiting improved binding activity to TfR such as peptides having a sequence of SEQ ID NO: 4, SEQ ID NO: 5, and SEQ ID NO: 8 (SEQ ID NO: 4, SEQ ID NO: 5, and SEQ ID NO: 8 are SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 72, respectively, with an added N-terminal GS).
- FIG.3B show TfR-binding of variants identified during the second variant mutation.
- the x-axis shows SEQ ID NOs of all variants and the y-axis shows the amount TfR bound in relative fluorescence units (RFUs) extrapolated from flow cytometry experiments.
- EXAMPLE 6 TfR-binding of SSM-Generated TfR-binding Peptide Variants [0383] This example demonstrates TfR-binding of site saturation mutagenesis (SSM)-generated TfR-binding peptide variants, as identified during SSM as described in EXAMPLE 5 [0384] In vivo BBB penetration experiments revealed that the TfR-binding capability of a peptide does not necessarily correspond with the capability of promoting vesicular transcytosis.
- SSM site saturation mutagenesis
- the peptide or peptide complex of the present disclosure comprises at least one or more of these corresponding residues in SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64.
- Such peptides can accordingly be engineered with enhanced binding to TfR.
- Hydrophilic surface-distal residues such as D, E, H, K, R, N, Q, S, or T likely contribute to peptide solubility corresponding to the following amino acid residues R3, E4, R9, K12, D14, E15, K19, R23, S26, S28, N29, T30, E31, E32, D33, E35, Q36, E37, E39, and D40, with reference to SEQ ID NO: 32 (Rl, E3, R7, K10, D12, E13, K17, R21, S24, S26, N27, T28, E29, E30, D31, E33, Q34, E35, E37, and D38, with reference to SEQ ID NO: 96).
- the peptide or peptide complex of the present disclosure comprises at least one or more of these corresponding residues in SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64.
- Such peptides can accordingly be engineered with enhanced solubility.
- the peptide or peptide complex of the present disclosure comprises at least one or more of these corresponding residues in SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64.
- Such peptides can accordingly be engineered with modified binding affinity.
- the peptide or peptide complex of the present disclosure comprises at least one or more of these corresponding residues in SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64.
- Such peptides can accordingly be engineered with modified binding affinity.
- a higher TfR-binding affinity is associated with aliphatic residues such as A, M, I, L, or V as shown by improved binding from a mutation away from large, aromatic residues such as F, W, or Y at the amino acid residue corresponding to L45 with reference to SEQ ID NO: 32 (L43 with reference to SEQ ID NO: 96).
- Substitutions of any one or more F, W, or Y in a peptide of the present disclosure to an aliphatic residue comprising A, M, I, L, or V can be used to enhance the binding affinity of the peptide to TfR.
- Any of peptides or peptide complexes of the present disclosure can be modified at one or more of the corresponding residues described herein, to generate peptide variants with improved properties including enhanced stability and increased (or decreased) binding properties or modified TfR-binding affinity and increased (or decreased) transcytosis properties, including modified ka (association) and kd (dissociation) rate constants.
- SPR Surface Plasmon Resonance
- binding affinity was analyzed by SPR experiments using captured biotinylated TfR, and which were performed at 25 °C on a Biacore T100 instrument (GE Healthcare) with Series S SA chips.
- HBS-EP+ (10 mM HEPES, pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.05% surfactant P20) was used as a running buffer in the experiments with 0.1 mg/mL bovine serum albumin (BSA).
- Soluble TfR-binding peptides were evaluated for binding by incubation of a dilution series, in which the concentration range was varied depending on the TfR-binding peptide being tested with 2 ug/ml TfR, capturing -300 resonance units (RUs) of protein for SPR experiments.
- FIG. 5 illustrates a surface plasmon resonance (SPR) trace showing TfR-binding for varying concentrations of the peptide from 100 pM to 200 nM having a sequence of SEQ ID NO: 2.
- FIG. 6 illustrates a surface plasmon resonance (SPR) trace showing TfR-binding for varying concentrations of the peptide from 100 pM to 200 nM having a sequence of SEQ ID NO: 4.
- FIG. 7 illustrates binding and single cycle kinetics data of SEQ ID NO: 32 binding to captured biotinylated (Bt) hTfR by SPR. 5 concentrations of a peptide having a sequence of
- FIG.8 illustrates binding and single cycle kinetics data of SEQ ID NO: 30 binding to captured biotinylated hTfR by SPR.5 concentrations of a peptide having a sequence of SEQ ID NO: 30 (0.037 nM, 0.11 nM, 0.33 nM, 1 nM, 3 nM) were injected over 2 densities of captured Bt-hTfR and analyzed globally.
- a K D of 8.7 ⁇ 4 nM and an Rmax of 23.1 ⁇ 2 RUs was determined.
- For the peptide having a sequence of SEQ ID NO: 4 a K D of 14.8 ⁇ 6 nM and an R max of 21.2 ⁇ 2 RUs was determined.
- For the peptide having a sequence of SEQ ID NO: 32 a K D of 216 ⁇ 1 pM was determined.
- For the peptide having a sequence of SEQ ID NO: 30 a KD of 468 ⁇ 1 pM was determined. Lower KD values indicate a higher binding affinity.
- Rmax represents the maximum binding capacity of the peptide to hTfR.
- SEQ ID NO: 32 had the lowest K D , indicating that it displayed the strongest binding to hTfR.
- An increased TfR-binding affinity can correspond to an improved transcytosis function.
- an increased TfR-binding affinity can correspond to a reduced transcytosis function, wherein in some cases, an increased TfR-binding affinity does not correspond to a change in transcytosis function compared to the reference peptide.
- a CDP that binds to transferrin receptor (TfR) and has a sequence of SEQ ID NO: 32 (corresponding to SEQ ID NO: 96 with an added N-terminal GS) was identified using site saturation mutagenesis as described in EXAMPLE 5. The pH-dependence of the binding affinity of the TfR-binding peptide for TfR was then compared at an exemplary extracellular pH of 7.4 and at an exemplary endosomal pH of 5.5. [0400] Cells expressing the peptide of SEQ ID NO: 32 were stained with 10 nM of biotinylated TfR labeled with streptavidin-AlexaFluor 647.
- TfR fluorescence was measured as a function of expression of SEQ ID NO: 32.
- a slice gate corresponding to a desired peptide expression level was selected for comparison.
- the level TfR fluorescence within the selected slice gate was indicative of the affinity of the peptide for TfR at the tested pH.
- the results showed that the TfR-binding peptide bound to TfR with slightly higher affinity at endosomal pH (pH 5.5) than at physiologic extracellular pH (pH 7.4, FIG.10C), with a slightly higher affinity at pH 5.5.
- TfR binding peptide of SEQ ID NO: 32 can bind TfR at a range of pHs including extracellular and endosomal pHs, and that it has a relatively pH-independent affinity for binding TfR. This demonstrates the suitability of the TfR-binding peptide for use in a method recruiting target molecules to endosomes while remaining bound to TfR inside the endosome. These results suggest that the TfR-binding peptide of SEQ ID NO: 32, and similar TfR binding CDPs of this disclosure, along with peptides linked to the TfR-binding peptide, can be recycled back to the cell surface along with TfR following TfR-mediated endocytosis. EXAMPLE 9
- PD-Ll-binding Peptides for pH-dependent Endosomal Delivery of PD-L1 This example describes development and in vitro testing of PD-Ll-binding peptides capable of pH-dependent dissociation from PD-L1, for example, at endosomal pH (e.g., pH 5.5).
- Imparting pH-dependent binding to a target-engaging domain can done in a variety of ways, an example of which is provided here.
- a library of variants was designed containing histidine substitutions.
- Histidine residues were introduced because, of all of the natural amino acids, His is the only one with a side chain whose charge changes significantly between neutral (e.g., pH 7.4) and acidic (e.g., pH ⁇ 6) endosomal conditions.
- This change of charge can alter binding, either directly (introducing a positive charge at low pH that could result in charge repulsion of nearby cationic groups) or indirectly (the change in charge imparts a subtle change in the binder’s structure, disrupting a protein-protein interface) as the pH changes, for example from a physiologic extracellular environment to an endosomal environment as the endosome acidifies.
- FIG. 11D shows a high-affinity PD-Ll-binding CDP sequence (SEQ ID NO: 187,
- Each black box represents a first and second site in which His could be substituted. Those purely along the top-left to bottom-right diagonal represent single His substitutions.
- Each black box represents a variant with one or two native-to- His substitutions, representing 821 peptide variants to be screened.
- a variant library containing the parental sequence and variants with one or two native-to-His substitutions was generated and tested.
- the resulting histidine-enriched PD-Ll-binding peptides were evaluated for their PD-L1 binding in comparative binding experiments at various pH levels or ranges.
- a variant library of PD-Ll-binding peptides was expressed via mammalian surface display, with each variant containing zero, one or two His substitutions. These variants were tested for maintenance of binding under extracellular pH (such as pH 7.4), and for reduced binding under endosomal pH (such as pH 5.5). Sequential screening was performed, as shown in FIG. 21. The input library was initially screened for PD-L1 binding at pH 7.4, and strong binders were selected (shaded area).
- the second and third rounds of screening (“Sort 1” and “Sort 2,” respectively) were performed at pH 5.5 to mimic endosomal pH, and the weak binders were collected (shaded area).
- Peptides containing substitutions at E2H NO: 239) were compared to SEQ ID NO: 187.
- the variant corresponding to SEQ ID NO: 233, containing substitutions at E2H and K16H, showed strong binding to PD-L1 at pH 7.4 and substantial loss of binding at pH 5.5 (black arrow).
- the other variants and the parent peptide showed varying levels of PD-L1 binding at pH 7.4 and at pH 5.5, with varying degrees of pH dependence to the binding.
- EXAMPLE 10 Development of Selective Depletion Complexes Containing pH-dependent PD-L1-binding Peptides for Selective Depletion of PD-L1
- This example describes development of selective depletion complexes containing pH- dependent PD-L1-binding peptides for selective depletion of PD-L1.
- Peptides with high PD-L1 binding affinity at physiologic extracellular pH but a significantly reduced binding affinity at lower pH levels such as endosomal pH of 55 are selected for cellular binding uptake and intra- endosomal or intra-vesicular release as described in EXAMPLE 9.
- PD-Ll-binding peptides with high endosomal delivery capabilities are identified and characterized.
- PD-L1 binding peptides with high PD-L1 binding affinity at physiologic extracellular pH (e.g., pH 7.4) and reduced binding affinity at endosomal pH (e.g., pH 5.5) are fused recombinantly, chemically synthesized as a single fusion, separately recombinantly expressed and conjugated, or separately chemically synthesized and conjugated to a TfR-binding peptide with a TfR-binding affinity that is substantially the same at a physiologic extracellular pH and at endosomal pH (e.g., a TfR- binding peptide of any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64), optionally with any linker or no linker in between the PD-L1 binding
- FIG. 11A A sample screening pipeline showing progression from screening for target binding CDPs, to modifying such CDPs for pH-dependent binding, to incorporation into compositions for selective depletion is shown in FIG. 11A.
- a peptide library of CDPs is screened for the ability to bind to a target molecule.
- Target-binding peptides from the library are distinguished by accumulation of signal from bound target molecules.
- identified target-binding peptides are selected and further matured for binding, for example using point mutation screens.
- Identified target binding peptides are converted to pH-dependent binders, for example by performing histidine point mutation scans as illustrated in FIG. 11D and described in EXAMPLE 9.
- the pH-dependent target-binding peptide is fused or linked to a recycler peptide (e.g., a TfR-binding peptide of any of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64), to form a selective depletion complex.
- a recycler peptide e.g., a TfR-binding peptide of any of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64
- the selective depletion complexes are validated by testing target depletion in cells expressing the selective depletion
- Complexes can be further tested in healthy cells and in transformed cell lines to measure disease-specific functionalities of the selective depletion complexes, as shown in FIG. 11C. Specificity of the complexes is measured by testing for changes in a target-specific cellular function, such as cancer-specific growth inhibition upon depletion of an apoptosis inhibitor. Target-specific cellular functions can depend on extrinsic or intrinsic factors, or a combination of extrinsic and intrinsic factors. Degradation of the target and selective impairment of cancer cells suggests that a therapeutic window exists in patients.
- Cancer-specific growth inhibition by a selective depletion complex comprising a PD-Ll- binding peptide may be tested using cells co-cultured with T cells.
- the checkpoint inhibition signaling can be reduced, and the tumor cells can be more likely to be recognized by and attacked by the immune system, leading to reduced tumor growth, reduced metastasis, or increase of other beneficial tumor responses.
- a composition containing a TfR-binding peptide (e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64) conjugated to a target-binding peptide is contacted to cells expressing TfR.
- a TfR-binding peptide e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64
- the TfR-binding peptide binds TfR with high affinity at both physiologic extracellular pH (such as pH 7.4) and at endosomal pH (such as pH 5.5), and the target-binding peptide binds to a soluble target molecule with higher affinity at physiologic extracellular pH and with lower affinity at endosomal pH.
- the TfR-binding peptide binds to TfR on the cell surface, and the target-binding peptide binds to the soluble target molecule in solution (FIG. 12A, (1)).
- composition containing the TfR-binding peptide and the target-binding peptide is endocytosed via TfR-mediated endocytosis along with the TfR and the bound target molecule (FIG. 12A, (2)).
- the endosomal compartment acidifies, the target molecule is released from the target-binding peptide (FIG. 12A, (3)).
- the target molecule is then degraded in a lysosomal compartment (FIG. 12A, (4)), and the complex is recycled to the cell surface along with the TfR (FIG. 12A, (5)).
- composition containing a TfR-binding peptide e.g., any one of SEQ ID NO: 96,
- SEQ ID NO: 65 SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 -
- SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64) conjugated to a target-binding peptide is contacted to cells expressing TfR.
- the TfR-binding peptide binds TfR with high affinity at both physiologic extracellular pH (such as at pH 7.4) and at endosomal pH (such as at pH 5.5), and the target-binding peptide binds to a surface target molecule with higher affinity at physiologic extracellular pH and with lower affinity at endosomal pH.
- the TfR-binding peptide binds to TfR on the cell surface
- the target-binding peptide binds to the surface target molecule on the cell surface (FIG.
- the composition containing the TfR-binding peptide and the target-binding peptide is endocytosed via TfR-mediated endocytosis along with the TfR and the bound target molecule (FIG. 12B, (2)). As the endosomal compartment acidifies, the target molecule is released from the target-binding peptide (FIG. 12B, (3)). The target molecule is then degraded in a lysosomal compartment (FIG. 12B, (4)), and the complex is recycled to the cell surface along with the TfR (FIG. 12B, (5)).
- This example demonstrates a method of extending the serum or plasma half-life of a peptide using serum albumin-binding peptide complexes as disclosed herein.
- a peptide or peptide complex having a sequence of any one of SEQ ID NO: 96, SEQ ID NO: 65 - SEQ ID NO: 95, SEQ ID NO: 97 - SEQ ID NO: 128, SEQ ID NO: 220 - SEQ ID NO: 222, or SEQ ID NO: 1 - SEQ ID NO: 64 is modified in order to increase its plasma half-life.
- the peptide and the serum half-life extending moiety are fused recombinantly, chemically synthesized as a single fusion, separately recombinantly expressed and conjugated, or separately chemically synthesized and conjugated. Fusing the peptide to a serum albumin-binding peptide extends the serum half- life of the peptide complex.
- the peptide or peptide complex is conjugated to a serum albuminbinding peptide, such as SA21 (SEQ ID NO: 178).
- SA21 serum albuminbinding peptide
- the peptide fused to SA21 has a sequence of any one of SEQ ID NO: 181 or SEQ ID NO: 184.
- the peptide fused to SA21 is linked to SA21 via a peptide linker having a sequence of SEQ ID NO: 179.
- the linker having a sequence corresponding to SEQ ID NO: 179 links two separately functional CDPs to incorporate serum half-life extension function into the peptide or peptide complex.
- the linker having a sequence corresponding to SEQ ID NO: 179 enables SA21 to cyclize without steric impediment from either member of the peptide complex.
- conjugation of the peptide to an albumin binder, such as Albu-tag or a fatty acid, such as a C14-C18 fatty acid or palmitic acid is used to extend plasma half-life. Plasma half-life is also optionally extended as a result of reduced immunogenicity by using minimal non-human protein sequences.
- FIG. 13A and FIG. 13B illustrate the purification of SA21 fusion peptides.
- SA21 was recombinantly expressed as a fusion peptide with a CDP and purified by HPLC.
- Peptides were purified fused to siderocalin (“Scn-CDP”) and cleaved to produce the ⁇ g ⁇ q ⁇ _ Q?21 apndji k ⁇ kod_ ⁇ ( ⁇ ABN ⁇ ) ⁇ i_ siderocalin ( ⁇ Q ⁇ i ⁇ ).
- FIG.13A shows purification of a peptide TfR-binding peptide fused to a serum albumin-binding peptide (SA21) corresponding to SEQ ID NO: 181. Purity was verified by SDS-PAGE (left) and RP-HPLC (right) under DTT m ⁇ _p ⁇ dib ( ⁇ P ⁇ ) jm iji-m ⁇ _p ⁇ dib ( ⁇ LP ⁇ ) ⁇ ji_dodjin. QBQ-PAGE was also run on the uncleaved ( ⁇ S ⁇ ) siderocalin-CDP fusion peptide.
- FIG.13B shows purification of a peptide fused to SA21 corresponding to SEQ ID NO: 182 (GSRLIEDICLPRWGCLWEDDGGGGSGGGGSVRIPVSCKHSGQCLKPCKDAGMRF GKCMNGKCDCTPK). Purity was verified by SDS-PAGE (left) and RP-HPLC (right) under BRR m ⁇ _p ⁇ dib ( ⁇ P ⁇ ) jm iji-m ⁇ _p ⁇ dib ( ⁇ LP ⁇ ) ⁇ ji_dodjin.
- a TfR-binding peptide (e.g., any one of SEQ ID NO: 96, SEQ ID NO: 65 ⁇ SEQ ID NO: 95, SEQ ID NO: 97 ⁇ SEQ ID NO: 128, SEQ ID NO: 220 ⁇ SEQ ID NO: 222, or SEQ ID NO: 1 ⁇ SEQ ID NO: 64) is conjugated to a target- binding peptide (e.g., a target-binding CDP selected for pH-dependent binding as described in EXAMPLE 9) via a linker.
- a target- binding peptide e.g., a target-binding CDP selected for pH-dependent binding as described in EXAMPLE 9
- the target-binding peptide can be fused to the TfR-binding peptide via a DkTx peptide (SEQ ID NO: 139, KKYKPYVPVTTN) from native CDP dimer, as shown in FIG.14A.
- the DkTx peptide linker is from a native knottin-knottin dimer from the Tau- theraphotoxin-Hs1a, also known as DkTx (double-knot toxin), in Haplopelma schmidti. Natively the DkTx linker separates two independently folding CDP domains and is well suited for maintaining the function of the two dimerizing CDPs.
- the target-binding peptide can be fused to the TfR-binding peptide via a poly-GlySer linker such as (SEQ ID NO: 138, GGGSGGGSGGGS), containing varying lengths of glycines interspaced by serines for solubility, as shown in FIG. 14B.
- the target-binding peptide can be fused to the TfR-binding peptide via a human IgG linker with a Cys-to-Ser mutation at position 5 (SEQ ID NO: 140, EPKSSDKTHT) to prevent crosslinking during secretion, as shown in FIG. 14C.
- a peptide linker for dimerizing two peptides optionally has the following properties: 1) the linker does not disturb the independent folding of the TfR- and target-binding domains, 2) the linker provides sufficient length to the mature molecule so as to facilitate contact between the target molecule and the TfR via the TfR-binding peptide target-biding peptide dimer, 3) the linker does not negatively impact manufacturability (synthetic or recombinant) of the TfR-binding peptide target-biding peptide dimer, and 4) the linker does not impair any required post-synthesis chemical alteration of the TfR-binding peptide target-biding peptide dimer (e.g., conjugation of a fluorophore or albumin-binding chemical group).
- CDPs can also be dimerized using immunoglobulin heavy chain Fc domains. These are commonly used in modern molecular medicine to dimerize functional domains, either based on antibodies or other otherwise soluble functional domains.
- the target-binding peptide can be non-covalently linked to the TfR-binding peptide via an IgG-based Fc domain, as shown in FIG. 15.
- An Fc domain can be used to homo- or hetero-dimerize functional domains and to impart serum half-life extension via a domain that interacts with the recycling Fc receptor (FcRn).
- Dimerization can be homodimeric if the Fc sequences are native, but if one wants to drive heterodimer formation, the Fc can be mutated into “knob-in-hole” format, where one Fc CH3 contains novel residues (knob) designed to fit into a cavity (hole) on the other Fc CH3 domain.
- knob+knob dimers are highly energetically unfavorable.
- Hole+hole dimers can be formed, but if a purification tag is added specifically to the “knob” side, hole+hole dimers can be excluded, ensuring that only knob+hole dimers are purified.
- Fc domains can separately be used as a recycling receptor- engaging domain, so use of Fc for dimerization can enhance peptide complex recycling or selective degradation complex.
- TfR-binding and target-binding CDPs can be further functionalized and multimerized by adding a third (or more) functional domain.
- a third (or more) functional domain In this example, an albumin-binding domain from a Finegoldia magna peptostreptococcal albumin-binding protein (SEQ ID NO: 192) is shown, as it is a simple three-helical structure that would be unlikely to disturb the independent folding of the other CDP domains.
- Such added functional domains could be included in any orientation relative to the TfR- and target-binding domains, as shown in FIG.16A i FIG.16C.
- Example peptides are shown with a poly-GlySer linker, but any of a number of linkers (e.g., any one of SEQ ID NO: 129 ⁇ SEQ ID NO: 141 or SEQ ID NO: 195 ⁇ SEQ ID NO: 218) could be used.
- An albumin binding domain e.g., a peptide of SEQ ID NO: 178 or SEQ ID NO: 192 can be fused to the TfR-binding peptide, the target-binding peptide, or both.
- the albumin binding domain can include a peptide linker (e.g., any one of SEQ ID NO: 129 ⁇ SEQ ID NO: 141 or SEQ ID NO: 195 ⁇ SEQ ID NO: 218).
- the albumin binding domain can be linked to the target-binding peptide and the TfR-binding peptide, as shown in FIG.16A.
- the albumin binding domain can be linked to the target-binding peptide, as shown in FIG.16B.
- the albumin binding domain can be linked to the TfR-binding peptide, as shown in FIG.16C. Addition of the albumin binding domain can increase the serum half-life of a composition containing the TfR-binding peptide and the target-binding peptide.
- CDP-CDP dimers containing a TfR-binding peptide of SEQ ID NO: 2 and an ion-channel inhibitory CDP.
- the TfR-binding peptide was linked to a peptide inhibitor of the Kv1.3 voltage-gated potassium channel (Z1E-AnTx, Z1P- AnTx, EWSS-ShK, HsTx, Pro-Vm24, or Vm24) by either a DkTx linker (SEQ ID NO: 139) or a GS3 linker (SEQ ID NO: 141).
- the CDP-CDP dimer peptides were expressed as a fusion with a siderocalin carrier peptide (SEQ ID NO: 147), which was cleaved off with a TEV protease.
- SEQ ID NO: 147 siderocalin carrier peptide
- the purified peptides were run on an SDS-PAGE gel to verify that the peptide fusions were intact (FIG.17A).
- Rc ⁇ ⁇ ndly distinguishable bands in the peptide sample lanes corresponded to, from top to bottom, uncleaved CDP-CDP dimer with siderocalin, cleaved siderocalin, and cleaved CDP-CDP dimer. All of the CDP-CDP dimer complexes expressed well, as indicated by the band intensity, and appeared folded, as indicated by the shift upon reduction with DTT.
- a different TfR-binding CDP corresponding to SEQ ID NO: 32 was fused to the Vm24 ion channel inhibitor via a polyGly-Ser linker (SEQ ID NO: 138).
- the resulting CDP-CDP dimer was purified and run on an SDS-PAGE gel (FIG. 17B, left bottom).
- the TfR-binding peptide (SEQ ID NO: 32) and the Vm24 ion channel -inhibiting CDP were also purified individually (FIG. 17B, left top and left middle).
- Purity of the TfR-binding peptide, the ion channel-inhibiting CDP, and the CDP-CDP dimer was compared using reverse phase high pressure liquid chromatography (RP-HPLC, FIG. 17B, center). The ability of each complex to inhibit a Kvl.3 ion channel was then tested (FIG. 17B, right).
- the CDP-CDP dimer retained its ability to inhibit the ion channel compared to the ion channel -inhibiting CDP alone. As expected, the TfR-binding peptide alone did not inhibit Kvl.3.
- FIG. 18A and FIG. 18B show flow cytometry plots that verify human versus mouse TfR expression using species-specific antibodies.
- FIG. 18C and FIG. 18D demonstrate that the peptides effectively bind to both homologs.
- flow cytometry was used to demonstrate effective binding of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 32, and Anti-Tf antibodies (positive controls).
- This example describes activation of neuronal CRE transporter mice using peptide complexes comprising one or more TfR-binding peptides as described herein.
- a fusion peptide comprising TfR-binding peptides and a neurotensin peptide was used.
- Peptides corresponding to SEQ ID NO: 1, SEQ ID NO: 2, and SEQ ID NO: 32 SEQ ID NO: 1, SEQ ID NO:
- SEQ ID NO: 2 and SEQ ID NO: 32 are SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 96, respectively, with an added N-terminal GS) were fused with neurotensin at the C-terminus of each peptide to produce the peptide-NT complexes.
- the downstream activity of neurotensin involves intracellular Ca 2+ regulation and cAMP response element (CRE) driven transcriptional programs (FIG.19A), and its modulation has been explored for suppression of chronic pain.
- CRE cAMP response element
- NTSR activity in HEK293 cells, or HEK293 cells transduced with a lentivector delivering human NTSR1 was measured using the IP-One ⁇ Gq kit (CisBio 62IPAPEB, FIG.19B).
- Cells were grown in DMEM + 10% fetal bovine serum, removed from the plates with Accutase, pelleted, and suspended in Hanks Buffered Salt Solution at a density of 1.5X10 6 cells per mL.
- HTFR reactions were set up in HTFR 96 well low volume plates (CisBio $66NJ96025) ⁇ jm_dib oj oc ⁇ h ⁇ ipa ⁇ opm ⁇ m ⁇ n dinomp ⁇ odjin.10,000 ⁇ ggn (7 ⁇ J) r ⁇ m ⁇ pn ⁇ _ k ⁇ m 25 ⁇ L reaction. The plate was incubated for 60 mins at 37°C. Then 3 ⁇ L IP1-d2 working solution was then added, followed by 3 ⁇ L Anti IP1-Cryptate working solution.
- FRET ratio was calculated as10,000 x (Signal 665 nm / Signal 620 nm).
- EXAMPLE 19 Development of a High Affinity and pH-Dependent EGFR Binding Nanobody [0422] This example describes development of a high affinity and pH-dependent EGFR binding nanobody.
- a nanobody that binds EGFR WGQGTQVTVSS, SEQ ID NO: 219) was modified for higher affinity and for pH-dependent binding to EGFR.
- a peptide library containing histidine point mutations at each residue in the two complementarity-determining regions shown by crystal structure to interact with EGFR (underlined in SEQ ID NO: 219 showing CDR1 and CDR3, respectively) was generated. Because CDR1 contains 10 non histidine residues one can generate up to 56 variants with 0, 1, or 2 histidines. Because CDR3 contains 17 non-histidine residues, one can generate up to 154 variants with 0, 1, or 2 histidines.
- a first EGFR-binding nanobody (SEQ ID NO: 242) was identified as a high-affinity EGFR-binding peptide that bound EGFR with higher affinity than SEQ ID NO: 219.
- a second EGFR-binding nanobody (SEQ ID NO: 243) was identified as a pH-dependent EGFR-binding nanobody that bound to EGFR with high affinity at ⁇ 7.4 and showed a decrease in binding affinity at ⁇ 6 or lower.
- a peptide e.g., a nanobody
- a target molecule e.g., PD-L1, VEGF, PD-1, EGFR, CD38, GD2, SLAMF7, CTLA-4, CCR4, CD20, PDGFRa, VEGFR2, HER2, CD33, CD30, CD22, CD79B, Nectin-4, or TROP2
- a target molecule e.g., PD-L1, VEGF, PD-1, EGFR, CD38, GD2, SLAMF7, CTLA-4, CCR4, CD20, PDGFRa, VEGFR2, HER2, CD33, CD30, CD22, CD79B, Nectin-4, or TROP2
- the site saturation mutant library is screened for binding to the target molecule at physiologic extracellular pH (e.g., pH 7.4) and at endosomal pH (e.g., pH 5.5). Mutants that show a higher binding affinity at physiologic extracellular pH and reduced binding affinity at endosomal pH are selected and further screened. Subsequent rounds of site saturation mutagenesis are performed on the hits to further improve pH-dependent binding.
- physiologic extracellular pH e.g., pH 7.4
- endosomal pH e.g., pH 5.5
- Mutants that show a higher binding affinity at physiologic extracellular pH and reduced binding affinity at endosomal pH are selected and further screened. Subsequent rounds of site saturation mutagenesis are performed on the hits to further improve pH-dependent binding.
- This example describes delivery of selective depletion complexes using an oncolytic herpes simplex virus.
- a gene encoding expression and secretion of a selective depletion complex is introduced to a target cell using an oncolytic herpes simplex virus (oHSV) vector.
- oHSV oncolytic herpes simplex virus
- the target cell is a cell within a patient.
- a target cell is a patient cell that has been collected and is re-introduced into the patient after modification with the viral vector.
- the oHSV infects cancer cells, and cancer cells that are not killed by the virus express and secrete the selective depletion complex. The remaining cells modify the tumor microenvironment to suppress immune activity against the cancer cells.
- Selective depletion complexes are secreted from the tumor cells in situ and act on the cancers are directed against immunosuppressive factors on T cells or in the tumor microenvironment.
- selective depletion complexes that modify tumor or T-cell activity could are engineered into CAR-T cells or other cellular therapies.
- CAR-T cells are already being specialized through genetic modification to target tumor tissue, killing tumor cells that carry cell surface markers targeted by the expressed chimeric antigen receptors (CAR). If supplemental activity is desired, such as suppression of regulatory, immunosuppressive signaling present in these tumors, the CAR-T cell is engineered to also secrete selective depletion complexes that suppress regulatory, immunosuppressive signaling.
- EXAMPLE 22 Ternary Complex Formation between Selective Depletion Complexes, Target Molecules, and Receptors [0427] This example describes ternary complex formation between selective depletion complexes, target molecules, and receptors while on the surface of a cell.
- SDCs Selective depletion complexes containing a target-binding peptide, a first peptide linker (GGGGSx4, SEQ ID NO: 224), an albumin binding peptide (SEQ ID NO: 227), a second peptide linker (GGGGSx4, SEQ ID NO: 224), and a TfR-binding peptide were designed to bind a target molecule and a transferrin receptor, as illustrated in FIG.23A.
- SDCs can contain one binding end that binds in a pH dependent fashion.
- the pH dependent binding has a significant differential in binding at endosomal pH (e.g., pH 5.5, 6.0, 6.5, 5.0, 4.5) versus binding at extracellular pH (e.g., pH 7.4, 7.0); however milder differences in endosomal versus extracellular pH binding may also be effective.
- endosomal pH e.g., pH 5.5, 6.0, 6.5, 5.0, 4.5
- extracellular pH e.g., pH 7.4, 7.0
- FIG. 23B shows SDS-PAGE analysis of the four peptide complexes, confirming successful expression and purification of the molecules.
- the four peptide complexes were screened for their ability to form ternary complexes by binding to both a cell surface-expressed target molecule (EGFR or PD-L1) and a receptor molecule (soluble TfR ectodomain fluorescently labeled with streptavidin-647).
- EGFR or PD-L1 cell surface-expressed target molecule
- receptor molecule soluble TfR ectodomain fluorescently labeled with streptavidin-647.
- the selective depletion complex containing an EGFR-binding peptide and a high-affmity TfR-binding peptide (peptide 2, corresponding to SEQ ID NO: 328) formed ternary complexes with cells expressing EGFR (left) but not with cells expressing PD- L1 (right).
- the selective depletion complex containing a PD-L1 -binding peptide and a high-affmity TfR-binding peptide (peptide 4, corresponding to SEQ ID NO: 356) formed ternary complexes with cells expressing PD-L1 (right) but not with cells expressing EGFR (left).
- Comparator peptide complexes with low affinity binding to TfR did not form ternary complexes, as seen by a lack of fluorescent labeling in the right and left panels of FIG. 23C.
- this data demonstrates that selective depletion molecules containing a target-binding peptide and a high-affmity receptor-binding peptide form ternary complexes with the target
- EXAMPLE 23 Cooperative Binding of Selective Depletion Complexes for Cell-Specific Targeting
- SDCs Selective depletion complexes
- a target-binding peptide and a receptor-binding peptide and labeled with a His tag (SEQ ID NO: 228) as illustrated in FIG. 24A, as well as a control peptide that does not contain a high-affinity target-binding moiety but that does contain receptor-binding moiety and a His-tag, were tested for the ability to cooperatively bind to a target molecule and a receptor on a cell surface.
- TfR TfR
- PBS PDL1 -, TfR +
- fluorescent anti-His antibody fluorescent anti-His antibody
- the SDC capable of binding both PD-L1 and TfR (SEQ ID NO: 356) cooperatively bound to cells expressing both PD-L1 and TfR, as indicated by high fluorescence shown in FIG.24B.
- the same SDC showed significant but substantially lower binding to cells that expressed TfR but not PD-L1, as indicates by moderate fluorescence shown in FIG.24B.
- Peptide complexes lacking the ability to bind TfR with high affinity but containing a PD-L1-binding domain (SEQ ID NO: 357) showed low binding to cells expressing TfR and PD-L1.
- this data demonstrates that selective depletion complexes containing both a functional target-binding domain (e.g., a PD-L1-binding peptide) and a functional receptor-binding domain (e.g., a TfR-binding peptide) cooperatively bind to cells expressing both the target molecule and the receptor.
- a functional target-binding domain e.g., a PD-L1-binding peptide
- a functional receptor-binding domain e.g., a TfR-binding peptide
- EXAMPLE 24 Designing Selective Depletion Complexes
- This example describes designing selective depletion complexes to bind to and deplete a target molecule.
- Selective depletion complexes containing a target-binding peptide and a receptor-binding peptide are designed deplete a target molecule by binding to a receptor that is recycled via the endocytic pathway (e.g., TfR or PD-L1) and also binding the target molecule (e.g., PD-L1 or EGFR).
- a receptor that is recycled via the endocytic pathway (e.g., TfR or PD-L1) and also binding the target molecule (e.g., PD-L1 or EGFR).
- One of the binding peptides in the SDC exhibits pH dependent binding (that is, higher binding to the target or receptor at extracellular pH than at endosomal/lysosomal pH).
- the SDC may be catalytic. If the receptor is bound with pH dependence and the target is bound with pH independence, the SDC may be non-catalytic.
- the receptor-binding peptide is complexed with the target-binding peptide by direct fusion through a linker or by dimerization through a dimerization domain Examples of selective depletion complexes and comparator molecules are shown in FIG. 25A and FIG. 25B.
- the selective depletion complexes and complex components are assembled by connecting a target-binding peptide to a receptor-binding peptide through a linker or a dimerization domain.
- receptor-binding peptides include a TfR-binding CDP (SEQ ID NO: 96, “T”) or a TfR-binding single chain antibody (SEQ ID NO: 221, “N5”; or SEQ ID NO: 222, “M16”).
- SEQ ID NO: 96 and SEQ ID NO: 221 can bind TfR with pH independence and SEQ ID NO: 222 can bind TfR with pH dependence.
- targetbinding peptides include an EGFR-binding nanobody (SEQ ID NO: 242, “G2”) with limited pH dependence, a pH-dependent EGFR-binding nanobody (SEQ ID NO: 243; “P”), a PD-L1- binding CDP with moderate pH dependence (SEQ ID NO: 187; solid dark circle), or a PD-L1- binding CDP with extreme pH dependence (SEQ ID NO: 233; solid light circle).
- Peptide linkers e g., SEQ ID NO: 129 - SEQ ID NO: 141, SEQ ID NO: 194 - SEQ ID NO: 218, SEQ ID NO: 223 - SEQ ID NO: 227, or SEQ ID NO: 391
- dimerization domains e.g., SEQ ID NO: 245 - SEQ ID NO: 287 are used to link the target-binding peptide to the receptor-binding peptide in a single polypeptide chain, as seen in the first row of complexes, or to link the target-binding peptide or the receptor-binding peptide to a dimerization domain, as seen in the second row of complexes in FIG. 25A.
- the dimerization domain can be an Fc homodimerization domain (e.g., any of SEQ ID NO: 245 - SEQ ID NO: 259) or a knob-in-hole (KIH) Fc heterodimerization domain (e.g., SEQ ID NO: 260 - SEQ ID NO: 287).
- Fc homodimerization domain e.g., any of SEQ ID NO: 245 - SEQ ID NO: 259
- KIH knob-in-hole
- SEQ ID NO: 260 dimerizes with SEQ ID NO: 261; SEQ ID NO: 262 dimerizes with SEQ ID NO: 263; SEQ ID NO: 264 dimerizes with SEQ ID NO: 265; SEQ ID NO: 266 dimerizes with SEQ ID NO: 267; SEQ ID NO: 268 dimerizes with SEQ ID NO: 269; SEQ ID NO: 270 dimerizes with SEQ ID NO: 271; SEQ ID NO: 272 dimerizes with SEQ ID NO: 273; SEQ ID NO: 274 dimerizes with SEQ ID NO: 275; SEQ ID NO: 276 dimerizes with SEQ ID NO: 277; SEQ ID NO: 278 dimerizes with SEQ ID NO: 279; SEQ ID NO: 280 dimerizes with SEQ ID NO: 281; SEQ ID NO: 282 dimerizes with SEQ ID NO: 283; SEQ ID NO: 284 dimerizes with SEQ
- FIG. 25A Examples of monovalent selective depletion complexes are shown in FIG. 25A.
- Monovalent selective depletion complexes are designed as single polypeptide chains containing a target-binding peptide (e.g., SEQ ID NO: 242, “G2”; SEQ ID NO: 243, “P”; SEQ ID NO: 187, solid dark circle; or SEQ ID NO: 233, solid light circle) linked to a receptor-binding peptide
- a target-binding peptide e.g., SEQ ID NO: 242, “G2”; SEQ ID NO: 243, “P”; SEQ ID NO: 187, solid dark circle; or SEQ ID NO: 233, solid light circle
- SEQ ID NO: 96 e.g., SEQ ID NO: 96, “T”; SEQ ID NO: 221, “N5”; or SEQ ID NO: 222, “M16”
- a linker e.g., SEQ ID NO: 129 - SEQ ID NO: 141, SEQ ID NO: 194 - SEQ ID NO: 218, SEQ ID NO: 223 - SEQ ID NO: 227, or SEQ ID NO: 391).
- monovalent selective depletion complexes are designed as a polypeptide containing a target-binding peptide heterodimerized with a polypeptide containing a receptor-binding polypeptide via complementary heterodimerization domains (e.g., a KIH heterodimerization pair selected from SEQ ID NO: 260 - SEQ ID NO: 287).
- complementary heterodimerization domains e.g., a KIH heterodimerization pair selected from SEQ ID NO: 260 - SEQ ID NO: 287.
- the target: SDC:receptor complex is trafficked to the endosome, where the pH is progressively lowered (such as in an early endosome, late endosome, and lysosome). At the lower pH, a pH-dependent binding end of the SDC may no longer bind to the target or receptor.
- Representative catalytic active molecules may bind to TfR in a pH-independent fashion (e.g., using SEQ ID NO: 96 or SEQ ID NO: 221) and to the target in a pH-dependent fashion (e.g., using SEQ ID NO: 243, SEQ ID NO: 187, SEQ ID NO: 233, or SEQ ID NO: 234) and will therefore remain bound to TfR but release target in the low-pH endosome.
- the target may be trafficked to a lysosome and degraded. TfR is recycled back to the cell surface, bringing the catalytic active SDC molecule with it.
- Non-catalytic active molecules may bind to TfR in a pH-dependent fashion (e.g., using SEQ ID NO: 222) and to the target in a pH-independent fashion (e.g., using SEQ ID NO: 242) and will therefore release from TfR and remain bound to the target in low pH conditions.
- the target and the SDC may then both be subject to endosomal/lysosomal degradation.
- Control molecules may be designed whose binding to both TfR (e.g., using SEQ ID NO: 96 or SEQ ID NO: 221) and to target (e.g., using SEQ ID NO:
- FIG. 25B Examples of bivalent selective depletion complexes are shown in FIG. 25B. These examples only show one example TfR-binding moiety (SEQ ID NO: 96) and one example target-binding moiety (SEQ ID NO: 243), but the concept may be applied to any TfR-binding moiety or any target-binding moiety and may be subject to the same expectations for catalytic activity, non-catalytic activity, or comparator complex behavior based on pH-dependence as demonstrated in FIG. 25A.
- a bivalent selective depletion complex contains one or two targetbinding peptides and one or two receptor-binding peptides.
- Bivalent selective depletion complexes are designed as homodimers or heterodimers containing one or more target-binding peptides (e.g., SEQ ID NO: 243, “P”; or SEQ ID NO: 242, SEQ ID NO: 187, SEQ ID NO: 233, or SEQ ID NO: 234 (not shown)) linked to one or more receptor-binding peptide (e.g., SEQ ID NO: 243, “P”; or SEQ ID NO: 242, SEQ ID NO: 187, SEQ ID NO: 233, or SEQ ID NO: 234 (not shown)) linked to one or more receptor-binding peptide (e.g., SEQ ID NO: 243, “P”; or SEQ ID NO: 242, SEQ ID NO: 187, SEQ ID NO: 233, or SEQ ID NO: 234 (not shown)) linked to one or more receptor-binding peptide (e.g., SEQ ID NO: 243, “P”; or
- linkers e.g., SEQ ID NO: 129 ⁇ SEQ ID NO: 141, SEQ ID NO: 194 ⁇ SEQ ID NO: 218, SEQ ID NO: 223 ⁇ SEQ ID NO: 227, or SEQ ID NO: 391
- a homodimerization domain e.g., any of SEQ ID NO: 245 ⁇ SEQ ID NO: 259
- a heterodimerization domain pair e.g., a KIH heterodimerization pair selected from SEQ ID NO: 260 ⁇ SEQ ID NO: 287).
- bivalent selective depletion complexes are designed as a single polypeptide chain containing one or two target-binding peptides and one or two receptor-binding peptides connected via a linker.
- Higher valence SDCs can also be designed.
- SDCs that are bivalent or multivalent may exhibit increased binding due to cooperativity, which may increase the potency or function of the molecule for target protein degradation. For example, if the receptor-binding peptide has a fairly rapid off rate, an SDC that is bivalent for binding the receptor may increase the ability of the SDC to bind the cell and may also increase the ability of the SDC to remain bound to the receptor during the trafficking of the receptor back to the cell surface.
- An SDC can have 1, 2, 3, 4, 5 or more target-binding peptides and 1, 2, 3, 4, 5 or more receptor-binding peptides.
- An IgM, polymer, or dendritic scaffold may be used to multimerize the SDC.
- FIG.25A and FIG.25B While selective depletion complexes in FIG.25A and FIG.25B are shown with the receptor-binding peptide positioned toward the N-terminus of the complex and the target- binding peptide positioned toward the C-terminus, complexes may be arranged with the target- binding peptide toward the N-terminus and the receptor-binding peptide toward the C-terminus.
- selective depletion complexes may be designed as multivalent complexes containing three or more target-binding peptides and/or three or more receptor-binding peptides.
- EXAMPLE 25 Selective Depletion of PD-L1 Using a Selective Depletion Complex
- This example describes selective depletion of PD-L1 using a selective depletion complex.
- a selective depletion complex containing a pH-dependent PD-L1-binding peptide of SEQ ID NO: 233 or SEQ ID NO: 234 and a TfR-binding peptide of SEQ ID NO: 96 or SEQ ID NO: 221 is contacted to a cell expressing TfR and PD-L1.
- the selective depletion complex cooperatively binds to TfR via the TfR-binding peptide and to PD-L1 via the PD-L1-binding peptide, forming a ternary complex on the cell surface.
- the TfR is endocytosed along with the bound selective depletion complex and PD-L1.
- the selective depletion complex releases the PD-L1 and remains bound to the TfR.
- the PD-L1 is degraded in the lysosome, thereby selectively depleting the PD-L1.
- the TfR and selective depletion complex are recycled to the cell surface [0438]
- the selective depletion complex is SEQ ID NO: 290, SEQ ID NO: 291, SEQ ID NO: 308, SEQ ID NO: 317, SEQ ID NO: 318, SEQ ID NO: 322, SEQ ID NO: 323; or the selective depletion complex is SEQ ID NO: 292, SEQ ID NO: 294, SEQ ID NO: 315, SEQ ID NO: 316, heterodimerized with SEQ ID NO: 304, SEQ ID NO: 306, SEQ ID NO: 319, SEQ ID NO: 320, SEQ ID NO: 321, SEQ ID NO: 324, or SEQ ID NO: 325; or the selective depletion complex is SEQ ID NO: 295 or SEQ ID NO: 297, heterodimerized with SEQ ID NO: 304, SEQ ID NO: 319, SEQ ID NO: 321, or SEQ ID NO: 324; or the selective depletion complex is SEQ ID
- This example describes treatment of cancer by selectively depleting PD-L1.
- a selective depletion complex containing a pH-dependent PD-L1 -binding peptide of SEQ ID NO: 233 or SEQ ID NO: 234 and a TfR-binding peptide, such as that of SEQ ID NO: 96 or SEQ ID NO: 221, is administered to a subject having a PD-L1 positive cancer.
- the selective depletion complex binds to PD-L1 and TfR on the surface of a cancer cell, and the ternary complex of the selective depletion complex, PD-L1, and TfR is endocytosed.
- the PD-L1 is released upon acidification in the endosome and degraded, thereby depleting PD-L1.
- the TfR and selective depletion complex are recycled to the cell surface. Depletion of PD-L1 inhibits evasion of the host immune response by the cancer cell and increases apoptosis of the cancer cell, thereby treating the cancer.
- This example describes selective depletion of EGFR using a selective depletion complex.
- a selective depletion complex containing a pH-dependent EGFR-binding peptide of SEQ ID NO: 1 A selective depletion complex containing a pH-dependent EGFR-binding peptide of SEQ ID NO: 1
- SEQ ID NO: 242 SEQ ID NO: 243 or SEQ ID NO: 244 and a TfR-binding peptide of SEQ ID NO: 96,
- SEQ ID NO: 221, or SEQ ID NO: 222 in any combination of TfR-binding valence (e.g. monovalent, bivalent, or greater) and EGFR-binding valence (e.g. monovalent, bivalent, or greater) is contacted to a cell expressing TfR and EGFR.
- the selective depletion complex cooperatively binds to TfR via the TfR-binding peptide and to EGFR via the EGFR-binding peptide, forming a ternary complex on the cell surface.
- the TfR is endocytosed along with the bound selective depletion complex and EGFR. Upon acidification in the endosome, the selective depletion complex releases the EGFR and remains bound to the TfR.
- the EGFR is degraded in the endosome/lysosome, thereby selectively depleting the EGFR.
- the TfR and selective depletion complex are recycled to the cell surface.
- Activation of EGFR and downstream pathways such as KRAS and MEK may be reduced. Binding to the cell surface, endosomal uptake, trafficking, degradation, and pathway activation can be detected using flow cytometry, fluorescent microscopy, Western blotting, ELISA, histology, IHC, or other methods. These can be monitored after in vitro or in vivo exposure of EGFR-expressing cells.
- the selective depletion complex is SEQ ID NO: 288, SEQ ID NO: 289, SEQ ID NO: 307, SEQ ID NO: 313, SEQ ID NO: 327, SEQ ID NO: 328, SEQ ID NO: 332, SEQ ID NO: 333, SEQ ID NO: 337, SEQ ID NO: 338, SEQ ID NO: 342, or SEQ ID NO: 343; or the selective depletion complex is SEQ ID NO: 292, SEQ ID NO: 293, SEQ ID NO: 310, SEQ ID NO: 315, SEQ ID NO: 316 heterodimerized with SEQ ID NO: 302; SEQ ID NO: 305, SEQ ID NO: 339, SEQ ID NO: 340; SEQ ID NO: 344; SEQ ID NO: 345; or the selective depletion complex is SEQ ID NO: 296 heterodimerized with SEQ ID NO: 302, SEQ ID NO: 339, or SEQ ID NO: 344; or the selective depletion complex
- PD-L1-binding domain e.g., a PD-L1-binding peptide
- TfR-binding domain the as the recycling receptor
- EGFR can similarly be depleted as described by use of a selective depletion complex that comprises a PD-L1-binding moiety and an EGFR-binding moiety where at least one moiety binds with a lower affinity at endosomal pH than at extracellular pH.
- EXAMPLE 28 Treatment of Cancer by Selectively Depleting EGFR.
- a selective depletion complex containing a pH-dependent EGFR-binding peptide, such as that of SEQ ID NO: 243 or SEQ ID NO: 244, and a TfR-binding peptide, such as that of SEQ ID NO: 96, is administered to a subject having an EGFR positive cancer
- the subject may be a human a non- human primate, a mouse, a rat, or another species.
- a selective depletion complex may be administered subcutaneously, intravenously, intramuscularly, interperitoneally, or by another route.
- the EGFR positive cancer is non-small-cell lung cancer, head and neck cancer, glioblastoma, metastatic brain cancer, colorectal cancer, TKI-resistant cancer, cetuximab -resistant cancer, necitumumab-resistant cancer, or panitumumab-resistant cancer.
- the selective depletion complex binds to EGFR and TfR on the surface of an EGFR positive cancer cell, and the ternary complex of the selective depletion complex, EGFR, and TfR is endocytosed.
- the EGFR is released upon acidification in the endosome and degraded, thereby depleting EGFR.
- the TfR and selective depletion complex are recycled to the cell surface. Depletion of EGFR reduces pro-growth signaling in the cancer cell, slowing cancer growth or metastases, thereby treating the cancer.
- the selective depletion complex targets cells that express both EGFR and TfR, the skin toxicity caused by the selective complex is less than the skin toxicity caused by anti-EGFR antibody or tyrosine kinase inhibitor therapy, which inhibit EGFR without TfR tissue targeting.
- Cancers may also be similarly treated by using a selective depletion complex that binds both PD-L1 and EGFR.
- This example describes selective depletion of TNFa using a selective depletion complex.
- a selective depletion complex containing a pH-dependent TNFa-binding peptide of and a TfR- binding peptide, such as that of SEQ ID NO: 96, is contacted to a cell expressing TfR where there is TNFa present, such as in the extracellular fluid, serum, on the cell surface, or in the cell culture media.
- the selective depletion complex cooperatively binds to TfR via the TfR-binding peptide and to TNFa via the TNFa-binding peptide, forming a ternary complex on the cell surface.
- the TfR is endocytosed along with the bound selective depletion complex and TNFa.
- the selective depletion complex releases the TNFa and remains bound to the TfR.
- the TNFa is degraded in the endosome/lysosome, thereby selectively depleting the TNFa.
- the TfR and selective depletion complex are recycled to the cell surface.
- This example describes treatment of a CNS Inflammatory Disorder by selectively depleting TNFa.
- a selective depletion complex containing a pH-dependent TNFa-binding peptide and a TfR-binding peptide of SEQ ID NO: 96 is administered to a subject having a disorder in the CNS that involves inflammation.
- the CNS inflammatory disorder is optionally neuroinflammation, stroke, traumatic brain injury, Alzheimer’s disease, or a tauopathy.
- the SDC crosses the BBB, thereby contacting cells and molecules within the subjects CNS.
- the SDC may be transported across the BBB via binding transferrin and undergoing transcytosis.
- the selective depletion complex binds to TfR on the surface of a cell and also to TNFa, and the ternary complex of the selective depletion complex, TNFa, and TfR is endocytosed.
- the TNFa is released upon acidification in the endosome and degraded, thereby depleting TNFa.
- the TfR and selective depletion complex are recycled to the cell surface. Depletion of TNFa reduces cytokine signaling in the CNS, reducing neuroinflammation, thereby treating the CNS inflammatory disorder.
- This example describes selective depletion of CD47 using a selective depletion complex.
- a selective depletion complex containing a TfR-binding peptide and a CD47-binding peptide, where one of the binding peptides is pH-dependent in its binding and the other binding peptide is pH-independent in its binding is contacted to a cell expressing TfR and CD47.
- the selective depletion complex cooperatively binds to TfR via the TfR-binding peptide and to CD47 via the CD47-binding peptide, forming a ternary complex on the cell surface.
- the TfR is endocytosed along with the bound selective depletion complex and CD47.
- the selective depletion complex releases the CD47 and remains bound to the TfR or the SDC released the TfR and remains bound to the CD47.
- the CD47 is degraded in the endosome/lysosome, thereby selectively depleting the CD47.
- This example describes treatment of cancer by selectively depleting CD47.
- a selective depletion complex containing a TfR-binding peptide and a CD47-binding peptide, such as that described in EXAMPLE 31, is administered to a subject having a CD47 positive cancer.
- the selective depletion complex binds at low or no amount to mature red blood cells because mature red blood cells do not express TfR, resulting in preferential binding to cancer cells as compared to red blood cells.
- the selective depletion complex binds to CD47 and TfR on the surface of a cancer cell, and the ternary complex formed from the selective depletion complex, CD47, and TfR is endocytosed.
- the CD47 is trafficked to the endosome/lysosome and degraded, thereby depleting CD47.
- the cell is depleted of CD47, eliminating an immuno-suppressive or anti- apoptotic signal from the cell.
- Depletion of CD47 inhibits evasion of the host immune response by the cancer cell and allows response to various pro-apoptotic signals which increase immune cell attack of or apoptosis of the cancer cell, thereby treating the cancer.
- Treatment of a cancer in a first subject with a selective depletion complex that targets and depletes CD47 is compared to treatment of a cancer in a second subject by administering an antibody that binds CD47.
- the antibody binds to all cells that expressed CD47, including red blood cells.
- CD39 is a cell surface ectoenzyme that degrades ATP to AMP; CD73 then processes AMP to adenosine, which is immunosuppressive, whereas ATP can activate macrophages to secrete IL-1ß and IL- 18 which activate T cells.
- a selective depletion complex (SDC) containing a TfR-binding peptide and a CD39-binding peptide is administered to a subject having a CD39 positive cancer.
- the SDC causes removal of CD39 from the cell surface.
- the cell is depleted of CD39, thereby inhibiting conversion of ATP to AMP.
- the resulting tumor microenvironment contains more ATP and less adenosine than the tumor microenvironment prior to treatment with the SDC.
- the tumor microenvironment becomes more inflammatory and less immunosuppressed, leading to enhanced targeting of the cancer cells by the immune system and for apoptosis, thereby treating the cancer
- the SDC causes the CD39 to be removed from the cell surface at a rate much faster than the rate of regeneration of CD39, leading to extended depletion of CD39 and sustained reduction of ATP processing to adenosine.
- Treatment of a cancer in a first subject with a selective depletion complex that targets and depletes CD39 is compared to treatment of a cancer in a second subject by administering an antibody that binds CD39.
- the concentration of antibody in the second np]e ⁇ o ⁇ n ⁇ dm ⁇ pg ⁇ odji varies over the dosing intervals such that CD39 is not fully occupied by the antibody at all times.
- Low occupancy of CD39 by the anti-CD39 antibody in the second subject results in less adenosine depletion in the second subject compared to the first subject treated with the SDC due to constant activity of the CD39 enzyme in the second subject.
- the antibody also binds to CD39 on the red blood cells of the second subject, causing anemia.
- the SDC does not deplete CD39 from red blood cells in the first subject because the mature red blood cells do not express TfR. As a result, the CD39 is not reduced on the red blood cells of the first subject.
- EXAMPLE 34 Selective Depletion of a Soluble Target Molecule via PD-L1-mediated Endocytosis
- This example describes selective depletion of a soluble target molecule via PD-L1- mediated endocytosis.
- a selective depletion complex (SDC) containing a PD-L1-binding peptide (e.g., any one of SEQ ID NO: 187, SEQ ID NO: 236, SEQ ID NO: 400, or SEQ ID NO: 401) with PD-L1-binding at endosomal pH conjugated to a target-binding peptide is contacted to cells expressing PD-L1.
- the PD-L1-binding peptide binds PD-L1 at both physiologic extracellular pH (such as pH 7.4) and at endosomal pH (such as pH 5.5), and the target-binding peptide binds to a soluble target molecule with higher affinity at physiologic extracellular pH and with lower affinity at endosomal pH.
- the PD-L1-binding peptide Upon contact, the PD-L1-binding peptide binds to PD- L1 on the cell surface, and the target-binding peptide binds to the soluble target molecule in solution.
- the PD-L1-binding SDC undergoes the same recycling process illustrated in FIG. 12A, rc ⁇ m ⁇ ⁇ RaP-binding CDP (p d _ _ o) ⁇ ⁇ i_ ( g ) are substituted with ⁇ NB-L1-binding CDP _ _ _ ⁇ NB-L1 ( g ), m ⁇ nk ⁇ odq ⁇ gt.
- Rc ⁇ QBA binds to the soluble target molecule, as illustrated in FIG.12A (1).
- the complex formed from the SDC, PD-L1, and the target molecule is endocytosed via PD-L1-mediated endocytosis as illustrated in FIG.12A (2).
- the endosomal compartment acidifies, the target molecule is released from the target-binding peptide, as illustrated in FIG.12A (3).
- the target molecule is then degraded in a lysosomal compartment, as illustrated in FIG. 12A (4), and the complex is recycled to the cell surface along with the PD-L1, as illustrated in FIG. 12A (5).
- a selective depletion complex (SDC) containing a PD-Ll-binding peptide e.g., any one of any one of SEQ ID NO: 187, SEQ ID NO: 235 - SEQ ID NO: 239,
- SEQ ID NO: 400 with PD-Ll-binding at endosomal pH conjugated to a target-binding peptide is contacted to cells expressing PD-L1.
- the PD-Ll-binding peptide binds PD-L1 at both physiologic extracellular pH (such as at pH 7.4) and at endosomal pH (such as at pH 5.5), and the target-binding peptide binds to a surface target molecule with higher affinity at physiologic extracellular pH and with lower affinity at endosomal pH.
- the PD-Ll-binding peptide Upon contact, the PD-Ll- binding peptide binds to PD-L1 on the cell surface, and the target-binding peptide binds to the target molecule on the cell surface.
- the PD-Ll-binding SDC undergoes the same recycling process illustrated in FIG. 12B, where “TfR-binding CDP (pH- independent)” and “TfR (Recycling)” are substituted with “PD-Ll-binding CDP (pH- independent)” and “PD-L1 (Recycling),” respectively.
- the SDC binds to the cell surface target molecule, as illustrated in FIG. 12B (1).
- the complex formed from the SDC, PD-L1, and the target molecule is endocytosed via PD-Ll-mediated endocytosis as illustrated in FIG. 12B (2).
- the endosomal compartment acidifies, the target molecule is released from the target-binding peptide, as illustrated in FIG. 12B (3).
- the target molecule is then degraded in a lysosomal compartment, as illustrated in FIG. 12B (4), and the complex is recycled to the cell surface along with the PD- Ll, as illustrated in FIG. 12B (5).
- This example describes selective depletion of HLA-G using a selective depletion complex that binds PD-L1.
- a selective depletion complex (SDC) containing a PD-Ll-binding peptide and an HLA-G-binding peptide is constructed.
- SDC selective depletion complex
- PD-L1 binding peptide such as a PD-Ll-binding peptide of SEQ ID NO: 187, SEQ ID NO: 236, SEQ ID NO: 400, or SEQ
- ID NO: 401 binds PD-L1 at both extracellular and endosomal pH, and the HLA-G-binding peptide binds HLA-G with high affinity at extracellular pH and lower affinity at endosomal pH.
- the PD-L1 binding peptide such as a PD-Ll-binding peptide of SEQ ID NO: 233 or SEQ ID NO: 234, binds PD-L1 at extracellular pH and lower affinity at endosomal pH, and the HLA-G-binding peptide binds HLA-G with high affinity at both extracellular and endosomal pH.
- the SDC of this example is contacted to a cancer cell.
- the SDC binds PD-L1 and HLA-G expressed on the surface of the cancer cell, forming a ternary complex.
- the SDC is endocytosed along with the PD-L1 and the HLA-G.
- the SDC releases the HLA-G upon acidification of the endosome and the HLA-G is targeted to the endosomal/lysosomal system for degradation. If the PD-L1 -binding peptide binds PD-L1 with high affinity at both extracellular and endosomal pH, the SDC is recycled back to the cell surface, where it may bind another HLA-G for degradation.
- the SDC releases the PD-L1 upon acidification of the endosome, and the HLA-G and the SDC may be trafficked to the endosomal/lysosomal system.
- the PD-L1 may be recycled back to the cell surface.
- This example describes the structure of a high-affinity PD-Ll-binding cystine dense peptide.
- a PD-Ll-binding CDP (SEQ ID NO: 187) was co-cry stalized with PD-L1 to confirm the CDP binding site and visualize the surface interactions with PD-L1, as shown in FIG. 26A.
- SEQ ID NO: 187 a variant that eliminated a canonical N-linked glycosite acquired during affinity maturation, was produced as a soluble molecule as described in EXAMPLE 1 and was co-crystalized with PD-L1.
- the resolved portion had an interface surface area of 620 A 2 as assessed by PISA (PDBe PISA vl.52), which was similar to the observed interface surface area of PD-L1 with PD-1 (622 A 2 , PDB 4ZQK).
- the CDP’s location on PD-L1 fell squarely within both the PD-1 occupancy space, as shown in FIG. 26C, showing the in silico low-resolution docking enrichment was predictive of the interface of this hit.
- Both K5 of SEQ ID NO: 187 and K78 of PD-1 made a salt bridge with the A121 backbone oxygen of PD-L1, while both D44 of SEQ ID NO: 187 and E136 of PD-1 similarly formed a salt bridge with Y123 of PD-L1.
- F40 of SEQ ID NO: 187 sat in pocket formed by Y56, R113, M115, and Y123 of PD-L1, making hydrophobic contacts (M115), herringbone ring stacking interactions (orj W ⁇ n), ⁇ i_ ⁇ ⁇ odji-pi interaction (R113). This pocket was also occupied by I134 of PD-1.
- V9, W12, and L43 of SEQ ID NO: 187 also shared sites of hydrophobic interactions used by L128, A132, and I126 of PD-1, respectively.
- the interface-adjacent mutations that differentiated SEQ ID NO: 187 from its parental scaffold would be expected to disrupt binding when reverted to the parental side chains, as illustrated in FIG.26E.
- the hydrophobic interactions of both M13 and L43 with the surface of PD-L1 would be lost in the parental A13 and V43; the pocket occupied by F40 would have to distort to accommodate the parental W40, altering the interface elsewhere; and parental F39 does not neatly fit against the surface as V39 does.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Diabetes (AREA)
- Virology (AREA)
- Cell Biology (AREA)
- Obesity (AREA)
- Emergency Medicine (AREA)
- Endocrinology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Steroid Compounds (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3195315A CA3195315A1 (en) | 2020-11-30 | 2021-11-29 | Compositions and methods for selective depletion of target molecules |
| EP21899190.9A EP4251130A4 (en) | 2020-11-30 | 2021-11-29 | Compositions and methods for selective depletion of target molecules |
| AU2021386254A AU2021386254A1 (en) | 2020-11-30 | 2021-11-29 | Compositions and methods for selective depletion of target molecules |
| CN202180089144.7A CN117279618A (zh) | 2020-11-30 | 2021-11-29 | 用于靶标分子的选择性耗竭的组合物和方法 |
| JP2023532341A JP2023551481A (ja) | 2020-11-30 | 2021-11-29 | 標的分子の選択的枯渇のための組成物及び方法 |
| US18/037,923 US20250195673A1 (en) | 2020-11-30 | 2021-11-29 | Compositions and methods for selective depletion of target molecules |
| IL303152A IL303152A (en) | 2020-11-30 | 2021-11-29 | Compositions and methods for selective depletion of target molecules |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063119195P | 2020-11-30 | 2020-11-30 | |
| US63/119,195 | 2020-11-30 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022115715A1 true WO2022115715A1 (en) | 2022-06-02 |
Family
ID=81754931
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/061035 Ceased WO2022115715A1 (en) | 2020-11-30 | 2021-11-29 | Compositions and methods for selective depletion of target molecules |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20250195673A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4251130A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2023551481A (cg-RX-API-DMAC7.html) |
| CN (1) | CN117279618A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2021386254A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3195315A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL303152A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2022115715A1 (cg-RX-API-DMAC7.html) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023235522A1 (en) * | 2022-06-02 | 2023-12-07 | Blaze Bioscience, Inc. | Compositions and methods for selective depletion of egfr target molecules |
| WO2023244540A1 (en) * | 2022-06-13 | 2023-12-21 | Denali Therapeutics Inc. | A quantitative pharmacological model of enzyme replacement therapy |
| WO2024092033A1 (en) * | 2022-10-26 | 2024-05-02 | Amgen Inc. | Multispecific molecules for clearance of immunoglobulins in the treatment of autoantibody-induced diseases |
| EP4424703A1 (en) * | 2023-03-02 | 2024-09-04 | Amylonix AB | Polypeptides for transferrin receptor-mediated transcytosis |
| WO2025054465A1 (en) * | 2023-09-08 | 2025-03-13 | California Institute Of Technology | Compositions for transport of therapeutic cargos using miniprotein binders targeting ca-iv |
| WO2025076243A1 (en) * | 2023-10-03 | 2025-04-10 | Ionis Pharmaceuticals, Inc. | Cell-targeting complexes and uses thereof |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| IL303149A (en) * | 2020-11-30 | 2023-07-01 | Fred Hutchinson Cancer Center | Pd-l1 binding peptides and peptide complexes and methods of use thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040157330A1 (en) * | 2003-01-09 | 2004-08-12 | Arizeke Pharmaceuticals, Inc. | Compositions and methods for targeted biological delivery of molecular carriers |
| WO2019199634A1 (en) * | 2018-04-09 | 2019-10-17 | Yale University | Bifunctional small molecules to target the selective degradation of circulating proteins |
| WO2020124032A1 (en) * | 2018-12-14 | 2020-06-18 | Fred Hutchinson Cancer Research Center | Transferrin receptor targeting peptides |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8808697B2 (en) * | 2010-04-28 | 2014-08-19 | Oncoimmune, Inc. | Methods of use of soluble CD24 for therapy of rheumatoid arthritis |
| RU2013150331A (ru) * | 2011-04-20 | 2015-05-27 | Рош Гликарт Аг | СПОСОБ И УСТРОЙСТВА ДЛЯ рН-ЗАВИСИМОГО ПРОХОЖДЕНИЯ ГЕМАТОЭНЦЕФАЛИЧЕСКОГО БАРЬЕРА |
| LT3071597T (lt) * | 2013-11-21 | 2020-10-12 | F. Hoffmann-La Roche Ag | Antikūnai prieš alfa-sunukleiną ir jų naudojimo būdai |
| CN115925878A (zh) * | 2015-06-05 | 2023-04-07 | 艾比欧公司 | 用于治疗纤维化的内皮抑素片段和变体 |
-
2021
- 2021-11-29 CN CN202180089144.7A patent/CN117279618A/zh active Pending
- 2021-11-29 EP EP21899190.9A patent/EP4251130A4/en active Pending
- 2021-11-29 JP JP2023532341A patent/JP2023551481A/ja active Pending
- 2021-11-29 AU AU2021386254A patent/AU2021386254A1/en not_active Abandoned
- 2021-11-29 US US18/037,923 patent/US20250195673A1/en active Pending
- 2021-11-29 IL IL303152A patent/IL303152A/en unknown
- 2021-11-29 WO PCT/US2021/061035 patent/WO2022115715A1/en not_active Ceased
- 2021-11-29 CA CA3195315A patent/CA3195315A1/en active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040157330A1 (en) * | 2003-01-09 | 2004-08-12 | Arizeke Pharmaceuticals, Inc. | Compositions and methods for targeted biological delivery of molecular carriers |
| WO2019199634A1 (en) * | 2018-04-09 | 2019-10-17 | Yale University | Bifunctional small molecules to target the selective degradation of circulating proteins |
| WO2020124032A1 (en) * | 2018-12-14 | 2020-06-18 | Fred Hutchinson Cancer Research Center | Transferrin receptor targeting peptides |
Non-Patent Citations (4)
| Title |
|---|
| BANIK ET AL.: "Lysosome-targeting chimaeras for degradation of extracellular proteins", NATURE, vol. 584, no. 7820, 13 August 2020 (2020-08-13), pages 291 - 297, XP037281719, Retrieved from the Internet <URL:https://www.proquest.com/docview/2434499538/FF4A0423AAF34897PQ/1?accountid=142944> [retrieved on 20220112] * |
| ELDEEB MOHAMED A., ZORCA CORNELIA E., GOIRAN THOMAS: "Extracellular protein degradation via the lysosome", COMMUN CHEM, vol. 3, no. 149, 30 October 2020 (2020-10-30), pages 1 - 3, XP055941487, Retrieved from the Internet <URL:https://www.nature.com/articles/s42004-020-00397-8> [retrieved on 20220112] * |
| NALAWANSHA DHANUSHA A., PAIVA STACEY-LYNN, RAFIZADEH DIANE N., PETTERSSON MARIELL, QIN LIENA, CREWS CRAIG M.: "Targeted Protein Internalization and Degradation by ENDosome TArgeting Chimeras (ENDTACs)", ACS CENTRAL SCIENCE, vol. 5, no. 6, 9 May 2019 (2019-05-09), pages 1079 - 1084, XP055941483, Retrieved from the Internet <URL:https://pubs.acs.org/doi/10.1021/acscentsci.9b00224> [retrieved on 20220112] * |
| See also references of EP4251130A4 * |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023235522A1 (en) * | 2022-06-02 | 2023-12-07 | Blaze Bioscience, Inc. | Compositions and methods for selective depletion of egfr target molecules |
| WO2023244540A1 (en) * | 2022-06-13 | 2023-12-21 | Denali Therapeutics Inc. | A quantitative pharmacological model of enzyme replacement therapy |
| WO2024092033A1 (en) * | 2022-10-26 | 2024-05-02 | Amgen Inc. | Multispecific molecules for clearance of immunoglobulins in the treatment of autoantibody-induced diseases |
| EP4424703A1 (en) * | 2023-03-02 | 2024-09-04 | Amylonix AB | Polypeptides for transferrin receptor-mediated transcytosis |
| WO2024180253A1 (en) * | 2023-03-02 | 2024-09-06 | Amylonix Ab | Polypeptides for transferrin receptor-mediated transcytosis |
| WO2025054465A1 (en) * | 2023-09-08 | 2025-03-13 | California Institute Of Technology | Compositions for transport of therapeutic cargos using miniprotein binders targeting ca-iv |
| WO2025076243A1 (en) * | 2023-10-03 | 2025-04-10 | Ionis Pharmaceuticals, Inc. | Cell-targeting complexes and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4251130A4 (en) | 2024-12-11 |
| CN117279618A (zh) | 2023-12-22 |
| EP4251130A1 (en) | 2023-10-04 |
| IL303152A (en) | 2023-07-01 |
| AU2021386254A1 (en) | 2023-06-29 |
| JP2023551481A (ja) | 2023-12-08 |
| CA3195315A1 (en) | 2022-06-02 |
| US20250195673A1 (en) | 2025-06-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250195673A1 (en) | Compositions and methods for selective depletion of target molecules | |
| JP7517997B2 (ja) | プログラニュリンを含む融合タンパク質 | |
| JP5828889B2 (ja) | プロリン/アラニンランダムコイルポリペプチドの生合成およびその使用 | |
| RU2645256C2 (ru) | Высокостабильный т-клеточный рецептор и способ его получения и применения | |
| WO2023235522A1 (en) | Compositions and methods for selective depletion of egfr target molecules | |
| TWI598361B (zh) | Cx3cr1-結合多肽 | |
| JP6738340B2 (ja) | 新規なegfr結合タンパク質 | |
| KR20180002734A (ko) | IgG 결합 펩타이드에 의한 항체의 특이적 변형 | |
| EP3218411A2 (en) | Variable new antigen receptors (vnars) directed against transferrin receptor (tfr) and their use | |
| KR20130010461A (ko) | Il―23에 결합하는 피브로넥틴 기반 스캐폴드 도메인 단백질 | |
| JP2013512683A5 (cg-RX-API-DMAC7.html) | ||
| CN113227134A (zh) | 抗体的Fc区变体 | |
| JP2023514420A (ja) | 変異型rasタンパク質を標的化する分子 | |
| US20190077839A1 (en) | Evasins for use in therapy and diagnostics | |
| US20230287046A1 (en) | Molecules targeting proteins | |
| KR102917499B1 (ko) | 백혈병 억제 인자 활성을 억제하기 위한 가용성 폴리펩타이드 및 이의 사용 방법 | |
| CN117396519A (zh) | 肾脏活性融合蛋白以及使用其的治疗方法 | |
| WO2024249812A2 (en) | Egf variants and methods of use thereof | |
| KR20230030649A (ko) | 인간 il23 수용체에 결합하는 폴리펩타이드 | |
| AU2013203326B2 (en) | Biological active proteins having increased in vivo and/or in vitro stability | |
| HK40080054A (en) | Molecules targeting proteins | |
| HK1156980B (en) | Biological active proteins having increased in vivo and/or vitro stability | |
| HK1156980A1 (en) | Biological active proteins having increased in vivo and/or vitro stability |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21899190 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3195315 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023532341 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 2021386254 Country of ref document: AU Date of ref document: 20211129 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202180089144.7 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 2021899190 Country of ref document: EP Effective date: 20230630 |
|
| WWP | Wipo information: published in national office |
Ref document number: 18037923 Country of ref document: US |